Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|9160
Gene name
LocationContig_647:8341..8818
Strand-
Gene length (bp)477
Transcript length (bp)366
Coding sequence length (bp)366
Protein length (aa) 122

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain 2.9E-15 15 98

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q12184|ADRX_YEAST Adrenodoxin homolog, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YAH1 PE=1 SV=1 3 121 4.0E-58
sp|Q8S904|MFDX2_ARATH Adrenodoxin-like protein 2, mitochondrial OS=Arabidopsis thaliana GN=MFDX2 PE=2 SV=1 7 120 2.0E-43
sp|Q9M0V0|MFDX1_ARATH Adrenodoxin-like protein 1, mitochondrial OS=Arabidopsis thaliana GN=MFDX1 PE=1 SV=1 7 120 4.0E-40
sp|Q9AKM6|FER2_RICMO 2Fe-2S ferredoxin OS=Rickettsia montanensis GN=fdxB PE=3 SV=1 8 116 2.0E-38
sp|Q92J08|FER2_RICCN 2Fe-2S ferredoxin OS=Rickettsia conorii (strain ATCC VR-613 / Malish 7) GN=fdxB PE=3 SV=1 8 116 8.0E-38
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q12184|ADRX_YEAST Adrenodoxin homolog, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YAH1 PE=1 SV=1 3 121 4.0E-58
sp|Q8S904|MFDX2_ARATH Adrenodoxin-like protein 2, mitochondrial OS=Arabidopsis thaliana GN=MFDX2 PE=2 SV=1 7 120 2.0E-43
sp|Q9M0V0|MFDX1_ARATH Adrenodoxin-like protein 1, mitochondrial OS=Arabidopsis thaliana GN=MFDX1 PE=1 SV=1 7 120 4.0E-40
sp|Q9AKM6|FER2_RICMO 2Fe-2S ferredoxin OS=Rickettsia montanensis GN=fdxB PE=3 SV=1 8 116 2.0E-38
sp|Q92J08|FER2_RICCN 2Fe-2S ferredoxin OS=Rickettsia conorii (strain ATCC VR-613 / Malish 7) GN=fdxB PE=3 SV=1 8 116 8.0E-38
sp|Q4UKL2|FER2_RICFE 2Fe-2S ferredoxin OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=fdxB PE=3 SV=1 8 116 8.0E-38
sp|Q9AKH1|FER2_RICRI 2Fe-2S ferredoxin OS=Rickettsia rickettsii GN=fdxB PE=3 SV=1 8 116 2.0E-37
sp|Q9ZDW6|FER2_RICPR 2Fe-2S ferredoxin OS=Rickettsia prowazekii (strain Madrid E) GN=fdxB PE=3 SV=1 8 116 8.0E-37
sp|Q9AKC4|FER2_RICTY 2Fe-2S ferredoxin OS=Rickettsia typhi (strain ATCC VR-144 / Wilmington) GN=fdxB PE=3 SV=1 8 121 9.0E-37
sp|Q1RJ69|FER2_RICBR 2Fe-2S ferredoxin OS=Rickettsia bellii (strain RML369-C) GN=fdxB PE=3 SV=1 9 116 2.0E-32
sp|Q6P4F2|ADXL_HUMAN Adrenodoxin-like protein, mitochondrial OS=Homo sapiens GN=FDX1L PE=1 SV=1 2 115 2.0E-30
sp|Q05B51|ADXL_BOVIN Adrenodoxin-like protein, mitochondrial OS=Bos taurus GN=FDX1L PE=2 SV=1 2 115 3.0E-30
sp|Q08C57|ADXL_DANRE Adrenodoxin-like protein, mitochondrial OS=Danio rerio GN=fdx1l PE=2 SV=1 9 115 7.0E-30
sp|Q10361|ETP1_SCHPO Electron transfer protein 1, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=etp1 PE=1 SV=2 3 116 2.0E-29
sp|Q9CPW2|ADXL_MOUSE Adrenodoxin-like protein, mitochondrial OS=Mus musculus GN=Fdx1l PE=1 SV=1 2 115 9.0E-29
sp|Q5FWQ0|ADXL_XENLA Adrenodoxin-like protein, mitochondrial OS=Xenopus laevis GN=fdx1l PE=2 SV=1 7 115 4.0E-28
sp|P37193|ADXH_DROME Adrenodoxin-like protein, mitochondrial OS=Drosophila melanogaster GN=Fdxh PE=2 SV=3 2 115 7.0E-28
sp|P29330|ADX_SHEEP Adrenodoxin OS=Ovis aries GN=FDX1 PE=1 SV=2 7 118 5.0E-26
sp|P10109|ADX_HUMAN Adrenodoxin, mitochondrial OS=Homo sapiens GN=FDX1 PE=1 SV=1 7 118 6.0E-26
sp|P46656|ADX_MOUSE Adrenodoxin, mitochondrial OS=Mus musculus GN=Fdx1 PE=1 SV=1 7 118 2.0E-25
sp|P00257|ADX_BOVIN Adrenodoxin, mitochondrial OS=Bos taurus GN=FDX1 PE=1 SV=2 7 109 2.0E-25
sp|P00258|ADX_PIG Adrenodoxin, mitochondrial OS=Sus scrofa GN=FDX1 PE=1 SV=2 7 109 2.0E-25
sp|P24483|ADX_RAT Adrenodoxin, mitochondrial OS=Rattus norvegicus GN=Fdx1 PE=2 SV=1 7 118 3.0E-25
sp|Q8SV19|ADRX_ENCCU Adrenodoxin homolog OS=Encephalitozoon cuniculi (strain GB-M1) GN=ECU07_0600 PE=3 SV=1 28 121 4.0E-25
sp|P13216|ADX_CHICK Adrenodoxin, mitochondrial (Fragment) OS=Gallus gallus GN=FDX1 PE=1 SV=1 7 118 6.0E-25
sp|P80306|FER6_RHOCA Ferredoxin-6 OS=Rhodobacter capsulatus GN=fdxE PE=1 SV=2 11 109 8.0E-20
sp|P37098|FER2_CAUCR 2Fe-2S ferredoxin OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=fdxB PE=3 SV=1 11 109 4.0E-19
sp|P0A9R6|FER_SHIFL 2Fe-2S ferredoxin OS=Shigella flexneri GN=fdx PE=3 SV=2 23 114 1.0E-18
sp|P0A9R4|FER_ECOLI 2Fe-2S ferredoxin OS=Escherichia coli (strain K12) GN=fdx PE=1 SV=2 23 114 1.0E-18
sp|P0A9R5|FER_ECO57 2Fe-2S ferredoxin OS=Escherichia coli O157:H7 GN=fdx PE=3 SV=2 23 114 1.0E-18
sp|P00259|PUTX_PSEPU Putidaredoxin OS=Pseudomonas putida GN=camB PE=1 SV=3 11 109 2.0E-17
sp|P44428|FER_HAEIN 2Fe-2S ferredoxin OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=fdx PE=3 SV=2 24 114 4.0E-17
sp|P43493|THCC_RHOER Rhodocoxin OS=Rhodococcus erythropolis GN=thcC PE=1 SV=2 11 109 3.0E-16
sp|Q51383|FER_PSEAE 2Fe-2S ferredoxin OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=fdx PE=3 SV=2 23 114 4.0E-16
sp|P33007|TERPB_PSESP Terpredoxin OS=Pseudomonas sp. GN=terPB PE=1 SV=2 10 109 1.0E-14
sp|O51882|FER_BUCAP 2Fe-2S ferredoxin OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=fdx PE=3 SV=1 23 114 7.0E-14
sp|D5IGG4|CARAC_SPHSX Ferredoxin CarAc OS=Sphingomonas sp. GN=carAc PE=1 SV=1 8 109 8.0E-13
sp|Q89A15|FER_BUCBP 2Fe-2S ferredoxin OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=fdx PE=3 SV=1 23 114 3.0E-12
sp|P57661|FER_BUCAI 2Fe-2S ferredoxin OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=fdx PE=3 SV=1 24 100 1.0E-11
sp|P59799|FER5_AQUAE 2Fe-2S ferredoxin-5 OS=Aquifex aeolicus (strain VF5) GN=fdx5 PE=1 SV=2 22 109 1.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0051536 iron-sulfur cluster binding Yes
GO:0009055 electron transfer activity Yes
GO:0016491 oxidoreductase activity No
GO:0048037 cofactor binding No
GO:0051540 metal cluster binding No
GO:0003674 molecular_function No
GO:0003824 catalytic activity No
GO:0005488 binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 34 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|9160
MPPKPGEELHVTFVDKDGQEYKFEVAEGDNLLDIAQANDLEMEGACGGSCACSTCHVIVADESYYDKMPEPEDDE
NDMLDLAFGLTETSRLGCQVKMTKDLDGLVVKLPSMTRNMQASDFQ*
Coding >Hirsu2|9160
ATGCCGCCCAAGCCCGGGGAAGAGCTCCATGTCACCTTTGTCGACAAGGACGGCCAAGAGTACAAGTTCGAAGTC
GCCGAGGGCGACAACCTGCTAGACATTGCCCAGGCCAACGACTTGGAAATGGAGGGCGCGTGCGGCGGGTCCTGC
GCGTGCTCGACATGCCATGTCATCGTCGCGGACGAGTCCTACTACGACAAGATGCCCGAGCCCGAAGACGACGAG
AACGACATGTTGGACCTGGCTTTTGGCCTGACGGAGACGAGCCGCCTGGGCTGCCAGGTGAAGATGACCAAGGAC
CTCGACGGCCTCGTCGTCAAGCTTCCCTCGATGACGAGAAATATGCAGGCCAGTGACTTCCAATGA
Transcript >Hirsu2|9160
ATGCCGCCCAAGCCCGGGGAAGAGCTCCATGTCACCTTTGTCGACAAGGACGGCCAAGAGTACAAGTTCGAAGTC
GCCGAGGGCGACAACCTGCTAGACATTGCCCAGGCCAACGACTTGGAAATGGAGGGCGCGTGCGGCGGGTCCTGC
GCGTGCTCGACATGCCATGTCATCGTCGCGGACGAGTCCTACTACGACAAGATGCCCGAGCCCGAAGACGACGAG
AACGACATGTTGGACCTGGCTTTTGGCCTGACGGAGACGAGCCGCCTGGGCTGCCAGGTGAAGATGACCAAGGAC
CTCGACGGCCTCGTCGTCAAGCTTCCCTCGATGACGAGAAATATGCAGGCCAGTGACTTCCAATGA
Gene >Hirsu2|9160
ATGGTCCGCGCGCCACTTGACGACCACGGCGCCACAACGTCATGGGCACGTCCAGCCGCCCAAGCCCGGGGAAGA
GTAAGTCCTCGACGGGCTGGCCGGCTTCGGCTTTCCACCTGCTGACGAGCGCCGCGCAGGCTCCATGTCACCTTT
GTCGACAAGGACGGCCAAGAGTACAAGTTCGAAGTCGCCGAGGGCGACAACCTGCTAGACATTGCCCAGGCCAAC
GACTTGGAAATGGAGGGCGCGTGCGGCGGGTCCTGCGCGTGCTCGACATGCCATGTCATCGTCGCGGACGAGTCC
TACTACGACAAGATGCCCGAGCCCGAAGACGACGAGAACGACATGTTGGACCTGGCTTTTGGCCTGACGGAGACG
AGCCGCCTGGGCTGCCAGGTGAAGATGACCAAGGACCTCGACGGCCTCGTCGTCAAGCTTCCCTCGATGACGAGA
AATATGCAGGCCAGTGACTTCCAATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail