Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|9131
Gene name
LocationContig_642:1919..3713
Strand+
Gene length (bp)1794
Transcript length (bp)1254
Coding sequence length (bp)1254
Protein length (aa) 418

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01494 FAD_binding_3 FAD binding domain 4.1E-20 11 370
PF13450 NAD_binding_8 NAD(P)-binding Rossmann-like domain 1.9E-07 14 41
PF00890 FAD_binding_2 FAD binding domain 1.6E-04 13 40

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9F131|3HBH1_PSEAC 3-hydroxybenzoate 6-hydroxylase 1 OS=Pseudomonas alcaligenes GN=xlnD PE=1 SV=1 12 377 2.0E-34
sp|Q53552|NHG2_PSEPU Salicylate hydroxylase OS=Pseudomonas putida GN=nahG PE=4 SV=1 6 377 5.0E-31
sp|Q5EXK1|3HBH_KLEOX 3-hydroxybenzoate 6-hydroxylase OS=Klebsiella oxytoca GN=mhbM PE=1 SV=1 25 376 2.0E-28
sp|Q3S4B7|3HBH_POLNA 3-hydroxybenzoate 6-hydroxylase OS=Polaromonas naphthalenivorans (strain CJ2) GN=nagX PE=1 SV=1 30 364 1.0E-27
sp|Q88FY2|6HN3M_PSEPK 6-hydroxynicotinate 3-monooxygenase OS=Pseudomonas putida (strain KT2440) GN=nicC PE=1 SV=1 32 384 3.0E-27
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9F131|3HBH1_PSEAC 3-hydroxybenzoate 6-hydroxylase 1 OS=Pseudomonas alcaligenes GN=xlnD PE=1 SV=1 12 377 2.0E-34
sp|Q53552|NHG2_PSEPU Salicylate hydroxylase OS=Pseudomonas putida GN=nahG PE=4 SV=1 6 377 5.0E-31
sp|Q5EXK1|3HBH_KLEOX 3-hydroxybenzoate 6-hydroxylase OS=Klebsiella oxytoca GN=mhbM PE=1 SV=1 25 376 2.0E-28
sp|Q3S4B7|3HBH_POLNA 3-hydroxybenzoate 6-hydroxylase OS=Polaromonas naphthalenivorans (strain CJ2) GN=nagX PE=1 SV=1 30 364 1.0E-27
sp|Q88FY2|6HN3M_PSEPK 6-hydroxynicotinate 3-monooxygenase OS=Pseudomonas putida (strain KT2440) GN=nicC PE=1 SV=1 32 384 3.0E-27
sp|P86491|6HN3M_PSEFL 6-hydroxynicotinate 3-monooxygenase OS=Pseudomonas fluorescens PE=1 SV=1 30 372 1.0E-26
sp|P23262|NHG1_PSEPU Salicylate hydroxylase OS=Pseudomonas putida GN=nahG PE=1 SV=4 25 377 9.0E-25
sp|B6D1N4|HPXO_KLEPN FAD-dependent urate hydroxylase OS=Klebsiella pneumoniae GN=hpxO PE=3 SV=1 10 384 4.0E-22
sp|A6T923|HPXO_KLEP7 FAD-dependent urate hydroxylase OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=hpxO PE=1 SV=1 10 384 6.0E-22
sp|Q0QFQ1|3HBH2_PSEAC 3-hydroxybenzoate 6-hydroxylase 2 OS=Pseudomonas alcaligenes GN=hbzD PE=2 SV=1 101 379 6.0E-21
sp|Q40412|ABA2_NICPL Zeaxanthin epoxidase, chloroplastic OS=Nicotiana plumbaginifolia GN=ABA2 PE=1 SV=1 8 375 4.0E-19
sp|P93236|ABA2_SOLLC Zeaxanthin epoxidase, chloroplastic OS=Solanum lycopersicum PE=2 SV=1 8 375 2.0E-17
sp|Q0JCU7|ZEP_ORYSJ Zeaxanthin epoxidase, chloroplastic OS=Oryza sativa subsp. japonica GN=ZEP PE=2 SV=1 4 375 3.0E-16
sp|O81360|ABA2_PRUAR Zeaxanthin epoxidase, chloroplastic OS=Prunus armeniaca PE=2 SV=1 7 375 5.0E-16
sp|Q9I0Q0|PQSH_PSEAE 2-heptyl-3-hydroxy-4(1H)-quinolone synthase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=pqsH PE=3 SV=1 10 376 9.0E-16
sp|O06489|YETM_BACSU Putative oxidoreductase YetM OS=Bacillus subtilis (strain 168) GN=yetM PE=3 SV=1 26 377 6.0E-15
sp|Q02N79|PQSH_PSEAB 2-heptyl-3-hydroxy-4(1H)-quinolone synthase OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=pqsH PE=1 SV=1 10 376 7.0E-15
sp|B5B0J6|HPXO_KLEOX FAD-dependent urate hydroxylase OS=Klebsiella oxytoca GN=hpxO PE=3 SV=1 22 384 7.0E-14
sp|Q96375|ABA2_CAPAN Zeaxanthin epoxidase, chloroplastic OS=Capsicum annuum PE=2 SV=1 8 375 6.0E-13
sp|Q8NLB6|3HBH_CORGL 3-hydroxybenzoate 6-hydroxylase OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=Cgl3026 PE=1 SV=1 34 334 9.0E-11
sp|A8LVF4|KMO_SALAI Kynurenine 3-monooxygenase OS=Salinispora arenicola (strain CNS-205) GN=kmo PE=3 SV=1 16 341 4.0E-06
sp|Q84HF5|KMO_PSEFL Kynurenine 3-monooxygenase OS=Pseudomonas fluorescens GN=kmo PE=1 SV=1 142 337 4.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0071949 FAD binding Yes
GO:0036094 small molecule binding No
GO:1901265 nucleoside phosphate binding No
GO:0043168 anion binding No
GO:0000166 nucleotide binding No
GO:0050660 flavin adenine dinucleotide binding No
GO:0097159 organic cyclic compound binding No
GO:1901363 heterocyclic compound binding No
GO:0005488 binding No
GO:0043167 ion binding No
GO:0003674 molecular_function No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm 0.6627 0.386 0.4025 0.0377 0.2434 0.1047 0.0976 0.0817 0.1415 0.0125

SignalP

(None)

Transmembrane Domains

Domain # Start End Length
1 9 28 19

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup479
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1118
Ophiocordyceps australis 1348a (Ghana) OphauG2|3185
Ophiocordyceps australis map64 (Brazil) OphauB2|1595
Ophiocordyceps australis map64 (Brazil) OphauB2|1649
Ophiocordyceps australis map64 (Brazil) OphauB2|8025
Ophiocordyceps subramaniannii Hirsu2|10599
Ophiocordyceps subramaniannii Hirsu2|5957
Ophiocordyceps subramaniannii Hirsu2|9131 (this protein)

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|9131
MQVGAAPRPLAVYIVGAGIGGLTAAVALRRAGHNVTVLERSRLACEVGAAINVPPNAMAVLCPLGVNPTSHGAVV
LQTVTEYGKSGELVHAHDVSFLSEESTHPFLLCHRVDLHSQLKAAATSPRGLGKPVELRTSSPVADVDADRALVT
LRDGTSFRGDLVVGADGIHSKTRCKVAATKPFPSGKSAHRFMLDRAQVDEVPGLGELFKPGDLTFWADVDRRVIV
YPARDGRLLNVVCIHPDDPDRWDGDGAAGRETWNESSTRAGLLSLYAGFDERALALMGLADESTLRVWRLMDMDA
LPAWHVGRLCLLGDAAHPFLPHQGQGAAQAIEDAAALEIVLPFGVDEAEVPARLALYQRCRQQRADAVQRLTRLS
GEDMQSGQADVTTKAVGFFRLNCEYNERHNSTDILRHWMMRE*
Coding >Hirsu2|9131
ATGCAAGTCGGCGCAGCCCCGCGGCCCTTGGCCGTCTACATCGTCGGCGCGGGCATCGGCGGCCTCACGGCGGCC
GTGGCCCTGCGCCGCGCAGGGCACAACGTGACGGTGCTGGAGAGGTCGAGGCTCGCGTGCGAGGTCGGCGCCGCC
ATCAACGTGCCTCCCAACGCCATGGCCGTCCTGTGTCCGCTGGGTGTCAACCCTACCAGCCACGGAGCCGTCGTC
TTGCAAACGGTGACCGAGTACGGCAAGTCCGGGGAGCTGGTGCACGCCCACGACGTCTCCTTTCTCAGCGAGGAG
AGCACACACCCCTTTCTTCTCTGCCACCGAGTCGATTTGCACTCGCAGCTCAAGGCCGCCGCGACGTCGCCGCGC
GGCCTGGGAAAGCCGGTTGAGCTGCGCACGAGCTCGCCCGTCGCTGACGTCGACGCCGACCGGGCCCTCGTCACG
CTCCGGGACGGCACCAGCTTCCGGGGCGACCTCGTCGTCGGCGCAGATGGGATCCACTCCAAGACGCGCTGCAAA
GTCGCAGCGACCAAGCCCTTCCCCTCCGGCAAGAGCGCGCACCGCTTCATGCTCGACAGAGCCCAGGTCGACGAG
GTCCCCGGCCTCGGCGAGCTCTTCAAGCCCGGGGACCTGACCTTCTGGGCCGACGTCGACCGGCGCGTCATCGTG
TATCCGGCCCGCGACGGCCGCCTGCTCAACGTCGTCTGCATCCACCCCGACGACCCGGACAGATGGGACGGCGAC
GGCGCGGCCGGGCGCGAGACGTGGAACGAGTCCAGCACACGCGCAGGCCTGCTGAGTCTGTACGCCGGCTTCGAC
GAGCGCGCCCTCGCCCTCATGGGCCTGGCGGACGAGTCGACGCTCCGGGTCTGGCGCCTCATGGACATGGACGCC
CTGCCGGCCTGGCACGTCGGCCGCCTGTGCCTCCTCGGCGACGCCGCCCATCCCTTTCTGCCGCACCAGGGCCAA
GGCGCCGCCCAGGCCATCGAGGACGCCGCCGCGCTCGAGATCGTCCTGCCCTTTGGCGTCGACGAGGCCGAAGTG
CCCGCCCGCCTCGCCCTGTACCAGCGCTGTCGCCAGCAGCGCGCCGATGCCGTCCAGCGCCTGACGCGCCTCTCG
GGCGAGGACATGCAGTCGGGGCAGGCCGACGTCACGACCAAGGCCGTCGGCTTCTTCCGCCTGAACTGCGAGTAC
AATGAGCGCCACAACTCGACCGATATTCTGCGGCATTGGATGATGAGGGAGTGA
Transcript >Hirsu2|9131
ATGCAAGTCGGCGCAGCCCCGCGGCCCTTGGCCGTCTACATCGTCGGCGCGGGCATCGGCGGCCTCACGGCGGCC
GTGGCCCTGCGCCGCGCAGGGCACAACGTGACGGTGCTGGAGAGGTCGAGGCTCGCGTGCGAGGTCGGCGCCGCC
ATCAACGTGCCTCCCAACGCCATGGCCGTCCTGTGTCCGCTGGGTGTCAACCCTACCAGCCACGGAGCCGTCGTC
TTGCAAACGGTGACCGAGTACGGCAAGTCCGGGGAGCTGGTGCACGCCCACGACGTCTCCTTTCTCAGCGAGGAG
AGCACACACCCCTTTCTTCTCTGCCACCGAGTCGATTTGCACTCGCAGCTCAAGGCCGCCGCGACGTCGCCGCGC
GGCCTGGGAAAGCCGGTTGAGCTGCGCACGAGCTCGCCCGTCGCTGACGTCGACGCCGACCGGGCCCTCGTCACG
CTCCGGGACGGCACCAGCTTCCGGGGCGACCTCGTCGTCGGCGCAGATGGGATCCACTCCAAGACGCGCTGCAAA
GTCGCAGCGACCAAGCCCTTCCCCTCCGGCAAGAGCGCGCACCGCTTCATGCTCGACAGAGCCCAGGTCGACGAG
GTCCCCGGCCTCGGCGAGCTCTTCAAGCCCGGGGACCTGACCTTCTGGGCCGACGTCGACCGGCGCGTCATCGTG
TATCCGGCCCGCGACGGCCGCCTGCTCAACGTCGTCTGCATCCACCCCGACGACCCGGACAGATGGGACGGCGAC
GGCGCGGCCGGGCGCGAGACGTGGAACGAGTCCAGCACACGCGCAGGCCTGCTGAGTCTGTACGCCGGCTTCGAC
GAGCGCGCCCTCGCCCTCATGGGCCTGGCGGACGAGTCGACGCTCCGGGTCTGGCGCCTCATGGACATGGACGCC
CTGCCGGCCTGGCACGTCGGCCGCCTGTGCCTCCTCGGCGACGCCGCCCATCCCTTTCTGCCGCACCAGGGCCAA
GGCGCCGCCCAGGCCATCGAGGACGCCGCCGCGCTCGAGATCGTCCTGCCCTTTGGCGTCGACGAGGCCGAAGTG
CCCGCCCGCCTCGCCCTGTACCAGCGCTGTCGCCAGCAGCGCGCCGATGCCGTCCAGCGCCTGACGCGCCTCTCG
GGCGAGGACATGCAGTCGGGGCAGGCCGACGTCACGACCAAGGCCGTCGGCTTCTTCCGCCTGAACTGCGAGTAC
AATGAGCGCCACAACTCGACCGATATTCTGCGGCATTGGATGATGAGGGAGTGA
Gene >Hirsu2|9131
ATGCAAGTCGGCGCAGCCCCGCGGCCCTTGGCCGTCTACATCGTCGGCGCGGGCATCGGCGGCCTCACGGCGGCC
GTGGCCCTGCGCCGCGCAGGGCACAACGTGACGGCACGTCCGCCCCTCCTGCTCTGCTCCCCTCCGCGCCCTCGC
TCTTCGGTAGAAGAGGAAGAAGCAGTGGCGGCACGAAAGAGGCGCCCGAGACGGCTTGCTGACCAACAGGTTGCG
CAGGTGCTGGAGAGGTCGAGGCTCGCGTGCGAGGTCGGCGCCGCCATCAACGTGCCTCCCAACGCCATGGCCGTC
CTGTGTCCGCTGGGTGTCAACCCTACCAGCCACGGAGCCGTCGTCTTGCAAACGGTTCGCCCCTCCCCTGTCCCG
TGGCGTCTGCTGCCGCCCTCGCTCACCCGCTCTCTTCTCTGCTCGTGAGGGATAGGTGACCGAGTACGGCAAGTC
CGGGGAGCTGGTGCACGCCCACGACGTCTCCTTTCTCAGCGAGGAGAGCACACACGTGAGTCGACAGCGTGAGGC
GGCCGTCGGGTCGGATGAGCGGCGCCGGGCGAGTGCTGACCGTGGCCCGGTTTGGTCGCGCCCAAAGCCCTTTCT
TCTCTGCCACCGAGTCGATTTGCACTCGCAGCTCAAGGCCGCCGCGACGTCGCCGCGCGGCCTGGGAAAGCCGGT
TGAGCTGCGCACGAGCTCGCCCGTCGCTGACGTCGACGCCGACCGGGCCCTCGTCACGCTCCGGGACGGCACCAG
CTTCCGGGGCGACCTCGTCGTCGGCGCAGATGGGATCCACGTGAGTAGAGGCCGCCCTTTCGTCTCCAGCCCTTC
CCTGCCCGGAGTCACCGTTGAGAAACGGAGGCGCGCGTATGCGGGCAAGACGAGAGAGAGGGCACCGGTTGACAG
AAAGAGCTCGCATGTCTCGGCCAGTCCAAGACGCGCTGCAAAGTCGCAGCGACCAAGCCCTTCCCCTCCGGCAAG
AGCGCGCACCGCTTCATGCTCGACAGAGCCCAGGTCGACGAGGTCCCCGGCCTCGGCGAGCTCTTCAAGCCCGGG
GACCTGACCTTCTGGGCCGACGTCGACCGGTAAGGCGCCTCTCCCTCCCTCCCTCTAGCTTCGGGCGTGGCCTCG
CGCCGGCCTTCTTCTTCCCCCCATCGGCGGACAAGCCAAAGGCCTCGGTCTGGGCTCTGACGAACGACACGCATC
AGGCGCGTCATCGTGTATCCGGCCCGCGACGGCCGCCTGCTCAACGTCGTCTGCATCCACCCCGACGACCCGGAC
AGATGGGACGGCGACGGCGCGGCCGGGCGCGAGACGTGGAACGAGTCCAGCACACGCGCAGGCCTGCTGAGTCTG
TACGCCGGCTTCGACGAGCGCGCCCTCGCCCTCATGGGCCTGGCGGACGAGTCGACGCTCCGGGTCTGGCGCCTC
ATGGACATGGACGCCCTGCCGGCCTGGCACGTCGGCCGCCTGTGCCTCCTCGGCGACGCCGCCCATCCCTTTCTG
CCGCACCAGGGCCAAGGCGCCGCCCAGGCCATCGAGGACGCCGCCGCGCTCGAGATCGTCCTGCCCTTTGGCGTC
GACGAGGCCGAAGTGCCCGCCCGCCTCGCCCTGTACCAGCGCTGTCGCCAGCAGCGCGCCGATGCCGTCCAGCGC
CTGACGCGCCTCTCGGGCGAGGACATGCAGTCGGGGCAGGCCGACGTCACGACCAAGGCCGTCGGCTTCTTCCGC
CTGAACTGCGAGTACAATGAGCGCCACAACTCGACCGATATTCTGCGGCATTGGATGATGAGGGAGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail