Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|9150
Gene name
LocationContig_646:190..2600
Strand-
Gene length (bp)2410
Transcript length (bp)2358
Coding sequence length (bp)2358
Protein length (aa) 786

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08608 Wyosine_form Wyosine base formation 2.0E-24 636 704
PF04055 Radical_SAM Radical SAM superfamily 1.9E-23 451 625
PF00258 Flavodoxin_1 Flavodoxin 1.2E-09 142 281

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q08960|TYW1_YEAST S-adenosyl-L-methionine-dependent tRNA 4-demethylwyosine synthase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TYW1 PE=1 SV=1 115 773 0.0E+00
sp|O59761|TYW1_SCHPO S-adenosyl-L-methionine-dependent tRNA 4-demethylwyosine synthase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tyw1 PE=3 SV=1 116 769 0.0E+00
sp|Q2KHP8|TYW1_XENLA S-adenosyl-L-methionine-dependent tRNA 4-demethylwyosine synthase OS=Xenopus laevis GN=tyw1 PE=2 SV=1 145 769 7.0E-148
sp|Q08C92|TYW1_DANRE S-adenosyl-L-methionine-dependent tRNA 4-demethylwyosine synthase OS=Danio rerio GN=tyw1 PE=2 SV=1 143 769 5.0E-144
sp|Q8BJM7|TYW1_MOUSE S-adenosyl-L-methionine-dependent tRNA 4-demethylwyosine synthase OS=Mus musculus GN=Tyw1 PE=1 SV=1 118 769 4.0E-143
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q08960|TYW1_YEAST S-adenosyl-L-methionine-dependent tRNA 4-demethylwyosine synthase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TYW1 PE=1 SV=1 115 773 0.0E+00
sp|O59761|TYW1_SCHPO S-adenosyl-L-methionine-dependent tRNA 4-demethylwyosine synthase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tyw1 PE=3 SV=1 116 769 0.0E+00
sp|Q2KHP8|TYW1_XENLA S-adenosyl-L-methionine-dependent tRNA 4-demethylwyosine synthase OS=Xenopus laevis GN=tyw1 PE=2 SV=1 145 769 7.0E-148
sp|Q08C92|TYW1_DANRE S-adenosyl-L-methionine-dependent tRNA 4-demethylwyosine synthase OS=Danio rerio GN=tyw1 PE=2 SV=1 143 769 5.0E-144
sp|Q8BJM7|TYW1_MOUSE S-adenosyl-L-methionine-dependent tRNA 4-demethylwyosine synthase OS=Mus musculus GN=Tyw1 PE=1 SV=1 118 769 4.0E-143
sp|Q9NV66|TYW1_HUMAN S-adenosyl-L-methionine-dependent tRNA 4-demethylwyosine synthase OS=Homo sapiens GN=TYW1 PE=2 SV=2 158 769 1.0E-142
sp|Q5REF9|TYW1_PONAB S-adenosyl-L-methionine-dependent tRNA 4-demethylwyosine synthase OS=Pongo abelii GN=TYW1 PE=2 SV=1 158 769 2.0E-141
sp|Q8RXN5|TYW1_ARATH S-adenosyl-L-methionine-dependent tRNA 4-demethylwyosine synthase OS=Arabidopsis thaliana GN=TYW1 PE=2 SV=1 118 767 9.0E-141
sp|Q8H8N3|TYW1_ORYSJ S-adenosyl-L-methionine-dependent tRNA 4-demethylwyosine synthase OS=Oryza sativa subsp. japonica GN=TYW1 PE=2 SV=1 402 769 1.0E-133
sp|Q6NUM6|TYW1B_HUMAN S-adenosyl-L-methionine-dependent tRNA 4-demethylwyosine synthase OS=Homo sapiens GN=TYW1B PE=2 SV=3 158 769 3.0E-109
sp|Q9V1F9|TYW1_PYRAB S-adenosyl-L-methionine-dependent tRNA 4-demethylwyosine synthase OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=taw1 PE=1 SV=1 405 717 7.0E-55
sp|O59412|TYW1_PYRHO S-adenosyl-L-methionine-dependent tRNA 4-demethylwyosine synthase OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=taw1 PE=1 SV=1 405 717 2.0E-54
sp|Q57705|TYW1_METJA S-adenosyl-L-methionine-dependent tRNA 4-demethylwyosine synthase OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=taw1 PE=1 SV=1 400 680 3.0E-42
[Show less]

GO

GO Term Description Terminal node
GO:0010181 FMN binding Yes
GO:0003824 catalytic activity Yes
GO:0051536 iron-sulfur cluster binding Yes
GO:1901265 nucleoside phosphate binding No
GO:0050662 coenzyme binding No
GO:0005488 binding No
GO:0097367 carbohydrate derivative binding No
GO:0043168 anion binding No
GO:0003674 molecular_function No
GO:0032553 ribonucleotide binding No
GO:0097159 organic cyclic compound binding No
GO:0043167 ion binding No
GO:0000166 nucleotide binding No
GO:0051540 metal cluster binding No
GO:0036094 small molecule binding No
GO:1901363 heterocyclic compound binding No
GO:0048037 cofactor binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 17 0.5

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|9150
MHLFDWLSGLQSDTTADDVVQLWHAHRTPIIFCALVVLIFVRTILHKRDDKIELVALPQIYQKRAALADCPPSVH
TQPDDRTLAKANGPRRIKGGIARRPAQNAQHNPDLARPIKLVVFFSSVTTKTDKIARDFLADCAKATEQLARDTN
RAFLVPDLYDLSEIDFEDFFVSTPSGPDQARLFYLFLIPSYNIDTINDTLLQHLQETHHDFRIDTAPLVSLLGYA
VFGFGDREGWPDEADGFCFQAKDLDKWMSKLTGRKRAYPVGMGDMKSDYSERFDEWAAGVRETIRHIARTGNLGD
GVRGSGDAVESDDEDRVDDVDEDADDEEPADEKQPTSRALDDVEDLGKMLRTTGDGANTEQPKAAPLAVDFTTYG
PSSGKPPQSRVPVVKEMVAKNSPTYAALTKQGYSIVGSHSGVKICRWTKSALRGRGSCYKYSLYGINSHQCMETT
PSLSCSNKCVFCWRHGTNPVGTTWRWVVDPPDMIFEGVKENHYKKIKMMRGVPGVRAERYAEALRIRHCALSLVG
EPIFYPHINEFLALLHAERISSFLVCNAQHPDQLAALKAVTQLYVSIDASNRESLRKIDRPLHRDFWERFQRCLD
ILREKRFRHRTVFRLTLVKGFNVEDEAEGYAQLVERGLPCFVEVKGVTYCGTATSSNAGLSMSNVPFYWEVCEFV
KALEQRLAARGLRYGIAAEHAHSCCILLASERFRVDGRWHTHIDYARFFQLLEERGPDGEWTPEDYMGEPTPDWA
LWGNGGFDPRDQRVDRKGRKMENLVVRERPPGEVW*
Coding >Hirsu2|9150
ATGCATCTCTTCGACTGGCTGTCGGGCCTCCAATCCGACACCACGGCTGACGACGTCGTCCAGCTCTGGCATGCG
CACCGGACGCCAATCATCTTCTGCGCTCTTGTCGTCCTCATATTCGTCCGGACGATCCTTCACAAACGCGACGAC
AAGATCGAACTCGTCGCGCTCCCTCAGATCTATCAGAAGCGCGCCGCGCTCGCCGACTGCCCGCCATCTGTCCAC
ACCCAACCCGACGACAGGACGCTCGCCAAAGCCAACGGCCCGCGCAGGATCAAGGGAGGAATCGCGAGGAGGCCT
GCCCAGAATGCGCAGCACAATCCAGACTTGGCGCGGCCGATCAAGCTTGTCGTCTTCTTCTCCTCCGTCACGACC
AAGACGGACAAGATTGCTCGCGATTTCCTGGCCGACTGCGCCAAGGCTACGGAGCAGCTGGCCCGAGACACGAAC
CGCGCATTTCTGGTACCCGACCTTTACGATCTGTCCGAGATTGACTTTGAAGACTTCTTCGTCTCGACCCCGAGC
GGCCCCGACCAGGCCCGCCTGTTCTACCTCTTCCTCATCCCGAGCTACAACATTGACACGATCAACGACACCTTG
CTACAGCACCTGCAAGAGACACACCATGACTTCCGCATCGATACCGCGCCTCTCGTCTCCTTGCTCGGCTATGCC
GTCTTTGGCTTCGGCGACAGGGAAGGCTGGCCAGACGAGGCCGACGGCTTCTGCTTCCAGGCCAAAGACTTGGAC
AAGTGGATGTCCAAGCTGACGGGGCGAAAACGCGCCTATCCTGTCGGCATGGGCGACATGAAGAGCGACTATTCC
GAGCGTTTTGACGAATGGGCGGCCGGCGTCCGAGAAACCATCCGCCACATCGCACGAACAGGGAACCTGGGCGAC
GGTGTACGTGGGAGCGGAGACGCTGTCGAAAGCGACGATGAGGATCGAGTCGATGACGTCGATGAGGATGCAGAC
GACGAGGAGCCAGCCGACGAGAAACAGCCGACGTCAAGAGCGCTGGACGACGTCGAGGACCTGGGCAAGATGCTC
CGCACAACCGGAGACGGCGCAAATACGGAACAGCCCAAGGCGGCGCCCTTGGCCGTCGACTTCACCACGTACGGT
CCTTCGTCTGGCAAGCCGCCCCAGTCTCGAGTGCCGGTCGTCAAGGAGATGGTGGCCAAGAACTCGCCGACGTAC
GCAGCCCTGACGAAGCAGGGCTACTCCATCGTCGGATCCCACTCCGGCGTCAAGATCTGTCGATGGACCAAGTCT
GCGCTCCGCGGACGCGGCAGCTGCTACAAGTACTCGCTCTACGGCATCAACTCGCACCAATGCATGGAGACGACG
CCGTCGCTCTCCTGCTCCAACAAGTGCGTCTTCTGCTGGCGGCACGGCACGAACCCGGTCGGGACGACGTGGCGC
TGGGTCGTGGACCCGCCCGACATGATATTCGAAGGCGTCAAGGAGAACCACTACAAGAAGATCAAGATGATGCGC
GGCGTGCCGGGGGTCCGCGCCGAGCGATACGCCGAGGCGCTGAGGATCCGGCACTGCGCGCTGTCGCTGGTCGGC
GAGCCAATCTTCTACCCGCACATCAACGAGTTCCTGGCGCTCCTGCACGCCGAGCGCATCTCGTCCTTCCTGGTC
TGCAACGCGCAGCACCCGGACCAGCTCGCGGCGCTCAAGGCCGTCACCCAGCTGTACGTGTCCATCGACGCGTCG
AACCGCGAGTCGCTCCGCAAGATCGACCGGCCGCTGCACCGCGACTTCTGGGAGCGCTTCCAGCGCTGCCTCGAC
ATCCTGCGCGAGAAGCGCTTCCGGCACCGCACCGTCTTCCGCCTGACGCTCGTCAAGGGCTTCAACGTCGAGGAC
GAGGCCGAGGGCTACGCCCAGCTGGTGGAGCGCGGCCTTCCGTGCTTCGTCGAGGTCAAGGGCGTCACCTACTGC
GGCACCGCGACCTCGTCCAACGCGGGGCTCAGCATGTCCAACGTGCCCTTCTACTGGGAGGTGTGCGAGTTCGTC
AAGGCCCTGGAGCAGAGGCTGGCCGCCCGGGGCCTGCGGTACGGCATCGCCGCCGAGCACGCCCACAGCTGCTGC
ATCCTGCTGGCGAGCGAGCGGTTCCGCGTCGATGGCCGGTGGCACACCCACATCGACTACGCCCGCTTCTTCCAG
CTGCTCGAGGAGAGGGGCCCCGACGGCGAGTGGACGCCCGAGGACTACATGGGCGAGCCGACGCCGGACTGGGCT
CTGTGGGGGAACGGCGGCTTCGACCCGCGCGACCAACGGGTCGACCGCAAGGGGCGCAAGATGGAGAACCTGGTC
GTCCGCGAGCGGCCGCCGGGCGAGGTTTGGTAG
Transcript >Hirsu2|9150
ATGCATCTCTTCGACTGGCTGTCGGGCCTCCAATCCGACACCACGGCTGACGACGTCGTCCAGCTCTGGCATGCG
CACCGGACGCCAATCATCTTCTGCGCTCTTGTCGTCCTCATATTCGTCCGGACGATCCTTCACAAACGCGACGAC
AAGATCGAACTCGTCGCGCTCCCTCAGATCTATCAGAAGCGCGCCGCGCTCGCCGACTGCCCGCCATCTGTCCAC
ACCCAACCCGACGACAGGACGCTCGCCAAAGCCAACGGCCCGCGCAGGATCAAGGGAGGAATCGCGAGGAGGCCT
GCCCAGAATGCGCAGCACAATCCAGACTTGGCGCGGCCGATCAAGCTTGTCGTCTTCTTCTCCTCCGTCACGACC
AAGACGGACAAGATTGCTCGCGATTTCCTGGCCGACTGCGCCAAGGCTACGGAGCAGCTGGCCCGAGACACGAAC
CGCGCATTTCTGGTACCCGACCTTTACGATCTGTCCGAGATTGACTTTGAAGACTTCTTCGTCTCGACCCCGAGC
GGCCCCGACCAGGCCCGCCTGTTCTACCTCTTCCTCATCCCGAGCTACAACATTGACACGATCAACGACACCTTG
CTACAGCACCTGCAAGAGACACACCATGACTTCCGCATCGATACCGCGCCTCTCGTCTCCTTGCTCGGCTATGCC
GTCTTTGGCTTCGGCGACAGGGAAGGCTGGCCAGACGAGGCCGACGGCTTCTGCTTCCAGGCCAAAGACTTGGAC
AAGTGGATGTCCAAGCTGACGGGGCGAAAACGCGCCTATCCTGTCGGCATGGGCGACATGAAGAGCGACTATTCC
GAGCGTTTTGACGAATGGGCGGCCGGCGTCCGAGAAACCATCCGCCACATCGCACGAACAGGGAACCTGGGCGAC
GGTGTACGTGGGAGCGGAGACGCTGTCGAAAGCGACGATGAGGATCGAGTCGATGACGTCGATGAGGATGCAGAC
GACGAGGAGCCAGCCGACGAGAAACAGCCGACGTCAAGAGCGCTGGACGACGTCGAGGACCTGGGCAAGATGCTC
CGCACAACCGGAGACGGCGCAAATACGGAACAGCCCAAGGCGGCGCCCTTGGCCGTCGACTTCACCACGTACGGT
CCTTCGTCTGGCAAGCCGCCCCAGTCTCGAGTGCCGGTCGTCAAGGAGATGGTGGCCAAGAACTCGCCGACGTAC
GCAGCCCTGACGAAGCAGGGCTACTCCATCGTCGGATCCCACTCCGGCGTCAAGATCTGTCGATGGACCAAGTCT
GCGCTCCGCGGACGCGGCAGCTGCTACAAGTACTCGCTCTACGGCATCAACTCGCACCAATGCATGGAGACGACG
CCGTCGCTCTCCTGCTCCAACAAGTGCGTCTTCTGCTGGCGGCACGGCACGAACCCGGTCGGGACGACGTGGCGC
TGGGTCGTGGACCCGCCCGACATGATATTCGAAGGCGTCAAGGAGAACCACTACAAGAAGATCAAGATGATGCGC
GGCGTGCCGGGGGTCCGCGCCGAGCGATACGCCGAGGCGCTGAGGATCCGGCACTGCGCGCTGTCGCTGGTCGGC
GAGCCAATCTTCTACCCGCACATCAACGAGTTCCTGGCGCTCCTGCACGCCGAGCGCATCTCGTCCTTCCTGGTC
TGCAACGCGCAGCACCCGGACCAGCTCGCGGCGCTCAAGGCCGTCACCCAGCTGTACGTGTCCATCGACGCGTCG
AACCGCGAGTCGCTCCGCAAGATCGACCGGCCGCTGCACCGCGACTTCTGGGAGCGCTTCCAGCGCTGCCTCGAC
ATCCTGCGCGAGAAGCGCTTCCGGCACCGCACCGTCTTCCGCCTGACGCTCGTCAAGGGCTTCAACGTCGAGGAC
GAGGCCGAGGGCTACGCCCAGCTGGTGGAGCGCGGCCTTCCGTGCTTCGTCGAGGTCAAGGGCGTCACCTACTGC
GGCACCGCGACCTCGTCCAACGCGGGGCTCAGCATGTCCAACGTGCCCTTCTACTGGGAGGTGTGCGAGTTCGTC
AAGGCCCTGGAGCAGAGGCTGGCCGCCCGGGGCCTGCGGTACGGCATCGCCGCCGAGCACGCCCACAGCTGCTGC
ATCCTGCTGGCGAGCGAGCGGTTCCGCGTCGATGGCCGGTGGCACACCCACATCGACTACGCCCGCTTCTTCCAG
CTGCTCGAGGAGAGGGGCCCCGACGGCGAGTGGACGCCCGAGGACTACATGGGCGAGCCGACGCCGGACTGGGCT
CTGTGGGGGAACGGCGGCTTCGACCCGCGCGACCAACGGGTCGACCGCAAGGGGCGCAAGATGGAGAACCTGGTC
GTCCGCGAGCGGCCGCCGGGCGAGGTTTGGTAG
Gene >Hirsu2|9150
ATGCATCTCTTCGACTGGCTGTCGGGCCTCCAATCCGACACCACGGCTGACGGTAAGTTGCGCTGCGCAAAACTC
GAGTCGTCGCAAAATCTTACCCTGCATAGACGTCGTCCAGCTCTGGCATGCGCACCGGACGCCAATCATCTTCTG
CGCTCTTGTCGTCCTCATATTCGTCCGGACGATCCTTCACAAACGCGACGACAAGATCGAACTCGTCGCGCTCCC
TCAGATCTATCAGAAGCGCGCCGCGCTCGCCGACTGCCCGCCATCTGTCCACACCCAACCCGACGACAGGACGCT
CGCCAAAGCCAACGGCCCGCGCAGGATCAAGGGAGGAATCGCGAGGAGGCCTGCCCAGAATGCGCAGCACAATCC
AGACTTGGCGCGGCCGATCAAGCTTGTCGTCTTCTTCTCCTCCGTCACGACCAAGACGGACAAGATTGCTCGCGA
TTTCCTGGCCGACTGCGCCAAGGCTACGGAGCAGCTGGCCCGAGACACGAACCGCGCATTTCTGGTACCCGACCT
TTACGATCTGTCCGAGATTGACTTTGAAGACTTCTTCGTCTCGACCCCGAGCGGCCCCGACCAGGCCCGCCTGTT
CTACCTCTTCCTCATCCCGAGCTACAACATTGACACGATCAACGACACCTTGCTACAGCACCTGCAAGAGACACA
CCATGACTTCCGCATCGATACCGCGCCTCTCGTCTCCTTGCTCGGCTATGCCGTCTTTGGCTTCGGCGACAGGGA
AGGCTGGCCAGACGAGGCCGACGGCTTCTGCTTCCAGGCCAAAGACTTGGACAAGTGGATGTCCAAGCTGACGGG
GCGAAAACGCGCCTATCCTGTCGGCATGGGCGACATGAAGAGCGACTATTCCGAGCGTTTTGACGAATGGGCGGC
CGGCGTCCGAGAAACCATCCGCCACATCGCACGAACAGGGAACCTGGGCGACGGTGTACGTGGGAGCGGAGACGC
TGTCGAAAGCGACGATGAGGATCGAGTCGATGACGTCGATGAGGATGCAGACGACGAGGAGCCAGCCGACGAGAA
ACAGCCGACGTCAAGAGCGCTGGACGACGTCGAGGACCTGGGCAAGATGCTCCGCACAACCGGAGACGGCGCAAA
TACGGAACAGCCCAAGGCGGCGCCCTTGGCCGTCGACTTCACCACGTACGGTCCTTCGTCTGGCAAGCCGCCCCA
GTCTCGAGTGCCGGTCGTCAAGGAGATGGTGGCCAAGAACTCGCCGACGTACGCAGCCCTGACGAAGCAGGGCTA
CTCCATCGTCGGATCCCACTCCGGCGTCAAGATCTGTCGATGGACCAAGTCTGCGCTCCGCGGACGCGGCAGCTG
CTACAAGTACTCGCTCTACGGCATCAACTCGCACCAATGCATGGAGACGACGCCGTCGCTCTCCTGCTCCAACAA
GTGCGTCTTCTGCTGGCGGCACGGCACGAACCCGGTCGGGACGACGTGGCGCTGGGTCGTGGACCCGCCCGACAT
GATATTCGAAGGCGTCAAGGAGAACCACTACAAGAAGATCAAGATGATGCGCGGCGTGCCGGGGGTCCGCGCCGA
GCGATACGCCGAGGCGCTGAGGATCCGGCACTGCGCGCTGTCGCTGGTCGGCGAGCCAATCTTCTACCCGCACAT
CAACGAGTTCCTGGCGCTCCTGCACGCCGAGCGCATCTCGTCCTTCCTGGTCTGCAACGCGCAGCACCCGGACCA
GCTCGCGGCGCTCAAGGCCGTCACCCAGCTGTACGTGTCCATCGACGCGTCGAACCGCGAGTCGCTCCGCAAGAT
CGACCGGCCGCTGCACCGCGACTTCTGGGAGCGCTTCCAGCGCTGCCTCGACATCCTGCGCGAGAAGCGCTTCCG
GCACCGCACCGTCTTCCGCCTGACGCTCGTCAAGGGCTTCAACGTCGAGGACGAGGCCGAGGGCTACGCCCAGCT
GGTGGAGCGCGGCCTTCCGTGCTTCGTCGAGGTCAAGGGCGTCACCTACTGCGGCACCGCGACCTCGTCCAACGC
GGGGCTCAGCATGTCCAACGTGCCCTTCTACTGGGAGGTGTGCGAGTTCGTCAAGGCCCTGGAGCAGAGGCTGGC
CGCCCGGGGCCTGCGGTACGGCATCGCCGCCGAGCACGCCCACAGCTGCTGCATCCTGCTGGCGAGCGAGCGGTT
CCGCGTCGATGGCCGGTGGCACACCCACATCGACTACGCCCGCTTCTTCCAGCTGCTCGAGGAGAGGGGCCCCGA
CGGCGAGTGGACGCCCGAGGACTACATGGGCGAGCCGACGCCGGACTGGGCTCTGTGGGGGAACGGCGGCTTCGA
CCCGCGCGACCAACGGGTCGACCGCAAGGGGCGCAAGATGGAGAACCTGGTCGTCCGCGAGCGGCCGCCGGGCGA
GGTTTGGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail