Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|9145
Gene name
LocationContig_644:5851..11809
Strand+
Gene length (bp)5958
Transcript length (bp)5151
Coding sequence length (bp)5151
Protein length (aa) 1717

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13832 zf-HC5HC2H_2 PHD-zinc-finger like domain 7.0E-21 1108 1200
PF01426 BAH BAH domain 7.2E-17 262 371
PF13771 zf-HC5HC2H PHD-like zinc-binding domain 8.9E-17 1118 1222
PF13831 PHD_2 PHD-finger 1.1E-07 999 1030

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P53127|SNT2_YEAST E3 ubiquitin-protein ligase SNT2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SNT2 PE=1 SV=1 258 868 1.0E-62
sp|Q10077|SNT2_SCHPO Lid2 complex component snt2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=snt2 PE=3 SV=1 258 865 2.0E-59
sp|Q9ULD4|BRPF3_HUMAN Bromodomain and PHD finger-containing protein 3 OS=Homo sapiens GN=BRPF3 PE=1 SV=2 1108 1224 4.0E-18
sp|P53127|SNT2_YEAST E3 ubiquitin-protein ligase SNT2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SNT2 PE=1 SV=1 982 1189 1.0E-17
sp|O95696|BRD1_HUMAN Bromodomain-containing protein 1 OS=Homo sapiens GN=BRD1 PE=1 SV=1 1108 1224 6.0E-17
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P53127|SNT2_YEAST E3 ubiquitin-protein ligase SNT2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SNT2 PE=1 SV=1 258 868 1.0E-62
sp|Q10077|SNT2_SCHPO Lid2 complex component snt2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=snt2 PE=3 SV=1 258 865 2.0E-59
sp|Q9ULD4|BRPF3_HUMAN Bromodomain and PHD finger-containing protein 3 OS=Homo sapiens GN=BRPF3 PE=1 SV=2 1108 1224 4.0E-18
sp|P53127|SNT2_YEAST E3 ubiquitin-protein ligase SNT2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SNT2 PE=1 SV=1 982 1189 1.0E-17
sp|O95696|BRD1_HUMAN Bromodomain-containing protein 1 OS=Homo sapiens GN=BRD1 PE=1 SV=1 1108 1224 6.0E-17
sp|P55201|BRPF1_HUMAN Peregrin OS=Homo sapiens GN=BRPF1 PE=1 SV=2 1108 1224 7.0E-17
sp|Q12311|NTO1_YEAST NuA3 HAT complex component NTO1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NTO1 PE=1 SV=1 1108 1224 9.0E-15
sp|P55197|AF10_HUMAN Protein AF-10 OS=Homo sapiens GN=MLLT10 PE=1 SV=2 1108 1185 5.0E-14
sp|O54826|AF10_MOUSE Protein AF-10 OS=Mus musculus GN=Mllt10 PE=1 SV=2 1108 1185 5.0E-14
sp|P55198|AF17_HUMAN Protein AF-17 OS=Homo sapiens GN=MLLT6 PE=1 SV=2 1108 1193 3.0E-13
sp|Q7YZH1|RNO_DROME PHD finger protein rhinoceros OS=Drosophila melanogaster GN=rno PE=1 SV=1 1116 1183 1.0E-12
sp|Q80TZ9|RERE_MOUSE Arginine-glutamic acid dipeptide repeats protein OS=Mus musculus GN=Rere PE=1 SV=3 627 865 3.0E-12
sp|Q62901|RERE_RAT Arginine-glutamic acid dipeptide repeats protein OS=Rattus norvegicus GN=Rere PE=1 SV=2 627 865 4.0E-12
sp|Q803A0|JADE1_DANRE Protein Jade-1 OS=Danio rerio GN=jade1 PE=2 SV=1 1116 1183 5.0E-12
sp|P34447|YM2A_CAEEL Uncharacterized protein F54F2.2, isoform a OS=Caenorhabditis elegans GN=F54F2.2/F54F2.3/F54F2.4 PE=3 SV=2 1108 1185 6.0E-12
sp|Q6GQJ2|JADE1_XENLA Protein Jade-1 OS=Xenopus laevis GN=jade1 PE=2 SV=1 1116 1183 8.0E-12
sp|Q9P2R6|RERE_HUMAN Arginine-glutamic acid dipeptide repeats protein OS=Homo sapiens GN=RERE PE=1 SV=2 679 865 1.0E-11
sp|Q9C5X4|ATX1_ARATH Histone-lysine N-methyltransferase ATX1 OS=Arabidopsis thaliana GN=ATX1 PE=1 SV=2 1108 1227 2.0E-11
sp|Q6IE81|JADE1_HUMAN Protein Jade-1 OS=Homo sapiens GN=JADE1 PE=1 SV=1 1116 1183 3.0E-11
sp|Q6ZPI0|JADE1_MOUSE Protein Jade-1 OS=Mus musculus GN=Jade1 PE=1 SV=2 1116 1183 3.0E-11
sp|Q5E9T7|JADE1_BOVIN Protein Jade-1 OS=Bos taurus GN=JADE1 PE=2 SV=1 1116 1183 4.0E-11
sp|Q8GZ42|ATX5_ARATH Histone-lysine N-methyltransferase ATX5 OS=Arabidopsis thaliana GN=ATX5 PE=2 SV=1 1112 1184 8.0E-11
sp|P0CB22|ATX2_ARATH Histone-lysine N-methyltransferase ATX2 OS=Arabidopsis thaliana GN=ATX2 PE=2 SV=1 1108 1225 1.0E-10
sp|Q9SUE7|ATX4_ARATH Histone-lysine N-methyltransferase ATX4 OS=Arabidopsis thaliana GN=ATX4 PE=2 SV=3 1116 1186 1.0E-10
sp|Q6ZQF7|JADE2_MOUSE Protein Jade-2 OS=Mus musculus GN=Jade2 PE=1 SV=2 1114 1183 2.0E-10
sp|O74759|NTO1_SCHPO Mst2 complex subunit nto1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=nto1 PE=1 SV=1 1111 1185 2.0E-10
sp|Q20318|LIN49_CAEEL Protein lin-49 OS=Caenorhabditis elegans GN=lin-49 PE=1 SV=1 1108 1231 2.0E-10
sp|Q9NQC1|JADE2_HUMAN Protein Jade-2 OS=Homo sapiens GN=JADE2 PE=1 SV=2 1114 1183 3.0E-10
sp|Q9M364|ATX3_ARATH Histone-lysine N-methyltransferase ATX3 OS=Arabidopsis thaliana GN=ATX3 PE=2 SV=2 1116 1184 5.0E-10
sp|Q7ZVP1|JADE3_DANRE Protein Jade-3 OS=Danio rerio GN=jade3 PE=2 SV=1 1112 1179 6.0E-10
sp|Q6IE82|JADE3_MOUSE Protein Jade-3 OS=Mus musculus GN=Jade3 PE=1 SV=1 1116 1183 2.0E-09
sp|Q92613|JADE3_HUMAN Protein Jade-3 OS=Homo sapiens GN=JADE3 PE=1 SV=1 1116 1183 2.0E-09
sp|Q5ZKT9|MIER1_CHICK Mesoderm induction early response protein 1 OS=Gallus gallus GN=MIER1 PE=2 SV=1 637 772 6.0E-09
sp|Q10077|SNT2_SCHPO Lid2 complex component snt2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=snt2 PE=3 SV=1 1108 1190 1.0E-08
sp|Q8BXJ2|TREF1_MOUSE Transcriptional-regulating factor 1 OS=Mus musculus GN=Trerf1 PE=1 SV=1 635 756 1.0E-07
sp|Q09228|EGL27_CAEEL Egg-laying defective protein 27 OS=Caenorhabditis elegans GN=egl-27 PE=1 SV=2 616 938 5.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0003682 chromatin binding Yes
GO:0003674 molecular_function No
GO:0005488 binding No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Nucleus Nuclear localization signal 0.2424 0.9392 0.0603 0.0307 0.0745 0.0071 0.028 0.0108 0.0196 0.0017

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup4416
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|6078
Ophiocordyceps australis map64 (Brazil) OphauB2|4049
Ophiocordyceps camponoti-floridani Ophcf2|00409
Ophiocordyceps camponoti-rufipedis Ophun1|7084
Ophiocordyceps kimflemingae Ophio5|6355
Ophiocordyceps subramaniannii Hirsu2|9145 (this protein)

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|9145
MAQQNDSKAAGTDAHSASESMRASSGSEPATKDPGSEMAAPYGTRSRNRNARPNYAEDKDIDMDNYDYYRDKTGH
ESTKKSARHANATAANAEGPPPRGSSGGARKPLVDEARASAASQNGPKDQTSSSVGSGGSGGGSGGGGSGGGGAA
AAGGGGNGGGGGSGGGGGGGGGGGGGAGAGISGGGGGGGGGAAGASQTGAQASGALQPSRKRKAAAAVVTRRAGS
AVQTSGPPFRETNLMTFEQCDSRPEHGRMKADDGTVLEPNDHVYLVCEPPGEPYYLGRIMEFLHAQNDSARPVDA
VRINWFYRPKDIGRKAIDTRQVFATMHSDISPLTALRGKCRIMHRGEIDNMDHFRKTPDSFWFEKLYDRYIQKNY
DLIPTSSIVNVPDKVKKVLDDRWKFVLVEQGRGKELTSAVKLCKRCSGYCASNDSVDCAVCHNTYHMNCVRPPLL
KKPSRGFAWSCAACSRAQERKLEARNTPNGADVNGDAEDDEFLDDDDDDAAQGINTDRTTPADDAPHHQGTAEQI
YQASLWPWRYLGMHCKPEDALDYDDRIYPRASTRIGPRHQANVSPWPGQPVQYVKPAETKKGSRGPKMSKEAQDA
EKALRGQRPKWVQDQPPGYVARGEDFDDDDPRATSTLLWKPPPPDAVADDAVDDYAKKAQAMAKKLALPERSTNL
RDVALETLFRQDYDVAKALKALPEAERAVFKEPNLTAAEQKKFEEGVSKYGSELHLVKKHVRTMTPGQIVRYYYI
WKKTERGQQVWGAFSGRKGKKQAKRAEAAANKFADDVADNDDDSAFDAAKAADKKRSFVCQFCATTTSRQWRRAP
NVAPGVVNDHGTKPGGKDKGGGQYVVALCRRCAELWRRYGIRFEEMEEVAKKVAQSGGRAWKRKQDEELLKELQA
AQEMGLMTPDRDVTPSSAVAAPPAPAPQEPPRKKLKGAPSESKEPDQACSDAGSGSALSSAPKKKEKPPADATPV
PEMPKPRTLPCAICDQMEPLGDQHVSCRECRLTVHRNCYGIVDNRIQGKWICDMCSNDKSPQVSIQYKCVLCPVE
HTEKDFVDQPKLTHHKKKMSEKDREREKMEVQQARKAAEYYRKKQEEMNRPVNPREPLKRTADNNWVHVTCAVWT
PEVKFGNAKALEPSEGIPSIPRSRYDETCQACSQKGGACIFCHQCRAPYHVECARQQGHLLGFDVSPVKSSRRDQ
FNIVTISGESGTMSAVVWCKDHVPTKTMAHRMHDVVDESGLNALQLYVQSYKQADLTLTGTVRKANLMMNAAKTS
GTPMPASGARRTSTAAAAAAAGTTAVNGSTSQVRSNEATEAASNAQQPGDKVCITCGIDVTPKWWPIDDSLERRL
TNGHHGAIGSEAQKFVEQRKFQCHKCRKAARTPKPYTPGPPTPANEPPPRLRDPSSGPATGVPPLRSPPPAPSDY
RPLRPEIHALLHHPTRHPSPQPPPPPQPPLPPTASAVAAASAVAAPHPPPPPPPPPPAPPAAPPAAPQPPPSATV
PVTGPPHAPAHMMGPRPPAVSHPFATAPPPRQGPYNDWGHQPRHASPPRHLNGGPPPLHGAPPPPPPPPPMSNLS
SLRPPAMSGPPPVTPLSAGHHHAHGSPLYGNGMPSSPRRLSGPAPPAPYVPPYHGGPAPHSASPSLTNGVPPPRA
DAFSHGLHPQRSPYAGPHGSPPMSRNGQLPPPHEPVRPASSMGPRAPESRPASGASASPSLRNLLS*
Coding >Hirsu2|9145
ATGGCACAGCAAAATGACTCCAAAGCCGCAGGCACGGACGCCCACTCAGCGTCCGAGTCGATGAGGGCTTCGTCT
GGCTCAGAACCTGCCACCAAGGACCCCGGCTCGGAAATGGCTGCGCCCTACGGCACCCGCTCGCGCAACAGGAAC
GCACGGCCCAACTACGCAGAGGACAAGGACATCGACATGGACAATTACGACTACTATCGCGACAAGACGGGCCAC
GAAAGCACCAAGAAGTCGGCCCGCCACGCCAACGCGACAGCTGCAAACGCCGAAGGGCCTCCGCCGCGCGGCAGC
AGCGGGGGGGCGCGCAAGCCGCTCGTCGACGAAGCCAGAGCCTCTGCAGCTTCGCAGAATGGCCCCAAGGATCAG
ACTTCCAGCAGTGTCGGCAGTGGTGGCAGTGGTGGTGGCAGTGGTGGTGGTGGCAGTGGTGGTGGTGGCGCCGCC
GCCGCTGGCGGTGGTGGTAATGGAGGTGGTGGTGGCAGCGGCGGCGGCGGTGGTGGTGGTGGTGGTGGTGGAGGA
GGAGCAGGAGCAGGAATCAGCGGCGGCGGCGGCGGCGGCGGCGGCGGCGCTGCGGGTGCCTCGCAAACTGGCGCG
CAGGCATCCGGCGCATTGCAGCCGTCGCGCAAGCGCAAGGCCGCCGCCGCCGTCGTGACGAGACGGGCCGGCAGC
GCCGTGCAAACCTCGGGCCCGCCCTTTCGGGAGACGAACCTGATGACGTTTGAGCAGTGCGACTCGCGCCCTGAA
CACGGGCGGATGAAGGCTGACGACGGGACCGTGTTGGAGCCAAATGACCACGTCTACCTGGTGTGCGAGCCGCCC
GGCGAGCCCTACTACCTGGGCCGCATCATGGAGTTCCTGCACGCGCAGAACGACAGCGCGCGGCCGGTGGACGCG
GTGCGCATCAACTGGTTCTACCGGCCCAAGGACATCGGGCGCAAGGCCATCGACACGCGCCAGGTCTTCGCGACG
ATGCATTCCGACATTAGCCCGCTGACGGCCCTGCGCGGCAAGTGCCGCATCATGCACCGCGGCGAGATTGACAAC
ATGGACCACTTCCGCAAGACGCCCGACAGCTTCTGGTTCGAGAAGCTGTACGACCGCTACATCCAGAAGAACTAC
GACCTGATCCCGACGTCGAGCATCGTCAACGTCCCGGACAAGGTCAAGAAGGTGCTCGACGACCGCTGGAAGTTC
GTCCTGGTGGAGCAGGGCCGTGGCAAGGAGCTCACTAGTGCCGTCAAGCTCTGCAAGAGATGCAGCGGCTACTGC
GCCAGCAATGACTCGGTCGACTGCGCCGTCTGCCACAACACATACCATATGAACTGCGTGCGCCCGCCCCTGCTC
AAGAAGCCGTCGCGCGGCTTCGCCTGGTCCTGCGCCGCCTGCAGCAGGGCCCAGGAGCGCAAGCTCGAGGCCCGC
AACACGCCCAACGGCGCCGACGTCAACGGCGACGCCGAAGACGACGAGTTCCTCGACGACGACGACGACGACGCC
GCCCAGGGCATCAACACCGACCGCACCACGCCCGCCGACGACGCGCCCCATCACCAGGGCACCGCCGAGCAGATC
TACCAGGCGAGCCTGTGGCCCTGGCGCTACCTCGGCATGCACTGCAAGCCCGAGGACGCCCTCGACTACGACGAC
CGCATCTACCCCCGCGCCAGCACCCGCATCGGGCCCCGCCACCAGGCCAATGTCTCCCCCTGGCCCGGCCAGCCC
GTCCAGTACGTCAAGCCGGCCGAGACGAAGAAGGGCTCCAGGGGTCCCAAGATGTCCAAGGAGGCCCAGGACGCC
GAAAAGGCCCTCCGCGGACAGCGCCCGAAATGGGTCCAGGACCAGCCCCCCGGTTACGTGGCCCGCGGCGAGGAC
TTCGACGACGACGACCCCAGGGCCACCTCGACGCTCCTGTGGAAGCCCCCGCCGCCCGACGCCGTCGCCGACGAC
GCCGTCGACGACTACGCCAAGAAGGCGCAGGCCATGGCCAAGAAGCTCGCCCTGCCCGAGCGCTCCACCAATCTC
CGCGACGTGGCCTTGGAGACGCTCTTCCGCCAGGATTACGACGTGGCCAAGGCGCTCAAGGCCCTGCCCGAGGCG
GAGCGCGCCGTGTTCAAGGAGCCCAACCTGACCGCCGCCGAGCAGAAGAAGTTCGAGGAGGGCGTTTCCAAGTAC
GGATCGGAGCTGCATCTGGTCAAGAAGCACGTGAGGACGATGACGCCCGGCCAGATCGTGCGCTACTACTACATC
TGGAAGAAGACGGAGCGCGGCCAGCAGGTCTGGGGCGCCTTCTCCGGCCGAAAGGGCAAGAAGCAGGCCAAGCGG
GCCGAGGCGGCCGCCAACAAGTTCGCCGACGACGTCGCCGACAACGACGACGACTCCGCCTTCGACGCCGCCAAG
GCGGCCGACAAGAAGCGCAGCTTCGTCTGCCAGTTCTGCGCCACGACGACGTCGCGCCAGTGGAGGAGGGCCCCC
AACGTCGCGCCGGGCGTCGTCAACGACCACGGCACCAAGCCGGGCGGCAAGGACAAGGGCGGCGGCCAGTACGTG
GTCGCGCTCTGCCGCCGGTGCGCCGAGCTGTGGCGCCGGTACGGTATCCGCTTCGAGGAGATGGAGGAGGTCGCC
AAGAAGGTCGCGCAGTCGGGCGGCCGGGCCTGGAAGCGCAAGCAGGACGAGGAGCTCCTGAAAGAGCTGCAGGCG
GCCCAGGAGATGGGGCTCATGACGCCCGACCGGGACGTGACGCCCTCGAGCGCCGTCGCCGCGCCCCCCGCGCCC
GCCCCCCAGGAGCCGCCGCGGAAGAAGCTCAAGGGAGCCCCGTCGGAGAGCAAGGAGCCGGACCAAGCCTGCTCG
GACGCGGGCAGCGGCTCGGCCTTGTCGAGCGCGCCCAAGAAGAAGGAGAAGCCGCCGGCCGATGCGACGCCGGTG
CCCGAGATGCCCAAGCCGCGCACGCTGCCGTGCGCCATTTGCGATCAGATGGAGCCCCTCGGGGATCAGCACGTG
TCTTGCAGGGAATGTCGCCTGACCGTGCACCGCAACTGCTACGGCATCGTGGACAATCGCATCCAGGGCAAATGG
ATCTGCGACATGTGCTCCAACGACAAGAGCCCCCAGGTTTCAATCCAATACAAATGCGTCCTGTGTCCCGTGGAG
CACACCGAGAAGGACTTCGTCGACCAGCCGAAGCTGACGCACCACAAGAAGAAGATGTCGGAGAAGGATCGCGAG
CGCGAGAAGATGGAAGTGCAGCAGGCGCGCAAGGCGGCCGAGTACTACCGGAAGAAGCAGGAAGAGATGAACCGG
CCGGTCAACCCCCGAGAGCCTCTGAAGCGCACGGCCGACAACAACTGGGTCCACGTCACCTGTGCCGTCTGGACG
CCCGAGGTCAAGTTCGGGAATGCCAAGGCCCTCGAGCCGTCGGAAGGGATCCCGTCGATACCGAGGTCGCGCTAC
GACGAGACTTGCCAGGCCTGCAGCCAAAAGGGCGGAGCCTGCATCTTCTGCCACCAGTGCCGAGCGCCGTATCAC
GTCGAGTGCGCGCGGCAGCAGGGCCATCTCCTCGGCTTCGACGTGTCCCCGGTCAAGAGCTCACGCCGCGACCAG
TTCAACATCGTGACGATCAGCGGAGAGAGCGGCACCATGTCGGCCGTGGTCTGGTGCAAAGACCACGTGCCGACG
AAGACGATGGCGCACCGCATGCACGACGTGGTCGACGAGTCGGGGCTGAACGCGCTGCAGCTCTACGTGCAGAGC
TACAAGCAGGCCGACCTGACCTTGACCGGCACGGTCCGGAAGGCAAATCTCATGATGAACGCTGCAAAGACGTCG
GGGACCCCCATGCCGGCCAGCGGCGCTCGGCGGACGTCGACCGCCGCCGCCGCCGCCGCCGCCGGCACCACTGCC
GTGAATGGCTCGACGTCGCAGGTGCGCAGCAACGAGGCGACGGAGGCAGCATCGAATGCGCAGCAGCCGGGGGAC
AAGGTGTGCATCACCTGCGGCATCGACGTGACACCCAAGTGGTGGCCCATCGACGACTCCCTGGAGCGGAGACTC
ACCAATGGCCACCACGGCGCCATCGGATCCGAGGCGCAGAAGTTCGTGGAGCAGAGGAAGTTCCAGTGCCACAAG
TGCCGCAAGGCCGCCCGGACTCCGAAGCCCTACACCCCGGGGCCCCCGACGCCGGCTAATGAGCCTCCCCCTCGC
CTGCGCGATCCGAGCAGCGGGCCGGCAACCGGGGTGCCGCCGTTACGAAGCCCGCCGCCGGCTCCATCCGACTAT
CGACCCTTGCGGCCCGAGATACACGCCCTGCTGCATCATCCGACCCGTCACCCGTCGCCGCAGCCGCCGCCGCCG
CCGCAGCCACCCCTCCCCCCCACCGCCTCTGCAGTGGCTGCCGCCTCCGCCGTCGCCGCTCCCCATCCTCCTCCT
CCTCCTCCTCCTCCTCCGCCGGCTCCTCCCGCCGCTCCTCCCGCCGCTCCTCAGCCCCCGCCTTCGGCCACAGTG
CCGGTCACGGGGCCGCCGCACGCACCGGCGCACATGATGGGGCCGAGGCCGCCGGCGGTGTCGCACCCGTTCGCG
ACAGCTCCGCCTCCCCGGCAGGGGCCGTACAACGACTGGGGCCATCAGCCAAGGCACGCTTCTCCCCCTCGGCAC
CTCAACGGAGGTCCTCCGCCGCTGCATGGGGCCCCGCCGCCGCCGCCGCCGCCGCCGCCCATGTCCAATCTATCG
TCGCTCCGGCCCCCGGCCATGTCGGGGCCGCCCCCGGTCACACCTCTCTCGGCAGGTCACCACCACGCGCACGGC
TCTCCGCTGTACGGAAACGGCATGCCGTCATCGCCGCGCCGACTGAGCGGGCCGGCTCCGCCAGCGCCCTACGTC
CCCCCCTACCACGGCGGGCCGGCGCCGCATAGCGCGTCTCCCAGCTTGACCAACGGGGTGCCGCCGCCGCGCGCC
GACGCGTTCTCTCACGGCCTTCATCCACAACGCTCGCCGTATGCGGGCCCCCACGGAAGTCCTCCGATGTCGAGG
AACGGACAGCTGCCGCCGCCGCACGAACCGGTGAGGCCGGCGAGCTCGATGGGACCTCGGGCGCCCGAGAGTAGG
CCGGCCAGCGGCGCAAGCGCAAGCCCATCGCTGCGCAATCTCCTGTCATGA
Transcript >Hirsu2|9145
ATGGCACAGCAAAATGACTCCAAAGCCGCAGGCACGGACGCCCACTCAGCGTCCGAGTCGATGAGGGCTTCGTCT
GGCTCAGAACCTGCCACCAAGGACCCCGGCTCGGAAATGGCTGCGCCCTACGGCACCCGCTCGCGCAACAGGAAC
GCACGGCCCAACTACGCAGAGGACAAGGACATCGACATGGACAATTACGACTACTATCGCGACAAGACGGGCCAC
GAAAGCACCAAGAAGTCGGCCCGCCACGCCAACGCGACAGCTGCAAACGCCGAAGGGCCTCCGCCGCGCGGCAGC
AGCGGGGGGGCGCGCAAGCCGCTCGTCGACGAAGCCAGAGCCTCTGCAGCTTCGCAGAATGGCCCCAAGGATCAG
ACTTCCAGCAGTGTCGGCAGTGGTGGCAGTGGTGGTGGCAGTGGTGGTGGTGGCAGTGGTGGTGGTGGCGCCGCC
GCCGCTGGCGGTGGTGGTAATGGAGGTGGTGGTGGCAGCGGCGGCGGCGGTGGTGGTGGTGGTGGTGGTGGAGGA
GGAGCAGGAGCAGGAATCAGCGGCGGCGGCGGCGGCGGCGGCGGCGGCGCTGCGGGTGCCTCGCAAACTGGCGCG
CAGGCATCCGGCGCATTGCAGCCGTCGCGCAAGCGCAAGGCCGCCGCCGCCGTCGTGACGAGACGGGCCGGCAGC
GCCGTGCAAACCTCGGGCCCGCCCTTTCGGGAGACGAACCTGATGACGTTTGAGCAGTGCGACTCGCGCCCTGAA
CACGGGCGGATGAAGGCTGACGACGGGACCGTGTTGGAGCCAAATGACCACGTCTACCTGGTGTGCGAGCCGCCC
GGCGAGCCCTACTACCTGGGCCGCATCATGGAGTTCCTGCACGCGCAGAACGACAGCGCGCGGCCGGTGGACGCG
GTGCGCATCAACTGGTTCTACCGGCCCAAGGACATCGGGCGCAAGGCCATCGACACGCGCCAGGTCTTCGCGACG
ATGCATTCCGACATTAGCCCGCTGACGGCCCTGCGCGGCAAGTGCCGCATCATGCACCGCGGCGAGATTGACAAC
ATGGACCACTTCCGCAAGACGCCCGACAGCTTCTGGTTCGAGAAGCTGTACGACCGCTACATCCAGAAGAACTAC
GACCTGATCCCGACGTCGAGCATCGTCAACGTCCCGGACAAGGTCAAGAAGGTGCTCGACGACCGCTGGAAGTTC
GTCCTGGTGGAGCAGGGCCGTGGCAAGGAGCTCACTAGTGCCGTCAAGCTCTGCAAGAGATGCAGCGGCTACTGC
GCCAGCAATGACTCGGTCGACTGCGCCGTCTGCCACAACACATACCATATGAACTGCGTGCGCCCGCCCCTGCTC
AAGAAGCCGTCGCGCGGCTTCGCCTGGTCCTGCGCCGCCTGCAGCAGGGCCCAGGAGCGCAAGCTCGAGGCCCGC
AACACGCCCAACGGCGCCGACGTCAACGGCGACGCCGAAGACGACGAGTTCCTCGACGACGACGACGACGACGCC
GCCCAGGGCATCAACACCGACCGCACCACGCCCGCCGACGACGCGCCCCATCACCAGGGCACCGCCGAGCAGATC
TACCAGGCGAGCCTGTGGCCCTGGCGCTACCTCGGCATGCACTGCAAGCCCGAGGACGCCCTCGACTACGACGAC
CGCATCTACCCCCGCGCCAGCACCCGCATCGGGCCCCGCCACCAGGCCAATGTCTCCCCCTGGCCCGGCCAGCCC
GTCCAGTACGTCAAGCCGGCCGAGACGAAGAAGGGCTCCAGGGGTCCCAAGATGTCCAAGGAGGCCCAGGACGCC
GAAAAGGCCCTCCGCGGACAGCGCCCGAAATGGGTCCAGGACCAGCCCCCCGGTTACGTGGCCCGCGGCGAGGAC
TTCGACGACGACGACCCCAGGGCCACCTCGACGCTCCTGTGGAAGCCCCCGCCGCCCGACGCCGTCGCCGACGAC
GCCGTCGACGACTACGCCAAGAAGGCGCAGGCCATGGCCAAGAAGCTCGCCCTGCCCGAGCGCTCCACCAATCTC
CGCGACGTGGCCTTGGAGACGCTCTTCCGCCAGGATTACGACGTGGCCAAGGCGCTCAAGGCCCTGCCCGAGGCG
GAGCGCGCCGTGTTCAAGGAGCCCAACCTGACCGCCGCCGAGCAGAAGAAGTTCGAGGAGGGCGTTTCCAAGTAC
GGATCGGAGCTGCATCTGGTCAAGAAGCACGTGAGGACGATGACGCCCGGCCAGATCGTGCGCTACTACTACATC
TGGAAGAAGACGGAGCGCGGCCAGCAGGTCTGGGGCGCCTTCTCCGGCCGAAAGGGCAAGAAGCAGGCCAAGCGG
GCCGAGGCGGCCGCCAACAAGTTCGCCGACGACGTCGCCGACAACGACGACGACTCCGCCTTCGACGCCGCCAAG
GCGGCCGACAAGAAGCGCAGCTTCGTCTGCCAGTTCTGCGCCACGACGACGTCGCGCCAGTGGAGGAGGGCCCCC
AACGTCGCGCCGGGCGTCGTCAACGACCACGGCACCAAGCCGGGCGGCAAGGACAAGGGCGGCGGCCAGTACGTG
GTCGCGCTCTGCCGCCGGTGCGCCGAGCTGTGGCGCCGGTACGGTATCCGCTTCGAGGAGATGGAGGAGGTCGCC
AAGAAGGTCGCGCAGTCGGGCGGCCGGGCCTGGAAGCGCAAGCAGGACGAGGAGCTCCTGAAAGAGCTGCAGGCG
GCCCAGGAGATGGGGCTCATGACGCCCGACCGGGACGTGACGCCCTCGAGCGCCGTCGCCGCGCCCCCCGCGCCC
GCCCCCCAGGAGCCGCCGCGGAAGAAGCTCAAGGGAGCCCCGTCGGAGAGCAAGGAGCCGGACCAAGCCTGCTCG
GACGCGGGCAGCGGCTCGGCCTTGTCGAGCGCGCCCAAGAAGAAGGAGAAGCCGCCGGCCGATGCGACGCCGGTG
CCCGAGATGCCCAAGCCGCGCACGCTGCCGTGCGCCATTTGCGATCAGATGGAGCCCCTCGGGGATCAGCACGTG
TCTTGCAGGGAATGTCGCCTGACCGTGCACCGCAACTGCTACGGCATCGTGGACAATCGCATCCAGGGCAAATGG
ATCTGCGACATGTGCTCCAACGACAAGAGCCCCCAGGTTTCAATCCAATACAAATGCGTCCTGTGTCCCGTGGAG
CACACCGAGAAGGACTTCGTCGACCAGCCGAAGCTGACGCACCACAAGAAGAAGATGTCGGAGAAGGATCGCGAG
CGCGAGAAGATGGAAGTGCAGCAGGCGCGCAAGGCGGCCGAGTACTACCGGAAGAAGCAGGAAGAGATGAACCGG
CCGGTCAACCCCCGAGAGCCTCTGAAGCGCACGGCCGACAACAACTGGGTCCACGTCACCTGTGCCGTCTGGACG
CCCGAGGTCAAGTTCGGGAATGCCAAGGCCCTCGAGCCGTCGGAAGGGATCCCGTCGATACCGAGGTCGCGCTAC
GACGAGACTTGCCAGGCCTGCAGCCAAAAGGGCGGAGCCTGCATCTTCTGCCACCAGTGCCGAGCGCCGTATCAC
GTCGAGTGCGCGCGGCAGCAGGGCCATCTCCTCGGCTTCGACGTGTCCCCGGTCAAGAGCTCACGCCGCGACCAG
TTCAACATCGTGACGATCAGCGGAGAGAGCGGCACCATGTCGGCCGTGGTCTGGTGCAAAGACCACGTGCCGACG
AAGACGATGGCGCACCGCATGCACGACGTGGTCGACGAGTCGGGGCTGAACGCGCTGCAGCTCTACGTGCAGAGC
TACAAGCAGGCCGACCTGACCTTGACCGGCACGGTCCGGAAGGCAAATCTCATGATGAACGCTGCAAAGACGTCG
GGGACCCCCATGCCGGCCAGCGGCGCTCGGCGGACGTCGACCGCCGCCGCCGCCGCCGCCGCCGGCACCACTGCC
GTGAATGGCTCGACGTCGCAGGTGCGCAGCAACGAGGCGACGGAGGCAGCATCGAATGCGCAGCAGCCGGGGGAC
AAGGTGTGCATCACCTGCGGCATCGACGTGACACCCAAGTGGTGGCCCATCGACGACTCCCTGGAGCGGAGACTC
ACCAATGGCCACCACGGCGCCATCGGATCCGAGGCGCAGAAGTTCGTGGAGCAGAGGAAGTTCCAGTGCCACAAG
TGCCGCAAGGCCGCCCGGACTCCGAAGCCCTACACCCCGGGGCCCCCGACGCCGGCTAATGAGCCTCCCCCTCGC
CTGCGCGATCCGAGCAGCGGGCCGGCAACCGGGGTGCCGCCGTTACGAAGCCCGCCGCCGGCTCCATCCGACTAT
CGACCCTTGCGGCCCGAGATACACGCCCTGCTGCATCATCCGACCCGTCACCCGTCGCCGCAGCCGCCGCCGCCG
CCGCAGCCACCCCTCCCCCCCACCGCCTCTGCAGTGGCTGCCGCCTCCGCCGTCGCCGCTCCCCATCCTCCTCCT
CCTCCTCCTCCTCCTCCGCCGGCTCCTCCCGCCGCTCCTCCCGCCGCTCCTCAGCCCCCGCCTTCGGCCACAGTG
CCGGTCACGGGGCCGCCGCACGCACCGGCGCACATGATGGGGCCGAGGCCGCCGGCGGTGTCGCACCCGTTCGCG
ACAGCTCCGCCTCCCCGGCAGGGGCCGTACAACGACTGGGGCCATCAGCCAAGGCACGCTTCTCCCCCTCGGCAC
CTCAACGGAGGTCCTCCGCCGCTGCATGGGGCCCCGCCGCCGCCGCCGCCGCCGCCGCCCATGTCCAATCTATCG
TCGCTCCGGCCCCCGGCCATGTCGGGGCCGCCCCCGGTCACACCTCTCTCGGCAGGTCACCACCACGCGCACGGC
TCTCCGCTGTACGGAAACGGCATGCCGTCATCGCCGCGCCGACTGAGCGGGCCGGCTCCGCCAGCGCCCTACGTC
CCCCCCTACCACGGCGGGCCGGCGCCGCATAGCGCGTCTCCCAGCTTGACCAACGGGGTGCCGCCGCCGCGCGCC
GACGCGTTCTCTCACGGCCTTCATCCACAACGCTCGCCGTATGCGGGCCCCCACGGAAGTCCTCCGATGTCGAGG
AACGGACAGCTGCCGCCGCCGCACGAACCGGTGAGGCCGGCGAGCTCGATGGGACCTCGGGCGCCCGAGAGTAGG
CCGGCCAGCGGCGCAAGCGCAAGCCCATCGCTGCGCAATCTCCTGTCATGA
Gene >Hirsu2|9145
ATGGCACAGCAAAATGTCAGTCATCTTCCTCCGTCTTTTCTTCAATTCCTCATCACCACGCTTCCTCCCACCTCC
CCCCCCCTCCCCCCTCCTTTTTTTTTTGTTGGTAAAATGCTGGGCCCCATCGCCCGGGATCCGGTCCTCTTGCTC
ATTTTACCCCCCTCCATCGTCGACTCGGCTGACACGTCAAGCAGGACTCCAAAGCCGCAGGCACGGACGCCCACT
CAGCGTCCGAGTCGATGAGGGCTTCGTCTGGCTCAGAACCTGCCACCAAGGACCCCGGCTCGGAAATGGCTGCGC
CCTACGGCACCCGCTCGCGCAACAGGAACGCACGGCCCAACTACGCAGAGGACAAGGACATCGACATGGACAATT
ACGACTACTATCGCGACAAGACGGGCCACGAAAGCACCAAGAAGTCGGCCCGCCACGCCAACGCGACAGCTGCAA
ACGCCGAAGGGCCTCCGCCGCGCGGCAGCAGCGGGGGGGCGCGCAAGCCGCTCGTCGACGAAGCCAGAGCCTCTG
CAGCTTCGCAGAATGGCCCCAAGGATCAGACTTCCAGCAGTGTCGGCAGTGGTGGCAGTGGTGGTGGCAGTGGTG
GTGGTGGCAGTGGTGGTGGTGGCGCCGCCGCCGCTGGCGGTGGTGGTAATGGAGGTGGTGGTGGCAGCGGCGGCG
GCGGTGGTGGTGGTGGTGGTGGTGGAGGAGGAGCAGGAGCAGGAATCAGCGGCGGCGGCGGCGGCGGCGGCGGCG
GCGCTGCGGGTGCCTCGCAAACTGGCGCGCAGGCATCCGGCGCATTGCAGCCGTCGCGCAAGCGCAAGGCCGCCG
CCGCCGTCGTGACGAGACGGGCCGGCAGCGCCGTGCAAACCTCGGGCCCGCCCTTTCGGGAGACGAACCTGATGA
CGTTTGAGCAGTGCGACTCGCGCCCTGAACACGGGCGGATGAAGGCTGACGACGGGACCGTGTTGGAGCCAAATG
GTGAGTCTCTTCCCCCCCCCCCGGTACCAGCGGCACGGCCAGGATCCACCCAGCCTCTCTCTCTGTCTCGGGGGG
CCTACGGGGCCAAATTCCAGCACCGGTCGCCACCGCTCGAAAATGGTGCAGCGGCCAGCGACGACGCCCGCAAGG
CCTGTCGTCGTCGGCACCGAGCACGCAGAGACAAGGGCCGGGCATGGGGCGGCCGCTGGGCACGCGCGCTGGGCG
AGCGTCGGCTGACGAGAGGCAGACCACGTCTACCTGGTGTGCGAGCCGCCCGGCGAGCCCTACTACCTGGGCCGC
ATCATGGAGTTCCTGCACGCGCAGAACGACAGCGCGCGGCCGGTGGACGCGGTGCGCATCAACTGGTTCTACCGG
CCCAAGGACATCGGGCGCAAGGCCATCGACACGCGCCAGGTCTTCGCGACGATGCATTCCGACATTAGCCCGCTG
ACGGCCCTGCGCGGCAAGTGCCGCATCATGCACCGCGGCGAGATTGACAACATGGACCACTTCCGCAAGACGCCC
GACAGCTTCTGGTTCGAGAAGCTGTACGACCGCTACATCCAGAAGAACTACGACCTGATCCCGACGTCGAGCATC
GTCAACGTCCCGGACAAGGTCAAGAAGGTGCTCGACGACCGCTGGAAGTTCGTCCTGGTGGAGCAGGGCCGTGGC
AAGGAGCTCACTAGTGCCGTCAAGCTCTGCAAGAGATGCAGCGGCTACTGCGCCAGGTACGTACCGCCCGCCCTG
ACGGAGCACGGGAGCAAGGGAGCGGAGGGAGGAGAGGGCGAGCGCGCGAGCGCGCGCCAGGGCGAGAGCCGGAGA
GCCGGGGAGCCGGAGAGCCGGAGAGCCGGAGAGGCGAGGCCGGCTCGAGGCGAGGCGCCCGGGCGCAACTGACAA
CGACGGCGACGGGGGCTGACGCGCGCCCTGTCCCAGCAATGACTCGGTCGACTGCGCCGTCTGCCACAACACATA
CCATATGAACTGCGTGCGCCCGCCCCTGCTCAAGAAGCCGTCGCGCGGCTTCGCCTGGTCCTGCGCCGCCTGCAG
CAGGGCCCAGGAGCGCAAGCTCGAGGCCCGCAACACGCCCAACGGCGCCGACGTCAACGGCGACGCCGAAGACGA
CGAGTTCCTCGACGACGACGACGACGACGCCGCCCAGGGCATCAACACCGACCGCACCACGCCCGCCGACGACGC
GCCCCATCACCAGGGCACCGCCGAGCAGATCTACCAGGCGAGCCTGTGGCCCTGGCGCTACCTCGGCATGCACTG
CAAGCCCGAGGACGCCCTCGACTACGACGACCGCATCTACCCCCGCGCCAGCACCCGCATCGGGCCCCGCCACCA
GGCCAATGTCTCCCCCTGGCCCGGCCAGCCCGTCCAGTACGTCAAGCCGGCCGAGACGAAGAAGGGCTCCAGGGG
TCCCAAGATGTCCAAGGAGGCCCAGGACGCCGAAAAGGCCCTCCGCGGACAGCGCCCGAAATGGGTCCAGGACCA
GCCCCCCGGTTACGTGGCCCGCGGCGAGGACTTCGACGACGACGACCCCAGGGCCACCTCGACGCTCCTGTGGAA
GCCCCCGCCGCCCGACGCCGTCGCCGACGACGCCGTCGACGACTACGCCAAGAAGGCGCAGGCCATGGCCAAGAA
GCTCGCCCTGCCCGAGCGCTCCACCAATCTCCGCGACGTGGCCTTGGAGACGCTCTTCCGCCAGGATTACGACGT
GGCCAAGGCGCTCAAGGCCCTGCCCGAGGCGGAGCGCGCCGTGTTCAAGGAGCCCAACCTGACCGCCGCCGAGCA
GAAGAAGTTCGAGGAGGGCGTTTCCAAGTACGGATCGGAGCTGCATCTGGTCAAGAAGCACGTGAGGACGATGAC
GCCCGGCCAGATCGTGCGCTACTACTACATCTGGAAGAAGACGGAGCGCGGCCAGCAGGTCTGGGGCGCCTTCTC
CGGCCGAAAGGGCAAGAAGCAGGCCAAGCGGGCCGAGGCGGCCGCCAACAAGTTCGCCGACGACGTCGCCGACAA
CGACGACGACTCCGCCTTCGACGCCGCCAAGGCGGCCGACAAGAAGCGCAGCTTCGTCTGCCAGTTCTGCGCCAC
GACGACGTCGCGCCAGTGGAGGAGGGCCCCCAACGTCGCGCCGGGCGTCGTCAACGACCACGGCACCAAGCCGGG
CGGCAAGGACAAGGGCGGCGGCCAGTACGTGGTCGCGCTCTGCCGCCGGTGCGCCGAGCTGTGGCGCCGGTACGG
TATCCGCTTCGAGGAGATGGAGGAGGTCGCCAAGAAGGTCGCGCAGTCGGGCGGCCGGGCCTGGAAGCGCAAGCA
GGACGAGGAGCTCCTGAAAGAGCTGCAGGCGGCCCAGGAGATGGGGCTCATGACGCCCGACCGGGACGTGACGCC
CTCGAGCGCCGTCGCCGCGCCCCCCGCGCCCGCCCCCCAGGAGCCGCCGCGGAAGAAGCTCAAGGGAGCCCCGTC
GGAGAGCAAGGAGCCGGACCAAGCCTGCTCGGACGCGGGCAGCGGCTCGGCCTTGTCGAGCGCGCCCAAGAAGAA
GGAGAAGCCGCCGGCCGATGCGACGCCGGTGCCCGAGATGCCCAAGCCGCGCACGCTGCCGTGCGCCATTTGCGA
TCAGATGGAGCCCCTCGGGGATCAGCACGTGTCTTGCAGGGAATGTCGCCTGACCGTGCACCGCAACTGCTACGG
CATCGTGGACAATCGCATCCAGGGCAAATGGATCTGCGACATGTGCTCCAACGACAAGAGCCCCCAGGTTTCAAT
CGTAAGTGGCCCGATCGATCGGCAAGGACTCCCCCGGCTCGGGCGCCGACCCCGCCCTCCCTCTTCTCCCCCACC
TCTTCGTCGGCGGAGAGATCGCTCACCATGTCGCAGCAATACAAATGCGTCCTGTGTCCCGTGGAGCACACCGAG
AAGGACTTCGTCGACCAGCCGAAGCTGACGCACCACAAGAAGAAGATGTCGGAGAAGGATCGCGAGCGCGAGAAG
ATGGAAGTGCAGCAGGCGCGCAAGGCGGCCGAGTACTACCGGAAGAAGCAGGAAGAGATGAACCGGCCGGTCAAC
CCCCGAGAGCCTCTGAAGCGCACGGCCGACAACAACTGGGTCCACGTCACCTGTGCCGTCTGGACGCCCGAGGTC
AAGTTCGGGAATGCCAAGGCCCTCGAGCCGTCGGAAGGGATCCCGTCGATACCGAGGTCGCGCTACGACGAGACT
TGCCAGGCCTGCAGCCAAAAGGGCGGAGCCTGCATCTTCTGCCACCAGTGCCGAGCGCCGTGTATGCCGAACCCC
CCCGCCTGACCCGCTCGGAGAGCGACGATGCTAACGGACCGCTTCCGCTCAGATCACGTCGAGTGCGCGCGGCAG
CAGGGCCATCTCCTCGGCTTCGACGTGTCCCCGGTCAAGAGCTCACGCCGCGACCAGTTCAACATCGTGACGATC
AGCGGAGAGAGCGGCACCATGTCGGCCGTGGTCTGGTGCAAAGACCACGTGCCGACGAAGACGATGGCGCACCGC
ATGCACGACGTGGTCGACGAGTCGGGGCTGAACGCGCTGCAGCTCTACGTGCAGAGCTACAAGCAGGCCGACCTG
ACCTTGACCGGCACGGTCCGGAAGGCAAATCTCATGATGAACGCTGCAAAGACGTCGGGGACCCCCATGCCGGCC
AGCGGCGCTCGGCGGACGTCGACCGCCGCCGCCGCCGCCGCCGCCGGCACCACTGCCGTGAATGGCTCGACGTCG
CAGGTGCGCAGCAACGAGGCGACGGAGGCAGCATCGAATGCGCAGCAGCCGGGGGACAAGGTGTGCATCACCTGC
GGCATCGACGTGACACCCAAGTGGTGGCCCATCGACGACTCCCTGGAGCGGAGACTCACCAATGGCCACCACGGC
GCCATCGGATCCGAGGCGCAGAAGTTCGTGGAGCAGAGGAAGTTCCAGTGCCACAAGTGCCGCAAGGCCGCCCGG
ACTCCGAAGCCCTACACCCCGGGGCCCCCGACGCCGGCTAATGAGCCTCCCCCTCGCCTGCGCGATCCGAGCAGC
GGGCCGGCAACCGGGGTGCCGCCGTTACGAAGCCCGCCGCCGGCTCCATCCGACTATCGACCCTTGCGGCCCGAG
ATACACGCCCTGCTGCATCATCCGACCCGTCACCCGTCGCCGCAGCCGCCGCCGCCGCCGCAGCCACCCCTCCCC
CCCACCGCCTCTGCAGTGGCTGCCGCCTCCGCCGTCGCCGCTCCCCATCCTCCTCCTCCTCCTCCTCCTCCTCCG
CCGGCTCCTCCCGCCGCTCCTCCCGCCGCTCCTCAGCCCCCGCCTTCGGCCACAGTGCCGGTCACGGGGCCGCCG
CACGCACCGGCGCACATGATGGGGCCGAGGCCGCCGGCGGTGTCGCACCCGTTCGCGACAGCTCCGCCTCCCCGG
CAGGGGCCGTACAACGACTGGGGCCATCAGCCAAGGCACGCTTCTCCCCCTCGGCACCTCAACGGAGGTCCTCCG
CCGCTGCATGGGGCCCCGCCGCCGCCGCCGCCGCCGCCGCCCATGTCCAATCTATCGTCGCTCCGGCCCCCGGCC
ATGTCGGGGCCGCCCCCGGTCACACCTCTCTCGGCAGGTCACCACCACGCGCACGGCTCTCCGCTGTACGGAAAC
GGCATGCCGTCATCGCCGCGCCGACTGAGCGGGCCGGCTCCGCCAGCGCCCTACGTCCCCCCCTACCACGGCGGG
CCGGCGCCGCATAGCGCGTCTCCCAGCTTGACCAACGGGGTGCCGCCGCCGCGCGCCGACGCGTTCTCTCACGGC
CTTCATCCACAACGCTCGCCGTATGCGGGCCCCCACGGAAGTCCTCCGATGTCGAGGAACGGACAGCTGCCGCCG
CCGCACGAACCGGTGAGGCCGGCGAGCTCGATGGGACCTCGGGCGCCCGAGAGTAGGCCGGCCAGCGGCGCAAGC
GCAAGCCCATCGCTGCGCAATCTCCTGTCATGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail