Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|9152
Gene name
LocationContig_646:7221..7992
Strand-
Gene length (bp)771
Transcript length (bp)651
Coding sequence length (bp)651
Protein length (aa) 217

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05995 CDO_I Cysteine dioxygenase type I 2.5E-44 44 194

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|D4AN26|CDO_ARTBC Cysteine dioxygenase OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=CDO1 PE=1 SV=2 10 215 2.0E-76
sp|D1MF76|CDO_ARTBE Cysteine dioxygenase OS=Arthroderma benhamiae GN=CDO1 PE=1 SV=1 10 215 3.0E-76
sp|Q5RLY7|CDO_AJECG Cysteine dioxygenase OS=Ajellomyces capsulatus (strain G186AR / H82 / ATCC MYA-2454 / RMSCC 2432) GN=CDO1 PE=2 SV=2 21 215 1.0E-72
sp|Q5A3Z5|CDO_CANAL Cysteine dioxygenase CDG1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CDG1 PE=2 SV=1 25 215 2.0E-47
sp|Q20893|CDO1_CAEEL Cysteine dioxygenase 1 OS=Caenorhabditis elegans GN=cdo-1 PE=3 SV=2 26 213 8.0E-47
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|D4AN26|CDO_ARTBC Cysteine dioxygenase OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=CDO1 PE=1 SV=2 10 215 2.0E-76
sp|D1MF76|CDO_ARTBE Cysteine dioxygenase OS=Arthroderma benhamiae GN=CDO1 PE=1 SV=1 10 215 3.0E-76
sp|Q5RLY7|CDO_AJECG Cysteine dioxygenase OS=Ajellomyces capsulatus (strain G186AR / H82 / ATCC MYA-2454 / RMSCC 2432) GN=CDO1 PE=2 SV=2 21 215 1.0E-72
sp|Q5A3Z5|CDO_CANAL Cysteine dioxygenase CDG1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CDG1 PE=2 SV=1 25 215 2.0E-47
sp|Q20893|CDO1_CAEEL Cysteine dioxygenase 1 OS=Caenorhabditis elegans GN=cdo-1 PE=3 SV=2 26 213 8.0E-47
sp|Q60TI7|CDO_CAEBR Cysteine dioxygenase OS=Caenorhabditis briggsae GN=cdo-1 PE=3 SV=1 26 213 2.0E-46
sp|Q5RBQ7|CDO1_PONAB Cysteine dioxygenase type 1 OS=Pongo abelii GN=CDO1 PE=2 SV=1 46 212 2.0E-45
sp|Q16878|CDO1_HUMAN Cysteine dioxygenase type 1 OS=Homo sapiens GN=CDO1 PE=1 SV=2 46 212 2.0E-45
sp|P21816|CDO1_RAT Cysteine dioxygenase type 1 OS=Rattus norvegicus GN=Cdo1 PE=1 SV=1 46 212 3.0E-44
sp|P60334|CDO1_MOUSE Cysteine dioxygenase type 1 OS=Mus musculus GN=Cdo1 PE=1 SV=1 46 212 3.0E-44
sp|Q3SZU4|CDO1_BOVIN Cysteine dioxygenase type 1 OS=Bos taurus GN=CDO1 PE=2 SV=1 46 212 4.0E-44
sp|Q6NWZ9|CDO1_DANRE Cysteine dioxygenase type 1 OS=Danio rerio GN=cdo1 PE=2 SV=1 43 212 3.0E-42
sp|Q9U8F1|CDO_SCHJA Cysteine dioxygenase OS=Schistosoma japonicum GN=CDO PE=2 SV=1 43 215 5.0E-30
[Show less]

GO

GO Term Description Terminal node
GO:0016702 oxidoreductase activity, acting on single donors with incorporation of molecular oxygen, incorporation of two atoms of oxygen Yes
GO:0005506 iron ion binding Yes
GO:0055114 oxidation-reduction process Yes
GO:0046872 metal ion binding No
GO:0016491 oxidoreductase activity No
GO:0043169 cation binding No
GO:0008152 metabolic process No
GO:0008150 biological_process No
GO:0043167 ion binding No
GO:0003674 molecular_function No
GO:0051213 dioxygenase activity No
GO:0016701 oxidoreductase activity, acting on single donors with incorporation of molecular oxygen No
GO:0003824 catalytic activity No
GO:0046914 transition metal ion binding No
GO:0005488 binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 17 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|9152
MAVDVVSSSVPAAVKGVVGDVPSNRFEELVLALKDALGPSSGLTSDDVDVGYLTRLMNSYGSSPAEWSKYAFGDS
SRGYTRNLVDEGNGKSNLLVLVWSPGKGSPIHDHGNAHCLMKILRGNLTETRYAFPDEDGPEEPMKVISEKTYKE
DAVAYMADELGLHRVSNRGSDFAVSLHLYTPPNVAKGGCHIFDEKTGKSSHVPGCHYYSAYGRLLK*
Coding >Hirsu2|9152
ATGGCCGTCGACGTCGTTTCCTCTTCCGTCCCCGCGGCCGTCAAGGGCGTCGTGGGCGATGTGCCCTCCAACCGC
TTCGAGGAGCTGGTCCTGGCCCTCAAGGATGCGCTTGGTCCCTCGTCGGGGCTGACGTCGGACGACGTAGACGTC
GGGTACCTGACGCGCCTGATGAACAGCTATGGCAGCAGCCCGGCGGAGTGGTCCAAGTACGCCTTCGGGGACAGT
AGCAGGGGCTACACCAGGAACCTCGTCGACGAGGGCAACGGCAAGAGCAATCTGCTGGTGCTCGTCTGGTCCCCC
GGCAAGGGCAGCCCCATCCACGACCACGGCAACGCCCACTGTCTGATGAAGATCCTGCGCGGCAACCTGACGGAA
ACCCGATACGCCTTCCCCGACGAGGACGGGCCGGAGGAGCCCATGAAAGTGATATCGGAGAAGACATATAAGGAA
GATGCCGTGGCTTACATGGCCGACGAGCTCGGGCTGCACCGCGTGTCCAACAGGGGCAGCGACTTCGCCGTCTCC
CTGCACCTGTACACCCCTCCCAACGTGGCCAAGGGAGGCTGTCACATCTTCGACGAGAAGACGGGCAAGAGTAGC
CATGTGCCGGGCTGCCACTACTACTCAGCGTACGGCCGGTTGCTGAAATAG
Transcript >Hirsu2|9152
ATGGCCGTCGACGTCGTTTCCTCTTCCGTCCCCGCGGCCGTCAAGGGCGTCGTGGGCGATGTGCCCTCCAACCGC
TTCGAGGAGCTGGTCCTGGCCCTCAAGGATGCGCTTGGTCCCTCGTCGGGGCTGACGTCGGACGACGTAGACGTC
GGGTACCTGACGCGCCTGATGAACAGCTATGGCAGCAGCCCGGCGGAGTGGTCCAAGTACGCCTTCGGGGACAGT
AGCAGGGGCTACACCAGGAACCTCGTCGACGAGGGCAACGGCAAGAGCAATCTGCTGGTGCTCGTCTGGTCCCCC
GGCAAGGGCAGCCCCATCCACGACCACGGCAACGCCCACTGTCTGATGAAGATCCTGCGCGGCAACCTGACGGAA
ACCCGATACGCCTTCCCCGACGAGGACGGGCCGGAGGAGCCCATGAAAGTGATATCGGAGAAGACATATAAGGAA
GATGCCGTGGCTTACATGGCCGACGAGCTCGGGCTGCACCGCGTGTCCAACAGGGGCAGCGACTTCGCCGTCTCC
CTGCACCTGTACACCCCTCCCAACGTGGCCAAGGGAGGCTGTCACATCTTCGACGAGAAGACGGGCAAGAGTAGC
CATGTGCCGGGCTGCCACTACTACTCAGCGTACGGCCGGTTGCTGAAATAG
Gene >Hirsu2|9152
ATGGCCGTCGACGTCGTTTCCTCTTCCGTCCCCGCGGCCGTCAAGGGCGTCGTGGGCGATGTGCCCTCCAACCGC
TTCGAGGAGCTGGTCCTGGCCCTCAAGGATGCGCTTGGTCCCTCGTCGGGGCTGACGTCGGACGACGTAGACGTC
GGGTACCTGACGCGCCTGATGAACAGCTATGGCAGCAGCCCGGCGGAGTGGTCCAAGTACGCCTTCGGGGACAGT
AGCAGGGGCTACACCAGGAACCTCGTCGACGAGGGCAACGGCAAGAGCAATCTGGTGAGCGGTATTCCTCTCCCG
TGCATCCACCGCCGTGACTGACGGCCTGCTGCCAGCTGGTGCTCGTCTGGTCCCCCGGCAAGGGCAGCCCCATCC
ACGACCACGGCAACGCCCACTGTCTGATGAAGATCCTGCGCGGCAACCTGACGGAAACCCGATACGCCTTCCCCG
ACGAGGACGGGCCGGAGGAGCCCATGAAAGTGATATCGGAGAAGACATATAAGGAAGATGCCGTGGCTTACATGG
CCGACGAGCTCGGGCTGCACCGCGTGTCCAACAGGGGCAGCGACTTCGCCGTCTCCCTGCACCGTAGGCGCACCC
GACTCCCCTTGCGAGACACTCGTCGTCGCCGTGCTGACCTGCTGCGCCGCAGTGTACACCCCTCCCAACGTGGCC
AAGGGAGGCTGTCACATCTTCGACGAGAAGACGGGCAAGAGTAGCCATGTGCCGGGCTGCCACTACTACTCAGCG
TACGGCCGGTTGCTGAAATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail