Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|9157
Gene name
LocationContig_647:3240..4066
Strand-
Gene length (bp)826
Transcript length (bp)636
Coding sequence length (bp)636
Protein length (aa) 212

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01105 EMP24_GP25L emp24/gp25L/p24 family/GOLD 2.4E-47 22 204

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O13770|YE98_SCHPO Uncharacterized membrane protein C17A5.08 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC17A5.08 PE=3 SV=1 1 209 4.0E-57
sp|Q12403|ERP3_YEAST Protein ERP3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ERP3 PE=1 SV=1 20 211 4.0E-31
sp|Q12450|ERP4_YEAST Protein ERP4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ERP4 PE=1 SV=1 27 211 1.0E-25
sp|Q769F9|TMEDA_DICDI Transmembrane emp24 domain-containing protein A OS=Dictyostelium discoideum GN=empA PE=3 SV=1 13 207 4.0E-25
sp|P39704|ERP2_YEAST Protein ERP2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ERP2 PE=1 SV=1 1 211 5.0E-25
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O13770|YE98_SCHPO Uncharacterized membrane protein C17A5.08 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC17A5.08 PE=3 SV=1 1 209 4.0E-57
sp|Q12403|ERP3_YEAST Protein ERP3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ERP3 PE=1 SV=1 20 211 4.0E-31
sp|Q12450|ERP4_YEAST Protein ERP4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ERP4 PE=1 SV=1 27 211 1.0E-25
sp|Q769F9|TMEDA_DICDI Transmembrane emp24 domain-containing protein A OS=Dictyostelium discoideum GN=empA PE=3 SV=1 13 207 4.0E-25
sp|P39704|ERP2_YEAST Protein ERP2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ERP2 PE=1 SV=1 1 211 5.0E-25
sp|O17528|TMED2_CAEEL Suppressor/enhancer of lin-12 protein 9 OS=Caenorhabditis elegans GN=sel-9 PE=1 SV=1 14 204 3.0E-23
sp|Q9Y3B3|TMED7_HUMAN Transmembrane emp24 domain-containing protein 7 OS=Homo sapiens GN=TMED7 PE=1 SV=2 20 207 9.0E-22
sp|D3ZTX0|TMED7_RAT Transmembrane emp24 domain-containing protein 7 OS=Rattus norvegicus GN=Tmed7 PE=1 SV=1 23 207 3.0E-21
sp|Q54BN0|TMEDB_DICDI Transmembrane emp24 domain-containing protein B OS=Dictyostelium discoideum GN=empB PE=3 SV=1 20 211 8.0E-21
sp|A7SXK3|TMED_NEMVE Transmembrane emp24 domain-containing protein OS=Nematostella vectensis GN=v1g194562 PE=3 SV=1 28 207 6.0E-20
sp|Q63524|TMED2_RAT Transmembrane emp24 domain-containing protein 2 OS=Rattus norvegicus GN=Tmed2 PE=1 SV=1 27 207 1.0E-19
sp|Q9R0Q3|TMED2_MOUSE Transmembrane emp24 domain-containing protein 2 OS=Mus musculus GN=Tmed2 PE=1 SV=1 27 207 1.0E-19
sp|Q15363|TMED2_HUMAN Transmembrane emp24 domain-containing protein 2 OS=Homo sapiens GN=TMED2 PE=1 SV=1 27 207 1.0E-19
sp|P49020|TMED2_CRIGR Transmembrane emp24 domain-containing protein 2 (Fragment) OS=Cricetulus griseus GN=TMED2 PE=1 SV=1 27 207 1.0E-19
sp|Q28BQ6|TMED1_XENTR Transmembrane emp24 domain-containing protein 1 OS=Xenopus tropicalis GN=tmed1 PE=2 SV=1 6 208 2.0E-17
sp|Q78IS1|TMED3_MOUSE Transmembrane emp24 domain-containing protein 3 OS=Mus musculus GN=Tmed3 PE=1 SV=1 15 207 4.0E-16
sp|Q6AY25|TMED3_RAT Transmembrane emp24 domain-containing protein 3 OS=Rattus norvegicus GN=Tmed3 PE=1 SV=1 15 207 5.0E-16
sp|Q9Y3Q3|TMED3_HUMAN Transmembrane emp24 domain-containing protein 3 OS=Homo sapiens GN=TMED3 PE=1 SV=1 23 207 5.0E-16
sp|Q9Y3A6|TMED5_HUMAN Transmembrane emp24 domain-containing protein 5 OS=Homo sapiens GN=TMED5 PE=1 SV=1 7 208 1.0E-14
sp|Q6AXN3|TMED5_RAT Transmembrane emp24 domain-containing protein 5 OS=Rattus norvegicus GN=Tmed5 PE=2 SV=1 7 208 1.0E-14
sp|Q9CXE7|TMED5_MOUSE Transmembrane emp24 domain-containing protein 5 OS=Mus musculus GN=Tmed5 PE=1 SV=1 7 208 2.0E-14
sp|Q9I7K5|TMEDE_DROME Transmembrane emp24 domain-containing protein eca OS=Drosophila melanogaster GN=eca PE=2 SV=2 1 207 4.0E-14
sp|Q5R809|TMED5_PONAB Transmembrane emp24 domain-containing protein 5 OS=Pongo abelii GN=TMED5 PE=2 SV=1 7 208 4.0E-14
sp|B4QWH9|TMEDE_DROSI Transmembrane emp24 domain-containing protein eca OS=Drosophila simulans GN=eca PE=3 SV=1 1 207 6.0E-14
sp|B4HJV5|TMEDE_DROSE Transmembrane emp24 domain-containing protein eca OS=Drosophila sechellia GN=eca PE=3 SV=1 1 207 8.0E-14
sp|B3NZM5|TMEDE_DROER Transmembrane emp24 domain-containing protein eca OS=Drosophila erecta GN=eca PE=3 SV=1 1 207 3.0E-13
sp|B4PVC6|TMEDE_DROYA Transmembrane emp24 domain-containing protein eca OS=Drosophila yakuba GN=eca PE=3 SV=1 1 207 3.0E-13
sp|B4NKL0|TMEDE_DROWI Transmembrane emp24 domain-containing protein eca OS=Drosophila willistoni GN=eca PE=3 SV=1 1 207 5.0E-13
sp|B4JG34|TMEDE_DROGR Transmembrane emp24 domain-containing protein eca OS=Drosophila grimshawi GN=eca PE=3 SV=1 1 207 5.0E-13
sp|B4KB41|TMEDE_DROMO Transmembrane emp24 domain-containing protein eca OS=Drosophila mojavensis GN=eca PE=3 SV=1 1 207 5.0E-13
sp|B4LYB8|TMEDE_DROVI Transmembrane emp24 domain-containing protein eca OS=Drosophila virilis GN=eca PE=3 SV=1 1 207 1.0E-12
sp|Q2KJ84|TMED5_BOVIN Transmembrane emp24 domain-containing protein 5 OS=Bos taurus GN=TMED5 PE=2 SV=1 19 208 1.0E-12
sp|Q9BVK6|TMED9_HUMAN Transmembrane emp24 domain-containing protein 9 OS=Homo sapiens GN=TMED9 PE=1 SV=2 10 207 3.0E-12
sp|B4GMC3|TMEDE_DROPE Transmembrane emp24 domain-containing protein eca OS=Drosophila persimilis GN=eca PE=3 SV=1 20 207 4.0E-12
sp|Q295B2|TMEDE_DROPS Transmembrane emp24 domain-containing protein eca OS=Drosophila pseudoobscura pseudoobscura GN=eca PE=3 SV=1 20 207 4.0E-12
sp|Q99KF1|TMED9_MOUSE Transmembrane emp24 domain-containing protein 9 OS=Mus musculus GN=Tmed9 PE=1 SV=2 20 207 8.0E-12
sp|Q5I0E7|TMED9_RAT Transmembrane emp24 domain-containing protein 9 OS=Rattus norvegicus GN=Tmed9 PE=1 SV=1 22 207 1.0E-11
sp|Q3T133|TMED9_BOVIN Transmembrane emp24 domain-containing protein 9 OS=Bos taurus GN=TMED9 PE=1 SV=1 22 207 1.0E-11
sp|B3MTS8|TMEDE_DROAN Transmembrane emp24 domain-containing protein eca OS=Drosophila ananassae GN=eca PE=3 SV=1 20 207 1.0E-11
sp|P32803|EMP24_YEAST Endosomal protein P24B OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=EMP24 PE=1 SV=1 10 204 4.0E-11
sp|Q8R1V4|TMED4_MOUSE Transmembrane emp24 domain-containing protein 4 OS=Mus musculus GN=Tmed4 PE=1 SV=1 9 207 3.0E-10
sp|Q5R7E6|TMED1_PONAB Transmembrane emp24 domain-containing protein 1 OS=Pongo abelii GN=TMED1 PE=2 SV=1 24 113 4.0E-10
sp|Q13445|TMED1_HUMAN Transmembrane emp24 domain-containing protein 1 OS=Homo sapiens GN=TMED1 PE=1 SV=1 24 113 5.0E-10
sp|Q2TBK5|TMED1_BOVIN Transmembrane emp24 domain-containing protein 1 OS=Bos taurus GN=TMED1 PE=2 SV=1 24 113 6.0E-10
sp|Q3V009|TMED1_MOUSE Transmembrane emp24 domain-containing protein 1 OS=Mus musculus GN=Tmed1 PE=1 SV=1 24 113 7.0E-10
sp|Q5BK85|TMED1_RAT Transmembrane emp24 domain-containing protein 1 OS=Rattus norvegicus GN=Tmed1 PE=2 SV=1 24 113 8.0E-10
sp|Q9LIL4|P24B3_ARATH Transmembrane emp24 domain-containing protein p24beta3 OS=Arabidopsis thaliana GN=At3g22845 PE=2 SV=1 10 203 9.0E-10
sp|Q7Z7H5|TMED4_HUMAN Transmembrane emp24 domain-containing protein 4 OS=Homo sapiens GN=TMED4 PE=1 SV=1 20 207 1.0E-09
sp|Q9P7I9|EMP24_SCHPO Endosomal protein P24B OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=emp24 PE=3 SV=1 8 207 6.0E-09
sp|Q9FVU0|P24D4_ARATH Transmembrane emp24 domain-containing protein p24delta4 OS=Arabidopsis thaliana GN=CYB PE=1 SV=1 64 207 2.0E-08
sp|Q9S7M9|P24B2_ARATH Transmembrane emp24 domain-containing protein p24beta2 OS=Arabidopsis thaliana GN=At3g07680 PE=1 SV=1 34 204 6.0E-08
sp|Q6IDL4|P24D3_ARATH Transmembrane emp24 domain-containing protein p24delta3 OS=Arabidopsis thaliana GN=At1g09580 PE=1 SV=1 64 207 1.0E-07
sp|P38819|ERP5_YEAST Protein ERP5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ERP5 PE=1 SV=1 6 203 1.0E-06
sp|Q6BTC2|TMEDA_DEBHA Endoplasmic reticulum vesicle protein 25 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=ERV25 PE=3 SV=2 73 204 6.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 21 0.45

Transmembrane Domains

Domain # Start End Length
1 5 27 22
2 177 199 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|9157
MRLPTIAAGIIACLASNVVATALTYKVAAGEKACFYTDAKKENEKVAFYFAVQSGGSFDVDYLVEGPGGKIILEG
EKERQGDFVFTAQRTGEYSFCFDNEMSTFTEKMIDIEISSEHESRTAQLPSKQGTSPEQTSVLEESIFKISGQLS
TISRNQKYFRTRENRNFSTVNSTEKRIVNFSMIQIGLIVCMGALQVFIVRFFFQGARKGYV*
Coding >Hirsu2|9157
ATGAGACTGCCGACCATAGCAGCAGGCATCATTGCCTGTTTGGCCAGCAATGTTGTGGCCACAGCGTTGACCTAC
AAGGTGGCGGCGGGCGAGAAGGCGTGCTTCTACACGGATGCCAAGAAGGAAAACGAGAAGGTCGCCTTCTACTTT
GCCGTTCAATCTGGCGGCTCGTTCGACGTCGATTACCTCGTCGAGGGGCCGGGCGGCAAGATCATACTCGAGGGC
GAAAAGGAGCGCCAGGGTGACTTTGTGTTTACAGCGCAGCGAACCGGCGAATACTCATTCTGCTTCGACAATGAG
ATGAGCACTTTTACGGAGAAGATGATCGACATTGAGATCTCGAGCGAGCACGAGTCCCGCACAGCGCAACTGCCG
TCCAAGCAGGGCACGTCTCCCGAGCAGACATCGGTCTTGGAGGAGTCCATCTTCAAGATTTCTGGTCAATTGTCG
ACTATTTCGCGAAACCAGAAGTACTTCCGGACTCGCGAGAATCGGAACTTTAGCACCGTCAACAGCACGGAGAAG
CGCATTGTCAACTTTAGCATGATACAAATTGGCCTCATCGTTTGCATGGGCGCCCTGCAGGTCTTTATCGTCAGG
TTCTTCTTCCAGGGCGCACGCAAGGGCTACGTATAA
Transcript >Hirsu2|9157
ATGAGACTGCCGACCATAGCAGCAGGCATCATTGCCTGTTTGGCCAGCAATGTTGTGGCCACAGCGTTGACCTAC
AAGGTGGCGGCGGGCGAGAAGGCGTGCTTCTACACGGATGCCAAGAAGGAAAACGAGAAGGTCGCCTTCTACTTT
GCCGTTCAATCTGGCGGCTCGTTCGACGTCGATTACCTCGTCGAGGGGCCGGGCGGCAAGATCATACTCGAGGGC
GAAAAGGAGCGCCAGGGTGACTTTGTGTTTACAGCGCAGCGAACCGGCGAATACTCATTCTGCTTCGACAATGAG
ATGAGCACTTTTACGGAGAAGATGATCGACATTGAGATCTCGAGCGAGCACGAGTCCCGCACAGCGCAACTGCCG
TCCAAGCAGGGCACGTCTCCCGAGCAGACATCGGTCTTGGAGGAGTCCATCTTCAAGATTTCTGGTCAATTGTCG
ACTATTTCGCGAAACCAGAAGTACTTCCGGACTCGCGAGAATCGGAACTTTAGCACCGTCAACAGCACGGAGAAG
CGCATTGTCAACTTTAGCATGATACAAATTGGCCTCATCGTTTGCATGGGCGCCCTGCAGGTCTTTATCGTCAGG
TTCTTCTTCCAGGGCGCACGCAAGGGCTACGTATAA
Gene >Hirsu2|9157
ATGAGACTGCCGACCATAGCAGCAGGCATCATTGCCTGTTTGGCCAGCAATGTTGTGGCCACAGCGTTGACCTAC
AAGGTGGCGGCGGGCGAGAAGGCGTGCTTCTACACGGATGCCAAGAAGGAAAACGAGAAGGTCGCCTTCTACTTT
GCCGTGCGTGGCCCGAGCCTTTGGACATGATACGTGAATGCTTCTGACCGTTGCGCAATGCAGGTTCAATCTGGC
GGCTCGTTCGACGTCGATTACCTCGTCGAGGGGCCGGGCGGCAAGATCATACTCGAGGGCGAAAAGGAGCGCCAG
GGTGACTTTGTGTTTACAGCGCAGCGAACCGGCGAATACTCATTCTGCTTCGACAATGAGATGAGCACTTTTACG
GAGAAGATGATCGACATTGAGATCTCGGTCAGTCCCGCTGTCCGGACTGGGTGAAGGCAGGCAAATTGCTAACCC
GATCCTCGATGCAGAGCGAGCACGAGTCCCGCACAGCGCAACTGCCGTCCAAGCAGGGCACGTCTCCCGAGCAGA
CATCGGTCTTGGAGGAGTCCATCTTCAAGATTTCTGGTCAATTGTCGACTATTTCGCGAAACCAGAAGTACTTCC
GGACTCGCGAGAATCGGAACTTTAGCACCGTCAACAGCACGGAGAAGCGCATTGTCAACTTTAGCATGATACAAA
TTGGCCTCATCGTTTGCATGGGCGCCCTGCAGGTCTTTATCGTCAGGTTCTTCTTCCAGGTAGGCCTTGTCCCAT
ACTCGAGCCACGCCCCCGCATTGGCTGACTCGATTTTCCCTTTGCACTTCAGGGCGCACGCAAGGGCTACGTATA
A

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail