Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|9131
Gene name
LocationContig_642:1919..3713
Strand+
Gene length (bp)1794
Transcript length (bp)1254
Coding sequence length (bp)1254
Protein length (aa) 418

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01494 FAD_binding_3 FAD binding domain 3.8E-20 11 370
PF13450 NAD_binding_8 NAD(P)-binding Rossmann-like domain 1.9E-07 14 41
PF00890 FAD_binding_2 FAD binding domain 1.4E-04 13 40

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9F131|3HBH1_PSEAC 3-hydroxybenzoate 6-hydroxylase 1 OS=Pseudomonas alcaligenes GN=xlnD PE=1 SV=1 12 377 2.0E-34
sp|Q53552|NHG2_PSEPU Salicylate hydroxylase OS=Pseudomonas putida GN=nahG PE=4 SV=1 6 377 5.0E-31
sp|Q5EXK1|3HBH_KLEOX 3-hydroxybenzoate 6-hydroxylase OS=Klebsiella oxytoca GN=mhbM PE=1 SV=1 25 376 2.0E-28
sp|Q3S4B7|3HBH_POLNA 3-hydroxybenzoate 6-hydroxylase OS=Polaromonas naphthalenivorans (strain CJ2) GN=nagX PE=1 SV=1 30 364 1.0E-27
sp|Q88FY2|6HN3M_PSEPK 6-hydroxynicotinate 3-monooxygenase OS=Pseudomonas putida (strain KT2440) GN=nicC PE=1 SV=1 32 384 3.0E-27
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9F131|3HBH1_PSEAC 3-hydroxybenzoate 6-hydroxylase 1 OS=Pseudomonas alcaligenes GN=xlnD PE=1 SV=1 12 377 2.0E-34
sp|Q53552|NHG2_PSEPU Salicylate hydroxylase OS=Pseudomonas putida GN=nahG PE=4 SV=1 6 377 5.0E-31
sp|Q5EXK1|3HBH_KLEOX 3-hydroxybenzoate 6-hydroxylase OS=Klebsiella oxytoca GN=mhbM PE=1 SV=1 25 376 2.0E-28
sp|Q3S4B7|3HBH_POLNA 3-hydroxybenzoate 6-hydroxylase OS=Polaromonas naphthalenivorans (strain CJ2) GN=nagX PE=1 SV=1 30 364 1.0E-27
sp|Q88FY2|6HN3M_PSEPK 6-hydroxynicotinate 3-monooxygenase OS=Pseudomonas putida (strain KT2440) GN=nicC PE=1 SV=1 32 384 3.0E-27
sp|P86491|6HN3M_PSEFL 6-hydroxynicotinate 3-monooxygenase OS=Pseudomonas fluorescens PE=1 SV=1 30 372 1.0E-26
sp|P23262|NHG1_PSEPU Salicylate hydroxylase OS=Pseudomonas putida GN=nahG PE=1 SV=4 25 377 9.0E-25
sp|B6D1N4|HPXO_KLEPN FAD-dependent urate hydroxylase OS=Klebsiella pneumoniae GN=hpxO PE=3 SV=1 10 384 4.0E-22
sp|A6T923|HPXO_KLEP7 FAD-dependent urate hydroxylase OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=hpxO PE=1 SV=1 10 384 6.0E-22
sp|Q0QFQ1|3HBH2_PSEAC 3-hydroxybenzoate 6-hydroxylase 2 OS=Pseudomonas alcaligenes GN=hbzD PE=2 SV=1 101 379 6.0E-21
sp|Q40412|ABA2_NICPL Zeaxanthin epoxidase, chloroplastic OS=Nicotiana plumbaginifolia GN=ABA2 PE=1 SV=1 8 375 4.0E-19
sp|P93236|ABA2_SOLLC Zeaxanthin epoxidase, chloroplastic OS=Solanum lycopersicum PE=2 SV=1 8 375 2.0E-17
sp|Q0JCU7|ZEP_ORYSJ Zeaxanthin epoxidase, chloroplastic OS=Oryza sativa subsp. japonica GN=ZEP PE=2 SV=1 4 375 3.0E-16
sp|O81360|ABA2_PRUAR Zeaxanthin epoxidase, chloroplastic OS=Prunus armeniaca PE=2 SV=1 7 375 5.0E-16
sp|Q9I0Q0|PQSH_PSEAE 2-heptyl-3-hydroxy-4(1H)-quinolone synthase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=pqsH PE=3 SV=1 10 376 9.0E-16
sp|O06489|YETM_BACSU Putative oxidoreductase YetM OS=Bacillus subtilis (strain 168) GN=yetM PE=3 SV=1 26 377 6.0E-15
sp|Q02N79|PQSH_PSEAB 2-heptyl-3-hydroxy-4(1H)-quinolone synthase OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=pqsH PE=1 SV=1 10 376 7.0E-15
sp|B5B0J6|HPXO_KLEOX FAD-dependent urate hydroxylase OS=Klebsiella oxytoca GN=hpxO PE=3 SV=1 22 384 7.0E-14
sp|Q96375|ABA2_CAPAN Zeaxanthin epoxidase, chloroplastic OS=Capsicum annuum PE=2 SV=1 8 375 6.0E-13
sp|Q8NLB6|3HBH_CORGL 3-hydroxybenzoate 6-hydroxylase OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=Cgl3026 PE=1 SV=1 34 334 9.0E-11
sp|A8LVF4|KMO_SALAI Kynurenine 3-monooxygenase OS=Salinispora arenicola (strain CNS-205) GN=kmo PE=3 SV=1 16 341 4.0E-06
sp|Q84HF5|KMO_PSEFL Kynurenine 3-monooxygenase OS=Pseudomonas fluorescens GN=kmo PE=1 SV=1 142 337 4.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0071949 FAD binding Yes
GO:0050662 coenzyme binding No
GO:1901363 heterocyclic compound binding No
GO:0048037 cofactor binding No
GO:0036094 small molecule binding No
GO:0043167 ion binding No
GO:0000166 nucleotide binding No
GO:0097159 organic cyclic compound binding No
GO:0050660 flavin adenine dinucleotide binding No
GO:0003674 molecular_function No
GO:0043168 anion binding No
GO:0005488 binding No
GO:1901265 nucleoside phosphate binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 26 0.5

Transmembrane Domains

Domain # Start End Length
1 9 28 19

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|9131
MQVGAAPRPLAVYIVGAGIGGLTAAVALRRAGHNVTVLERSRLACEVGAAINVPPNAMAVLCPLGVNPTSHGAVV
LQTVTEYGKSGELVHAHDVSFLSEESTHPFLLCHRVDLHSQLKAAATSPRGLGKPVELRTSSPVADVDADRALVT
LRDGTSFRGDLVVGADGIHSKTRCKVAATKPFPSGKSAHRFMLDRAQVDEVPGLGELFKPGDLTFWADVDRRVIV
YPARDGRLLNVVCIHPDDPDRWDGDGAAGRETWNESSTRAGLLSLYAGFDERALALMGLADESTLRVWRLMDMDA
LPAWHVGRLCLLGDAAHPFLPHQGQGAAQAIEDAAALEIVLPFGVDEAEVPARLALYQRCRQQRADAVQRLTRLS
GEDMQSGQADVTTKAVGFFRLNCEYNERHNSTDILRHWMMRE*
Coding >Hirsu2|9131
ATGCAAGTCGGCGCAGCCCCGCGGCCCTTGGCCGTCTACATCGTCGGCGCGGGCATCGGCGGCCTCACGGCGGCC
GTGGCCCTGCGCCGCGCAGGGCACAACGTGACGGTGCTGGAGAGGTCGAGGCTCGCGTGCGAGGTCGGCGCCGCC
ATCAACGTGCCTCCCAACGCCATGGCCGTCCTGTGTCCGCTGGGTGTCAACCCTACCAGCCACGGAGCCGTCGTC
TTGCAAACGGTGACCGAGTACGGCAAGTCCGGGGAGCTGGTGCACGCCCACGACGTCTCCTTTCTCAGCGAGGAG
AGCACACACCCCTTTCTTCTCTGCCACCGAGTCGATTTGCACTCGCAGCTCAAGGCCGCCGCGACGTCGCCGCGC
GGCCTGGGAAAGCCGGTTGAGCTGCGCACGAGCTCGCCCGTCGCTGACGTCGACGCCGACCGGGCCCTCGTCACG
CTCCGGGACGGCACCAGCTTCCGGGGCGACCTCGTCGTCGGCGCAGATGGGATCCACTCCAAGACGCGCTGCAAA
GTCGCAGCGACCAAGCCCTTCCCCTCCGGCAAGAGCGCGCACCGCTTCATGCTCGACAGAGCCCAGGTCGACGAG
GTCCCCGGCCTCGGCGAGCTCTTCAAGCCCGGGGACCTGACCTTCTGGGCCGACGTCGACCGGCGCGTCATCGTG
TATCCGGCCCGCGACGGCCGCCTGCTCAACGTCGTCTGCATCCACCCCGACGACCCGGACAGATGGGACGGCGAC
GGCGCGGCCGGGCGCGAGACGTGGAACGAGTCCAGCACACGCGCAGGCCTGCTGAGTCTGTACGCCGGCTTCGAC
GAGCGCGCCCTCGCCCTCATGGGCCTGGCGGACGAGTCGACGCTCCGGGTCTGGCGCCTCATGGACATGGACGCC
CTGCCGGCCTGGCACGTCGGCCGCCTGTGCCTCCTCGGCGACGCCGCCCATCCCTTTCTGCCGCACCAGGGCCAA
GGCGCCGCCCAGGCCATCGAGGACGCCGCCGCGCTCGAGATCGTCCTGCCCTTTGGCGTCGACGAGGCCGAAGTG
CCCGCCCGCCTCGCCCTGTACCAGCGCTGTCGCCAGCAGCGCGCCGATGCCGTCCAGCGCCTGACGCGCCTCTCG
GGCGAGGACATGCAGTCGGGGCAGGCCGACGTCACGACCAAGGCCGTCGGCTTCTTCCGCCTGAACTGCGAGTAC
AATGAGCGCCACAACTCGACCGATATTCTGCGGCATTGGATGATGAGGGAGTGA
Transcript >Hirsu2|9131
ATGCAAGTCGGCGCAGCCCCGCGGCCCTTGGCCGTCTACATCGTCGGCGCGGGCATCGGCGGCCTCACGGCGGCC
GTGGCCCTGCGCCGCGCAGGGCACAACGTGACGGTGCTGGAGAGGTCGAGGCTCGCGTGCGAGGTCGGCGCCGCC
ATCAACGTGCCTCCCAACGCCATGGCCGTCCTGTGTCCGCTGGGTGTCAACCCTACCAGCCACGGAGCCGTCGTC
TTGCAAACGGTGACCGAGTACGGCAAGTCCGGGGAGCTGGTGCACGCCCACGACGTCTCCTTTCTCAGCGAGGAG
AGCACACACCCCTTTCTTCTCTGCCACCGAGTCGATTTGCACTCGCAGCTCAAGGCCGCCGCGACGTCGCCGCGC
GGCCTGGGAAAGCCGGTTGAGCTGCGCACGAGCTCGCCCGTCGCTGACGTCGACGCCGACCGGGCCCTCGTCACG
CTCCGGGACGGCACCAGCTTCCGGGGCGACCTCGTCGTCGGCGCAGATGGGATCCACTCCAAGACGCGCTGCAAA
GTCGCAGCGACCAAGCCCTTCCCCTCCGGCAAGAGCGCGCACCGCTTCATGCTCGACAGAGCCCAGGTCGACGAG
GTCCCCGGCCTCGGCGAGCTCTTCAAGCCCGGGGACCTGACCTTCTGGGCCGACGTCGACCGGCGCGTCATCGTG
TATCCGGCCCGCGACGGCCGCCTGCTCAACGTCGTCTGCATCCACCCCGACGACCCGGACAGATGGGACGGCGAC
GGCGCGGCCGGGCGCGAGACGTGGAACGAGTCCAGCACACGCGCAGGCCTGCTGAGTCTGTACGCCGGCTTCGAC
GAGCGCGCCCTCGCCCTCATGGGCCTGGCGGACGAGTCGACGCTCCGGGTCTGGCGCCTCATGGACATGGACGCC
CTGCCGGCCTGGCACGTCGGCCGCCTGTGCCTCCTCGGCGACGCCGCCCATCCCTTTCTGCCGCACCAGGGCCAA
GGCGCCGCCCAGGCCATCGAGGACGCCGCCGCGCTCGAGATCGTCCTGCCCTTTGGCGTCGACGAGGCCGAAGTG
CCCGCCCGCCTCGCCCTGTACCAGCGCTGTCGCCAGCAGCGCGCCGATGCCGTCCAGCGCCTGACGCGCCTCTCG
GGCGAGGACATGCAGTCGGGGCAGGCCGACGTCACGACCAAGGCCGTCGGCTTCTTCCGCCTGAACTGCGAGTAC
AATGAGCGCCACAACTCGACCGATATTCTGCGGCATTGGATGATGAGGGAGTGA
Gene >Hirsu2|9131
ATGCAAGTCGGCGCAGCCCCGCGGCCCTTGGCCGTCTACATCGTCGGCGCGGGCATCGGCGGCCTCACGGCGGCC
GTGGCCCTGCGCCGCGCAGGGCACAACGTGACGGCACGTCCGCCCCTCCTGCTCTGCTCCCCTCCGCGCCCTCGC
TCTTCGGTAGAAGAGGAAGAAGCAGTGGCGGCACGAAAGAGGCGCCCGAGACGGCTTGCTGACCAACAGGTTGCG
CAGGTGCTGGAGAGGTCGAGGCTCGCGTGCGAGGTCGGCGCCGCCATCAACGTGCCTCCCAACGCCATGGCCGTC
CTGTGTCCGCTGGGTGTCAACCCTACCAGCCACGGAGCCGTCGTCTTGCAAACGGTTCGCCCCTCCCCTGTCCCG
TGGCGTCTGCTGCCGCCCTCGCTCACCCGCTCTCTTCTCTGCTCGTGAGGGATAGGTGACCGAGTACGGCAAGTC
CGGGGAGCTGGTGCACGCCCACGACGTCTCCTTTCTCAGCGAGGAGAGCACACACGTGAGTCGACAGCGTGAGGC
GGCCGTCGGGTCGGATGAGCGGCGCCGGGCGAGTGCTGACCGTGGCCCGGTTTGGTCGCGCCCAAAGCCCTTTCT
TCTCTGCCACCGAGTCGATTTGCACTCGCAGCTCAAGGCCGCCGCGACGTCGCCGCGCGGCCTGGGAAAGCCGGT
TGAGCTGCGCACGAGCTCGCCCGTCGCTGACGTCGACGCCGACCGGGCCCTCGTCACGCTCCGGGACGGCACCAG
CTTCCGGGGCGACCTCGTCGTCGGCGCAGATGGGATCCACGTGAGTAGAGGCCGCCCTTTCGTCTCCAGCCCTTC
CCTGCCCGGAGTCACCGTTGAGAAACGGAGGCGCGCGTATGCGGGCAAGACGAGAGAGAGGGCACCGGTTGACAG
AAAGAGCTCGCATGTCTCGGCCAGTCCAAGACGCGCTGCAAAGTCGCAGCGACCAAGCCCTTCCCCTCCGGCAAG
AGCGCGCACCGCTTCATGCTCGACAGAGCCCAGGTCGACGAGGTCCCCGGCCTCGGCGAGCTCTTCAAGCCCGGG
GACCTGACCTTCTGGGCCGACGTCGACCGGTAAGGCGCCTCTCCCTCCCTCCCTCTAGCTTCGGGCGTGGCCTCG
CGCCGGCCTTCTTCTTCCCCCCATCGGCGGACAAGCCAAAGGCCTCGGTCTGGGCTCTGACGAACGACACGCATC
AGGCGCGTCATCGTGTATCCGGCCCGCGACGGCCGCCTGCTCAACGTCGTCTGCATCCACCCCGACGACCCGGAC
AGATGGGACGGCGACGGCGCGGCCGGGCGCGAGACGTGGAACGAGTCCAGCACACGCGCAGGCCTGCTGAGTCTG
TACGCCGGCTTCGACGAGCGCGCCCTCGCCCTCATGGGCCTGGCGGACGAGTCGACGCTCCGGGTCTGGCGCCTC
ATGGACATGGACGCCCTGCCGGCCTGGCACGTCGGCCGCCTGTGCCTCCTCGGCGACGCCGCCCATCCCTTTCTG
CCGCACCAGGGCCAAGGCGCCGCCCAGGCCATCGAGGACGCCGCCGCGCTCGAGATCGTCCTGCCCTTTGGCGTC
GACGAGGCCGAAGTGCCCGCCCGCCTCGCCCTGTACCAGCGCTGTCGCCAGCAGCGCGCCGATGCCGTCCAGCGC
CTGACGCGCCTCTCGGGCGAGGACATGCAGTCGGGGCAGGCCGACGTCACGACCAAGGCCGTCGGCTTCTTCCGC
CTGAACTGCGAGTACAATGAGCGCCACAACTCGACCGATATTCTGCGGCATTGGATGATGAGGGAGTGA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail