Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|9165
Gene name
LocationContig_648:3787..4247
Strand-
Gene length (bp)460
Transcript length (bp)351
Coding sequence length (bp)351
Protein length (aa) 117

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF14138 COX16 Cytochrome c oxidase assembly protein COX16 6.2E-30 32 109

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q4I8P5|COX16_GIBZE Cytochrome c oxidase assembly protein COX16, mitochondrial OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=COX16 PE=3 SV=1 1 115 5.0E-56
sp|Q7SI11|COX16_NEUCR Cytochrome c oxidase assembly protein cox16, mitochondrial OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=cox-9 PE=3 SV=1 3 115 1.0E-46
sp|Q0UIR3|COX16_PHANO Cytochrome c oxidase assembly protein COX16, mitochondrial OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=COX16 PE=3 SV=2 1 115 4.0E-40
sp|A1C8Z3|COX16_ASPCL Cytochrome c oxidase assembly protein cox16, mitochondrial OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=cox16 PE=3 SV=2 1 115 1.0E-35
sp|Q1DME3|COX16_COCIM Cytochrome c oxidase assembly protein COX16, mitochondrial OS=Coccidioides immitis (strain RS) GN=COX16 PE=3 SV=1 1 115 2.0E-34
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q4I8P5|COX16_GIBZE Cytochrome c oxidase assembly protein COX16, mitochondrial OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=COX16 PE=3 SV=1 1 115 5.0E-56
sp|Q7SI11|COX16_NEUCR Cytochrome c oxidase assembly protein cox16, mitochondrial OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=cox-9 PE=3 SV=1 3 115 1.0E-46
sp|Q0UIR3|COX16_PHANO Cytochrome c oxidase assembly protein COX16, mitochondrial OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=COX16 PE=3 SV=2 1 115 4.0E-40
sp|A1C8Z3|COX16_ASPCL Cytochrome c oxidase assembly protein cox16, mitochondrial OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=cox16 PE=3 SV=2 1 115 1.0E-35
sp|Q1DME3|COX16_COCIM Cytochrome c oxidase assembly protein COX16, mitochondrial OS=Coccidioides immitis (strain RS) GN=COX16 PE=3 SV=1 1 115 2.0E-34
sp|Q2PIY2|COX16_ASPOR Cytochrome c oxidase assembly protein cox16, mitochondrial OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=cox16 PE=3 SV=1 1 115 2.0E-34
sp|Q5AXJ9|COX16_EMENI Cytochrome c oxidase assembly protein cox16, mitochondrial OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=cox16 PE=3 SV=2 1 115 8.0E-34
sp|Q52ZA1|COX16_PARBD Cytochrome c oxidase assembly protein COX16, mitochondrial OS=Paracoccidioides brasiliensis (strain Pb18) GN=COX16 PE=2 SV=1 3 113 4.0E-33
sp|Q75FA7|COX16_ASHGO Cytochrome c oxidase assembly protein COX16, mitochondrial OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=COX16 PE=3 SV=1 3 114 8.0E-27
sp|P47081|COX16_YEAST Cytochrome c oxidase assembly protein COX16, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=COX16 PE=1 SV=1 3 114 2.0E-26
sp|Q6CK73|COX16_KLULA Cytochrome c oxidase assembly protein COX16, mitochondrial OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=COX16 PE=3 SV=1 4 114 3.0E-26
sp|Q6FW43|COX16_CANGA Cytochrome c oxidase assembly protein COX16, mitochondrial OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=COX16 PE=3 SV=1 3 115 1.0E-25
sp|Q6CCF6|COX16_YARLI Cytochrome c oxidase assembly protein COX16, mitochondrial OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=COX16 PE=3 SV=1 4 115 4.0E-24
sp|Q6BY05|COX16_DEBHA Cytochrome c oxidase assembly protein COX16, mitochondrial OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=COX16 PE=3 SV=1 4 93 2.0E-17
sp|Q5ACH7|COX16_CANAL Cytochrome c oxidase assembly protein COX16, mitochondrial OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=COX16 PE=3 SV=1 3 106 3.0E-17
sp|P0CM84|COX16_CRYNJ Cytochrome c oxidase assembly protein COX16, mitochondrial OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=COX16 PE=3 SV=1 24 106 2.0E-14
sp|P0CM85|COX16_CRYNB Cytochrome c oxidase assembly protein COX16, mitochondrial OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=COX16 PE=3 SV=1 24 106 2.0E-14
sp|Q9UTK1|COX16_SCHPO Cytochrome c oxidase assembly protein cox16, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cox16 PE=3 SV=1 17 110 3.0E-14
[Show less]

GO

GO Term Description Terminal node
GO:0031966 mitochondrial membrane Yes
GO:0031090 organelle membrane No
GO:0005575 cellular_component No
GO:0044446 intracellular organelle part No
GO:0044444 cytoplasmic part No
GO:0044464 cell part No
GO:0044429 mitochondrial part No
GO:0044424 intracellular part No
GO:0016020 membrane No
GO:0044422 organelle part No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 36 0.5

Transmembrane Domains

Domain # Start End Length
1 31 53 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|9165
MPTFQSKRFRAASEAARPGARYRALLARRPFLSFGLPFVAAVVAGSVVLTRATAVRYERHDRRVRQLTRDEELGV
RRAGRRVDMRDEYYRLAGRDLDDWEQKRVERLPGESDGILR*
Coding >Hirsu2|9165
ATGCCGACCTTCCAGAGCAAGCGGTTCCGGGCGGCGAGCGAGGCCGCGCGCCCCGGGGCGCGGTACCGGGCGCTG
CTGGCGCGGCGGCCCTTCCTCAGCTTCGGCCTGCCGTTCGTGGCGGCCGTGGTGGCCGGGTCGGTGGTGCTGACG
CGCGCGACGGCCGTGCGCTACGAGCGGCATGACCGTCGCGTGCGGCAGCTCACGCGGGATGAGGAGCTGGGCGTG
CGCCGGGCTGGGCGCCGCGTCGACATGCGTGACGAGTACTACCGACTGGCCGGCCGCGACCTCGACGACTGGGAG
CAGAAGCGGGTCGAGCGCCTGCCGGGCGAGAGCGACGGGATCCTGCGCTGA
Transcript >Hirsu2|9165
ATGCCGACCTTCCAGAGCAAGCGGTTCCGGGCGGCGAGCGAGGCCGCGCGCCCCGGGGCGCGGTACCGGGCGCTG
CTGGCGCGGCGGCCCTTCCTCAGCTTCGGCCTGCCGTTCGTGGCGGCCGTGGTGGCCGGGTCGGTGGTGCTGACG
CGCGCGACGGCCGTGCGCTACGAGCGGCATGACCGTCGCGTGCGGCAGCTCACGCGGGATGAGGAGCTGGGCGTG
CGCCGGGCTGGGCGCCGCGTCGACATGCGTGACGAGTACTACCGACTGGCCGGCCGCGACCTCGACGACTGGGAG
CAGAAGCGGGTCGAGCGCCTGCCGGGCGAGAGCGACGGGATCCTGCGCTGA
Gene >Hirsu2|9165
ATGCCGACCTTCCAGAGCAAGCGGTTCCGGGCGGCGAGCGAGGCCGCGCGCCCCGGGGCGCGGTACCGGGCGCTG
CTGGCGCGGCGGCCCTTCCTCAGCTTCGGCCTGCCGTTCGTGGCGGCCGTGGTGGCCGGGTCGGTGGTGCTGACG
CGCGCGACGGCCGTGCGCTACGAGCGGCATGACCGTCGCGTGCGGCAGCTCACGCGGGATGAGGAGCTGGGCGTG
CGCCGGGCTGGGCGCCGCGTCGACATGCGTGACGAGTACTACGTGCGTTGTTGTTTTTTTTTCCCCTTCCCTCCC
TCTCTGTCTTGCTCTTTTTTCTCTCTCTCTGTCTTGCTCGTCCTCCTCCCTGCTGACACGATCGGTGGCCCGACA
GCGACTGGCCGGCCGCGACCTCGACGACTGGGAGCAGAAGCGGGTCGAGCGCCTGCCGGGCGAGAGCGACGGGAT
CCTGCGCTGA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail