Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|9150
Gene name
LocationContig_646:190..2600
Strand-
Gene length (bp)2410
Transcript length (bp)2358
Coding sequence length (bp)2358
Protein length (aa) 786

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04055 Radical_SAM Radical SAM superfamily 7.4E-24 451 625
PF08608 Wyosine_form Wyosine base formation 2.2E-24 636 704
PF00258 Flavodoxin_1 Flavodoxin 1.1E-09 142 281

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q08960|TYW1_YEAST S-adenosyl-L-methionine-dependent tRNA 4-demethylwyosine synthase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TYW1 PE=1 SV=1 115 773 0.0E+00
sp|O59761|TYW1_SCHPO S-adenosyl-L-methionine-dependent tRNA 4-demethylwyosine synthase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tyw1 PE=3 SV=1 116 769 0.0E+00
sp|Q2KHP8|TYW1_XENLA S-adenosyl-L-methionine-dependent tRNA 4-demethylwyosine synthase OS=Xenopus laevis GN=tyw1 PE=2 SV=1 145 769 7.0E-148
sp|Q08C92|TYW1_DANRE S-adenosyl-L-methionine-dependent tRNA 4-demethylwyosine synthase OS=Danio rerio GN=tyw1 PE=2 SV=1 143 769 5.0E-144
sp|Q8BJM7|TYW1_MOUSE S-adenosyl-L-methionine-dependent tRNA 4-demethylwyosine synthase OS=Mus musculus GN=Tyw1 PE=1 SV=1 118 769 4.0E-143
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q08960|TYW1_YEAST S-adenosyl-L-methionine-dependent tRNA 4-demethylwyosine synthase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TYW1 PE=1 SV=1 115 773 0.0E+00
sp|O59761|TYW1_SCHPO S-adenosyl-L-methionine-dependent tRNA 4-demethylwyosine synthase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tyw1 PE=3 SV=1 116 769 0.0E+00
sp|Q2KHP8|TYW1_XENLA S-adenosyl-L-methionine-dependent tRNA 4-demethylwyosine synthase OS=Xenopus laevis GN=tyw1 PE=2 SV=1 145 769 7.0E-148
sp|Q08C92|TYW1_DANRE S-adenosyl-L-methionine-dependent tRNA 4-demethylwyosine synthase OS=Danio rerio GN=tyw1 PE=2 SV=1 143 769 5.0E-144
sp|Q8BJM7|TYW1_MOUSE S-adenosyl-L-methionine-dependent tRNA 4-demethylwyosine synthase OS=Mus musculus GN=Tyw1 PE=1 SV=1 118 769 4.0E-143
sp|Q9NV66|TYW1_HUMAN S-adenosyl-L-methionine-dependent tRNA 4-demethylwyosine synthase OS=Homo sapiens GN=TYW1 PE=2 SV=2 158 769 1.0E-142
sp|Q5REF9|TYW1_PONAB S-adenosyl-L-methionine-dependent tRNA 4-demethylwyosine synthase OS=Pongo abelii GN=TYW1 PE=2 SV=1 158 769 2.0E-141
sp|Q8RXN5|TYW1_ARATH S-adenosyl-L-methionine-dependent tRNA 4-demethylwyosine synthase OS=Arabidopsis thaliana GN=TYW1 PE=2 SV=1 118 767 9.0E-141
sp|Q8H8N3|TYW1_ORYSJ S-adenosyl-L-methionine-dependent tRNA 4-demethylwyosine synthase OS=Oryza sativa subsp. japonica GN=TYW1 PE=2 SV=1 402 769 1.0E-133
sp|Q6NUM6|TYW1B_HUMAN S-adenosyl-L-methionine-dependent tRNA 4-demethylwyosine synthase OS=Homo sapiens GN=TYW1B PE=2 SV=3 158 769 3.0E-109
sp|Q9V1F9|TYW1_PYRAB S-adenosyl-L-methionine-dependent tRNA 4-demethylwyosine synthase OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=taw1 PE=1 SV=1 405 717 7.0E-55
sp|O59412|TYW1_PYRHO S-adenosyl-L-methionine-dependent tRNA 4-demethylwyosine synthase OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=taw1 PE=1 SV=1 405 717 2.0E-54
sp|Q57705|TYW1_METJA S-adenosyl-L-methionine-dependent tRNA 4-demethylwyosine synthase OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=taw1 PE=1 SV=1 400 680 3.0E-42
[Show less]

GO

GO Term Description Terminal node
GO:0003824 catalytic activity Yes
GO:0051536 iron-sulfur cluster binding Yes
GO:0010181 FMN binding Yes
GO:0036094 small molecule binding No
GO:0032553 ribonucleotide binding No
GO:0043168 anion binding No
GO:1901265 nucleoside phosphate binding No
GO:0000166 nucleotide binding No
GO:0097159 organic cyclic compound binding No
GO:0097367 carbohydrate derivative binding No
GO:0005488 binding No
GO:1901363 heterocyclic compound binding No
GO:0043167 ion binding No
GO:0051540 metal cluster binding No
GO:0003674 molecular_function No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Endoplasmic reticulum Signal peptide 0.1402 0.3412 0.0585 0.1273 0.3718 0.0221 0.7982 0.1762 0.3994 0.3144

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup4420
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|5422
Ophiocordyceps australis map64 (Brazil) OphauB2|3883
Ophiocordyceps camponoti-floridani Ophcf2|04125
Ophiocordyceps camponoti-rufipedis Ophun1|4034
Ophiocordyceps kimflemingae Ophio5|7035
Ophiocordyceps subramaniannii Hirsu2|9150 (this protein)

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|9150
MHLFDWLSGLQSDTTADDVVQLWHAHRTPIIFCALVVLIFVRTILHKRDDKIELVALPQIYQKRAALADCPPSVH
TQPDDRTLAKANGPRRIKGGIARRPAQNAQHNPDLARPIKLVVFFSSVTTKTDKIARDFLADCAKATEQLARDTN
RAFLVPDLYDLSEIDFEDFFVSTPSGPDQARLFYLFLIPSYNIDTINDTLLQHLQETHHDFRIDTAPLVSLLGYA
VFGFGDREGWPDEADGFCFQAKDLDKWMSKLTGRKRAYPVGMGDMKSDYSERFDEWAAGVRETIRHIARTGNLGD
GVRGSGDAVESDDEDRVDDVDEDADDEEPADEKQPTSRALDDVEDLGKMLRTTGDGANTEQPKAAPLAVDFTTYG
PSSGKPPQSRVPVVKEMVAKNSPTYAALTKQGYSIVGSHSGVKICRWTKSALRGRGSCYKYSLYGINSHQCMETT
PSLSCSNKCVFCWRHGTNPVGTTWRWVVDPPDMIFEGVKENHYKKIKMMRGVPGVRAERYAEALRIRHCALSLVG
EPIFYPHINEFLALLHAERISSFLVCNAQHPDQLAALKAVTQLYVSIDASNRESLRKIDRPLHRDFWERFQRCLD
ILREKRFRHRTVFRLTLVKGFNVEDEAEGYAQLVERGLPCFVEVKGVTYCGTATSSNAGLSMSNVPFYWEVCEFV
KALEQRLAARGLRYGIAAEHAHSCCILLASERFRVDGRWHTHIDYARFFQLLEERGPDGEWTPEDYMGEPTPDWA
LWGNGGFDPRDQRVDRKGRKMENLVVRERPPGEVW*
Coding >Hirsu2|9150
ATGCATCTCTTCGACTGGCTGTCGGGCCTCCAATCCGACACCACGGCTGACGACGTCGTCCAGCTCTGGCATGCG
CACCGGACGCCAATCATCTTCTGCGCTCTTGTCGTCCTCATATTCGTCCGGACGATCCTTCACAAACGCGACGAC
AAGATCGAACTCGTCGCGCTCCCTCAGATCTATCAGAAGCGCGCCGCGCTCGCCGACTGCCCGCCATCTGTCCAC
ACCCAACCCGACGACAGGACGCTCGCCAAAGCCAACGGCCCGCGCAGGATCAAGGGAGGAATCGCGAGGAGGCCT
GCCCAGAATGCGCAGCACAATCCAGACTTGGCGCGGCCGATCAAGCTTGTCGTCTTCTTCTCCTCCGTCACGACC
AAGACGGACAAGATTGCTCGCGATTTCCTGGCCGACTGCGCCAAGGCTACGGAGCAGCTGGCCCGAGACACGAAC
CGCGCATTTCTGGTACCCGACCTTTACGATCTGTCCGAGATTGACTTTGAAGACTTCTTCGTCTCGACCCCGAGC
GGCCCCGACCAGGCCCGCCTGTTCTACCTCTTCCTCATCCCGAGCTACAACATTGACACGATCAACGACACCTTG
CTACAGCACCTGCAAGAGACACACCATGACTTCCGCATCGATACCGCGCCTCTCGTCTCCTTGCTCGGCTATGCC
GTCTTTGGCTTCGGCGACAGGGAAGGCTGGCCAGACGAGGCCGACGGCTTCTGCTTCCAGGCCAAAGACTTGGAC
AAGTGGATGTCCAAGCTGACGGGGCGAAAACGCGCCTATCCTGTCGGCATGGGCGACATGAAGAGCGACTATTCC
GAGCGTTTTGACGAATGGGCGGCCGGCGTCCGAGAAACCATCCGCCACATCGCACGAACAGGGAACCTGGGCGAC
GGTGTACGTGGGAGCGGAGACGCTGTCGAAAGCGACGATGAGGATCGAGTCGATGACGTCGATGAGGATGCAGAC
GACGAGGAGCCAGCCGACGAGAAACAGCCGACGTCAAGAGCGCTGGACGACGTCGAGGACCTGGGCAAGATGCTC
CGCACAACCGGAGACGGCGCAAATACGGAACAGCCCAAGGCGGCGCCCTTGGCCGTCGACTTCACCACGTACGGT
CCTTCGTCTGGCAAGCCGCCCCAGTCTCGAGTGCCGGTCGTCAAGGAGATGGTGGCCAAGAACTCGCCGACGTAC
GCAGCCCTGACGAAGCAGGGCTACTCCATCGTCGGATCCCACTCCGGCGTCAAGATCTGTCGATGGACCAAGTCT
GCGCTCCGCGGACGCGGCAGCTGCTACAAGTACTCGCTCTACGGCATCAACTCGCACCAATGCATGGAGACGACG
CCGTCGCTCTCCTGCTCCAACAAGTGCGTCTTCTGCTGGCGGCACGGCACGAACCCGGTCGGGACGACGTGGCGC
TGGGTCGTGGACCCGCCCGACATGATATTCGAAGGCGTCAAGGAGAACCACTACAAGAAGATCAAGATGATGCGC
GGCGTGCCGGGGGTCCGCGCCGAGCGATACGCCGAGGCGCTGAGGATCCGGCACTGCGCGCTGTCGCTGGTCGGC
GAGCCAATCTTCTACCCGCACATCAACGAGTTCCTGGCGCTCCTGCACGCCGAGCGCATCTCGTCCTTCCTGGTC
TGCAACGCGCAGCACCCGGACCAGCTCGCGGCGCTCAAGGCCGTCACCCAGCTGTACGTGTCCATCGACGCGTCG
AACCGCGAGTCGCTCCGCAAGATCGACCGGCCGCTGCACCGCGACTTCTGGGAGCGCTTCCAGCGCTGCCTCGAC
ATCCTGCGCGAGAAGCGCTTCCGGCACCGCACCGTCTTCCGCCTGACGCTCGTCAAGGGCTTCAACGTCGAGGAC
GAGGCCGAGGGCTACGCCCAGCTGGTGGAGCGCGGCCTTCCGTGCTTCGTCGAGGTCAAGGGCGTCACCTACTGC
GGCACCGCGACCTCGTCCAACGCGGGGCTCAGCATGTCCAACGTGCCCTTCTACTGGGAGGTGTGCGAGTTCGTC
AAGGCCCTGGAGCAGAGGCTGGCCGCCCGGGGCCTGCGGTACGGCATCGCCGCCGAGCACGCCCACAGCTGCTGC
ATCCTGCTGGCGAGCGAGCGGTTCCGCGTCGATGGCCGGTGGCACACCCACATCGACTACGCCCGCTTCTTCCAG
CTGCTCGAGGAGAGGGGCCCCGACGGCGAGTGGACGCCCGAGGACTACATGGGCGAGCCGACGCCGGACTGGGCT
CTGTGGGGGAACGGCGGCTTCGACCCGCGCGACCAACGGGTCGACCGCAAGGGGCGCAAGATGGAGAACCTGGTC
GTCCGCGAGCGGCCGCCGGGCGAGGTTTGGTAG
Transcript >Hirsu2|9150
ATGCATCTCTTCGACTGGCTGTCGGGCCTCCAATCCGACACCACGGCTGACGACGTCGTCCAGCTCTGGCATGCG
CACCGGACGCCAATCATCTTCTGCGCTCTTGTCGTCCTCATATTCGTCCGGACGATCCTTCACAAACGCGACGAC
AAGATCGAACTCGTCGCGCTCCCTCAGATCTATCAGAAGCGCGCCGCGCTCGCCGACTGCCCGCCATCTGTCCAC
ACCCAACCCGACGACAGGACGCTCGCCAAAGCCAACGGCCCGCGCAGGATCAAGGGAGGAATCGCGAGGAGGCCT
GCCCAGAATGCGCAGCACAATCCAGACTTGGCGCGGCCGATCAAGCTTGTCGTCTTCTTCTCCTCCGTCACGACC
AAGACGGACAAGATTGCTCGCGATTTCCTGGCCGACTGCGCCAAGGCTACGGAGCAGCTGGCCCGAGACACGAAC
CGCGCATTTCTGGTACCCGACCTTTACGATCTGTCCGAGATTGACTTTGAAGACTTCTTCGTCTCGACCCCGAGC
GGCCCCGACCAGGCCCGCCTGTTCTACCTCTTCCTCATCCCGAGCTACAACATTGACACGATCAACGACACCTTG
CTACAGCACCTGCAAGAGACACACCATGACTTCCGCATCGATACCGCGCCTCTCGTCTCCTTGCTCGGCTATGCC
GTCTTTGGCTTCGGCGACAGGGAAGGCTGGCCAGACGAGGCCGACGGCTTCTGCTTCCAGGCCAAAGACTTGGAC
AAGTGGATGTCCAAGCTGACGGGGCGAAAACGCGCCTATCCTGTCGGCATGGGCGACATGAAGAGCGACTATTCC
GAGCGTTTTGACGAATGGGCGGCCGGCGTCCGAGAAACCATCCGCCACATCGCACGAACAGGGAACCTGGGCGAC
GGTGTACGTGGGAGCGGAGACGCTGTCGAAAGCGACGATGAGGATCGAGTCGATGACGTCGATGAGGATGCAGAC
GACGAGGAGCCAGCCGACGAGAAACAGCCGACGTCAAGAGCGCTGGACGACGTCGAGGACCTGGGCAAGATGCTC
CGCACAACCGGAGACGGCGCAAATACGGAACAGCCCAAGGCGGCGCCCTTGGCCGTCGACTTCACCACGTACGGT
CCTTCGTCTGGCAAGCCGCCCCAGTCTCGAGTGCCGGTCGTCAAGGAGATGGTGGCCAAGAACTCGCCGACGTAC
GCAGCCCTGACGAAGCAGGGCTACTCCATCGTCGGATCCCACTCCGGCGTCAAGATCTGTCGATGGACCAAGTCT
GCGCTCCGCGGACGCGGCAGCTGCTACAAGTACTCGCTCTACGGCATCAACTCGCACCAATGCATGGAGACGACG
CCGTCGCTCTCCTGCTCCAACAAGTGCGTCTTCTGCTGGCGGCACGGCACGAACCCGGTCGGGACGACGTGGCGC
TGGGTCGTGGACCCGCCCGACATGATATTCGAAGGCGTCAAGGAGAACCACTACAAGAAGATCAAGATGATGCGC
GGCGTGCCGGGGGTCCGCGCCGAGCGATACGCCGAGGCGCTGAGGATCCGGCACTGCGCGCTGTCGCTGGTCGGC
GAGCCAATCTTCTACCCGCACATCAACGAGTTCCTGGCGCTCCTGCACGCCGAGCGCATCTCGTCCTTCCTGGTC
TGCAACGCGCAGCACCCGGACCAGCTCGCGGCGCTCAAGGCCGTCACCCAGCTGTACGTGTCCATCGACGCGTCG
AACCGCGAGTCGCTCCGCAAGATCGACCGGCCGCTGCACCGCGACTTCTGGGAGCGCTTCCAGCGCTGCCTCGAC
ATCCTGCGCGAGAAGCGCTTCCGGCACCGCACCGTCTTCCGCCTGACGCTCGTCAAGGGCTTCAACGTCGAGGAC
GAGGCCGAGGGCTACGCCCAGCTGGTGGAGCGCGGCCTTCCGTGCTTCGTCGAGGTCAAGGGCGTCACCTACTGC
GGCACCGCGACCTCGTCCAACGCGGGGCTCAGCATGTCCAACGTGCCCTTCTACTGGGAGGTGTGCGAGTTCGTC
AAGGCCCTGGAGCAGAGGCTGGCCGCCCGGGGCCTGCGGTACGGCATCGCCGCCGAGCACGCCCACAGCTGCTGC
ATCCTGCTGGCGAGCGAGCGGTTCCGCGTCGATGGCCGGTGGCACACCCACATCGACTACGCCCGCTTCTTCCAG
CTGCTCGAGGAGAGGGGCCCCGACGGCGAGTGGACGCCCGAGGACTACATGGGCGAGCCGACGCCGGACTGGGCT
CTGTGGGGGAACGGCGGCTTCGACCCGCGCGACCAACGGGTCGACCGCAAGGGGCGCAAGATGGAGAACCTGGTC
GTCCGCGAGCGGCCGCCGGGCGAGGTTTGGTAG
Gene >Hirsu2|9150
ATGCATCTCTTCGACTGGCTGTCGGGCCTCCAATCCGACACCACGGCTGACGGTAAGTTGCGCTGCGCAAAACTC
GAGTCGTCGCAAAATCTTACCCTGCATAGACGTCGTCCAGCTCTGGCATGCGCACCGGACGCCAATCATCTTCTG
CGCTCTTGTCGTCCTCATATTCGTCCGGACGATCCTTCACAAACGCGACGACAAGATCGAACTCGTCGCGCTCCC
TCAGATCTATCAGAAGCGCGCCGCGCTCGCCGACTGCCCGCCATCTGTCCACACCCAACCCGACGACAGGACGCT
CGCCAAAGCCAACGGCCCGCGCAGGATCAAGGGAGGAATCGCGAGGAGGCCTGCCCAGAATGCGCAGCACAATCC
AGACTTGGCGCGGCCGATCAAGCTTGTCGTCTTCTTCTCCTCCGTCACGACCAAGACGGACAAGATTGCTCGCGA
TTTCCTGGCCGACTGCGCCAAGGCTACGGAGCAGCTGGCCCGAGACACGAACCGCGCATTTCTGGTACCCGACCT
TTACGATCTGTCCGAGATTGACTTTGAAGACTTCTTCGTCTCGACCCCGAGCGGCCCCGACCAGGCCCGCCTGTT
CTACCTCTTCCTCATCCCGAGCTACAACATTGACACGATCAACGACACCTTGCTACAGCACCTGCAAGAGACACA
CCATGACTTCCGCATCGATACCGCGCCTCTCGTCTCCTTGCTCGGCTATGCCGTCTTTGGCTTCGGCGACAGGGA
AGGCTGGCCAGACGAGGCCGACGGCTTCTGCTTCCAGGCCAAAGACTTGGACAAGTGGATGTCCAAGCTGACGGG
GCGAAAACGCGCCTATCCTGTCGGCATGGGCGACATGAAGAGCGACTATTCCGAGCGTTTTGACGAATGGGCGGC
CGGCGTCCGAGAAACCATCCGCCACATCGCACGAACAGGGAACCTGGGCGACGGTGTACGTGGGAGCGGAGACGC
TGTCGAAAGCGACGATGAGGATCGAGTCGATGACGTCGATGAGGATGCAGACGACGAGGAGCCAGCCGACGAGAA
ACAGCCGACGTCAAGAGCGCTGGACGACGTCGAGGACCTGGGCAAGATGCTCCGCACAACCGGAGACGGCGCAAA
TACGGAACAGCCCAAGGCGGCGCCCTTGGCCGTCGACTTCACCACGTACGGTCCTTCGTCTGGCAAGCCGCCCCA
GTCTCGAGTGCCGGTCGTCAAGGAGATGGTGGCCAAGAACTCGCCGACGTACGCAGCCCTGACGAAGCAGGGCTA
CTCCATCGTCGGATCCCACTCCGGCGTCAAGATCTGTCGATGGACCAAGTCTGCGCTCCGCGGACGCGGCAGCTG
CTACAAGTACTCGCTCTACGGCATCAACTCGCACCAATGCATGGAGACGACGCCGTCGCTCTCCTGCTCCAACAA
GTGCGTCTTCTGCTGGCGGCACGGCACGAACCCGGTCGGGACGACGTGGCGCTGGGTCGTGGACCCGCCCGACAT
GATATTCGAAGGCGTCAAGGAGAACCACTACAAGAAGATCAAGATGATGCGCGGCGTGCCGGGGGTCCGCGCCGA
GCGATACGCCGAGGCGCTGAGGATCCGGCACTGCGCGCTGTCGCTGGTCGGCGAGCCAATCTTCTACCCGCACAT
CAACGAGTTCCTGGCGCTCCTGCACGCCGAGCGCATCTCGTCCTTCCTGGTCTGCAACGCGCAGCACCCGGACCA
GCTCGCGGCGCTCAAGGCCGTCACCCAGCTGTACGTGTCCATCGACGCGTCGAACCGCGAGTCGCTCCGCAAGAT
CGACCGGCCGCTGCACCGCGACTTCTGGGAGCGCTTCCAGCGCTGCCTCGACATCCTGCGCGAGAAGCGCTTCCG
GCACCGCACCGTCTTCCGCCTGACGCTCGTCAAGGGCTTCAACGTCGAGGACGAGGCCGAGGGCTACGCCCAGCT
GGTGGAGCGCGGCCTTCCGTGCTTCGTCGAGGTCAAGGGCGTCACCTACTGCGGCACCGCGACCTCGTCCAACGC
GGGGCTCAGCATGTCCAACGTGCCCTTCTACTGGGAGGTGTGCGAGTTCGTCAAGGCCCTGGAGCAGAGGCTGGC
CGCCCGGGGCCTGCGGTACGGCATCGCCGCCGAGCACGCCCACAGCTGCTGCATCCTGCTGGCGAGCGAGCGGTT
CCGCGTCGATGGCCGGTGGCACACCCACATCGACTACGCCCGCTTCTTCCAGCTGCTCGAGGAGAGGGGCCCCGA
CGGCGAGTGGACGCCCGAGGACTACATGGGCGAGCCGACGCCGGACTGGGCTCTGTGGGGGAACGGCGGCTTCGA
CCCGCGCGACCAACGGGTCGACCGCAAGGGGCGCAAGATGGAGAACCTGGTCGTCCGCGAGCGGCCGCCGGGCGA
GGTTTGGTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail