Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|9124
Gene name
LocationContig_640:7447..9393
Strand+
Gene length (bp)1946
Transcript length (bp)1518
Coding sequence length (bp)1518
Protein length (aa) 506

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02781 G6PD_C Glucose-6-phosphate dehydrogenase, C-terminal domain 7.1E-114 198 486
PF00479 G6PD_N Glucose-6-phosphate dehydrogenase, NAD binding domain 5.3E-60 19 196

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P41764|G6PD_EMENI Glucose-6-phosphate 1-dehydrogenase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=gsdA PE=3 SV=2 7 501 0.0E+00
sp|P48826|G6PD_ASPNG Glucose-6-phosphate 1-dehydrogenase OS=Aspergillus niger GN=gsdA PE=2 SV=1 7 505 0.0E+00
sp|O00091|G6PD_SCHPO Glucose-6-phosphate 1-dehydrogenase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=zwf1 PE=3 SV=2 6 499 0.0E+00
sp|P11410|G6PD_CYBJA Glucose-6-phosphate 1-dehydrogenase OS=Cyberlindnera jadinii PE=1 SV=2 14 497 0.0E+00
sp|P48828|G6PD_KLULA Glucose-6-phosphate 1-dehydrogenase OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=ZWF PE=3 SV=1 11 498 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P41764|G6PD_EMENI Glucose-6-phosphate 1-dehydrogenase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=gsdA PE=3 SV=2 7 501 0.0E+00
sp|P48826|G6PD_ASPNG Glucose-6-phosphate 1-dehydrogenase OS=Aspergillus niger GN=gsdA PE=2 SV=1 7 505 0.0E+00
sp|O00091|G6PD_SCHPO Glucose-6-phosphate 1-dehydrogenase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=zwf1 PE=3 SV=2 6 499 0.0E+00
sp|P11410|G6PD_CYBJA Glucose-6-phosphate 1-dehydrogenase OS=Cyberlindnera jadinii PE=1 SV=2 14 497 0.0E+00
sp|P48828|G6PD_KLULA Glucose-6-phosphate 1-dehydrogenase OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=ZWF PE=3 SV=1 11 498 0.0E+00
sp|P11412|G6PD_YEAST Glucose-6-phosphate 1-dehydrogenase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ZWF1 PE=1 SV=4 10 497 0.0E+00
sp|P37830|G6PD_SOLTU Glucose-6-phosphate 1-dehydrogenase, cytoplasmic isoform OS=Solanum tuberosum GN=G6PDH PE=2 SV=1 17 494 4.0E-173
sp|Q29492|G6PD_MACRO Glucose-6-phosphate 1-dehydrogenase OS=Macropus robustus GN=G6PD PE=2 SV=3 14 494 1.0E-172
sp|Q557D2|G6PD_DICDI Glucose-6-phosphate 1-dehydrogenase OS=Dictyostelium discoideum GN=g6pd-1 PE=3 SV=1 17 498 3.0E-172
sp|O55044|G6PD_CRIGR Glucose-6-phosphate 1-dehydrogenase OS=Cricetulus griseus GN=G6PD PE=2 SV=3 14 494 3.0E-172
sp|Q9FJI5|G6PD6_ARATH Glucose-6-phosphate 1-dehydrogenase, cytoplasmic isoform 2 OS=Arabidopsis thaliana GN=ACG12 PE=2 SV=1 17 494 1.0E-170
sp|P05370|G6PD_RAT Glucose-6-phosphate 1-dehydrogenase OS=Rattus norvegicus GN=G6pdx PE=1 SV=3 14 494 1.0E-170
sp|Q00612|G6PD1_MOUSE Glucose-6-phosphate 1-dehydrogenase X OS=Mus musculus GN=G6pdx PE=1 SV=3 14 494 1.0E-169
sp|Q42919|G6PD_MEDSA Glucose-6-phosphate 1-dehydrogenase, cytoplasmic isoform OS=Medicago sativa PE=2 SV=1 4 494 7.0E-169
sp|P11413|G6PD_HUMAN Glucose-6-phosphate 1-dehydrogenase OS=Homo sapiens GN=G6PD PE=1 SV=4 14 494 9.0E-168
sp|Q9LK23|G6PD5_ARATH Glucose-6-phosphate 1-dehydrogenase, cytoplasmic isoform 1 OS=Arabidopsis thaliana GN=ACG9 PE=2 SV=1 17 494 9.0E-168
sp|P12646|G6PD_DROME Glucose-6-phosphate 1-dehydrogenase OS=Drosophila melanogaster GN=Zw PE=1 SV=2 17 503 7.0E-166
sp|Q27638|G6PD_DROYA Glucose-6-phosphate 1-dehydrogenase (Fragment) OS=Drosophila yakuba GN=Zw PE=3 SV=1 17 503 4.0E-165
sp|P54996|G6PD_TAKRU Glucose-6-phosphate 1-dehydrogenase OS=Takifugu rubripes GN=g6pd PE=3 SV=1 5 494 6.0E-165
sp|Q27464|G6PD_CAEEL Glucose-6-phosphate 1-dehydrogenase OS=Caenorhabditis elegans GN=gspd-1 PE=3 SV=1 17 494 2.0E-164
sp|P41571|G6PD_CERCA Glucose-6-phosphate 1-dehydrogenase OS=Ceratitis capitata GN=ZW PE=2 SV=1 17 494 9.0E-163
sp|P97324|G6PD2_MOUSE Glucose-6-phosphate 1-dehydrogenase 2 OS=Mus musculus GN=G6pd2 PE=1 SV=3 14 486 2.0E-161
sp|Q43793|G6PDC_TOBAC Glucose-6-phosphate 1-dehydrogenase, chloroplastic OS=Nicotiana tabacum PE=2 SV=1 13 488 1.0E-156
sp|Q8L743|G6PD3_ARATH Glucose-6-phosphate 1-dehydrogenase 3, chloroplastic OS=Arabidopsis thaliana GN=At1g24280 PE=1 SV=2 15 488 2.0E-156
sp|Q43727|G6PD1_ARATH Glucose-6-phosphate 1-dehydrogenase 1, chloroplastic OS=Arabidopsis thaliana GN=APG1 PE=2 SV=2 17 488 3.0E-156
sp|Q9FY99|G6PD2_ARATH Glucose-6-phosphate 1-dehydrogenase 2, chloroplastic OS=Arabidopsis thaliana GN=At5g13110 PE=1 SV=2 13 490 8.0E-156
sp|O24357|G6PDC_SPIOL Glucose-6-phosphate 1-dehydrogenase, chloroplastic OS=Spinacia oleracea GN=G6PD PE=2 SV=1 17 491 3.0E-155
sp|Q43839|G6PDC_SOLTU Glucose-6-phosphate 1-dehydrogenase, chloroplastic OS=Solanum tuberosum PE=1 SV=1 16 491 4.0E-153
sp|Q7YS37|G6PD_BOSIN Glucose-6-phosphate 1-dehydrogenase OS=Bos indicus GN=G6PD PE=2 SV=3 14 494 6.0E-149
sp|Q8IKU0|GLUPH_PLAF7 Bifunctional glucose-6-phosphate 1-dehydrogenase/6-phosphogluconolactonase OS=Plasmodium falciparum (isolate 3D7) GN=PF14_0511 PE=1 SV=1 3 472 3.0E-115
sp|O59812|G6PD2_SCHPO Probable glucose-6-phosphate 1-dehydrogenase C794.01c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC794.01c PE=3 SV=1 17 478 5.0E-115
sp|Q93ZW0|G6PD4_ARATH Glucose-6-phosphate 1-dehydrogenase 4, chloroplastic OS=Arabidopsis thaliana GN=At1g09420 PE=2 SV=1 18 488 5.0E-113
sp|Q9X0N9|G6PD_THEMA Glucose-6-phosphate 1-dehydrogenase OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=zwf PE=3 SV=1 18 486 2.0E-111
sp|O14137|G6PD3_SCHPO Probable glucose-6-phosphate 1-dehydrogenase C7.13c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC3C7.13c PE=3 SV=1 16 478 1.0E-106
sp|P73411|G6PD_SYNY3 Glucose-6-phosphate 1-dehydrogenase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=zwf PE=3 SV=1 18 473 5.0E-105
sp|P48992|G6PD_NOSS1 Glucose-6-phosphate 1-dehydrogenase OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=zwf PE=3 SV=2 18 473 6.0E-100
sp|Q9Z8U6|G6PD_CHLPN Glucose-6-phosphate 1-dehydrogenase OS=Chlamydia pneumoniae GN=zwf PE=3 SV=1 18 476 4.0E-99
sp|P48848|G6PD_NOSP7 Glucose-6-phosphate 1-dehydrogenase OS=Nostoc punctiforme (strain ATCC 29133 / PCC 73102) GN=zwf PE=3 SV=1 18 455 2.0E-98
sp|P54547|G6PD_BACSU Glucose-6-phosphate 1-dehydrogenase OS=Bacillus subtilis (strain 168) GN=zwf PE=1 SV=2 16 486 1.0E-97
sp|P29686|G6PD_SYNE7 Glucose-6-phosphate 1-dehydrogenase OS=Synechococcus elongatus (strain PCC 7942) GN=zwf PE=3 SV=2 18 473 5.0E-97
sp|O83491|G6PD_TREPA Glucose-6-phosphate 1-dehydrogenase OS=Treponema pallidum (strain Nichols) GN=zwf PE=3 SV=1 18 478 2.0E-96
sp|P44311|G6PD_HAEIN Glucose-6-phosphate 1-dehydrogenase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=zwf PE=3 SV=1 14 491 4.0E-96
sp|P9WN73|G6PD2_MYCTU Glucose-6-phosphate 1-dehydrogenase 2 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=zwf2 PE=1 SV=1 18 472 8.0E-96
sp|P9WN72|G6PD2_MYCTO Glucose-6-phosphate 1-dehydrogenase 2 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=zwf2 PE=3 SV=1 18 472 8.0E-96
sp|P0A585|G6PD2_MYCBO Glucose-6-phosphate 1-dehydrogenase 2 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=zwf2 PE=3 SV=1 18 472 8.0E-96
sp|Q9Z3S2|G6PD_RHIME Glucose-6-phosphate 1-dehydrogenase OS=Rhizobium meliloti (strain 1021) GN=zwf PE=3 SV=2 19 489 1.0E-94
sp|O51581|G6PD_BORBU Glucose-6-phosphate 1-dehydrogenase OS=Borrelia burgdorferi (strain ATCC 35210 / B31 / CIP 102532 / DSM 4680) GN=zwf PE=3 SV=1 15 476 2.0E-94
sp|A0QP90|G6PD_MYCS2 Glucose-6-phosphate 1-dehydrogenase OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=zwf PE=1 SV=1 14 472 3.0E-94
sp|P37986|G6PD_DICD3 Glucose-6-phosphate 1-dehydrogenase OS=Dickeya dadantii (strain 3937) GN=zwf PE=3 SV=1 18 474 1.0E-93
sp|O54537|G6PD_STRPN Glucose-6-phosphate 1-dehydrogenase OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=zwf PE=3 SV=2 12 487 7.0E-93
sp|P77809|G6PD_AGGAC Glucose-6-phosphate 1-dehydrogenase OS=Aggregatibacter actinomycetemcomitans GN=zwf PE=3 SV=1 14 491 1.0E-92
sp|O68282|G6PD_PSEAE Glucose-6-phosphate 1-dehydrogenase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=zwf PE=1 SV=1 17 486 4.0E-91
sp|P0AC53|G6PD_ECOLI Glucose-6-phosphate 1-dehydrogenase OS=Escherichia coli (strain K12) GN=zwf PE=1 SV=1 18 474 4.0E-90
sp|P0AC54|G6PD_ECOL6 Glucose-6-phosphate 1-dehydrogenase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=zwf PE=3 SV=1 18 474 4.0E-90
sp|Q8XCJ6|G6PD_ECO57 Glucose-6-phosphate 1-dehydrogenase OS=Escherichia coli O157:H7 GN=zwf PE=3 SV=1 18 474 6.0E-90
sp|Q9PKK8|G6PD_CHLMU Glucose-6-phosphate 1-dehydrogenase OS=Chlamydia muridarum (strain MoPn / Nigg) GN=zwf PE=3 SV=1 16 483 9.0E-90
sp|Q5FUK8|G6PD_GLUOX Glucose-6-phosphate 1-dehydrogenase OS=Gluconobacter oxydans (strain 621H) GN=zwf PE=1 SV=1 19 490 2.0E-87
sp|Q8K9M2|G6PD_BUCAP Glucose-6-phosphate 1-dehydrogenase OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=zwf PE=3 SV=1 10 483 1.0E-85
sp|P11411|G6PD_LEUME Glucose-6-phosphate 1-dehydrogenase OS=Leuconostoc mesenteroides GN=zwf PE=1 SV=4 16 483 4.0E-84
sp|P21907|G6PD_ZYMMO Glucose-6-phosphate 1-dehydrogenase OS=Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4) GN=zwf PE=3 SV=1 16 473 1.0E-81
sp|O84188|G6PD_CHLTR Glucose-6-phosphate 1-dehydrogenase OS=Chlamydia trachomatis (strain D/UW-3/Cx) GN=zwf PE=3 SV=1 92 483 5.0E-80
sp|P57405|G6PD_BUCAI Glucose-6-phosphate 1-dehydrogenase OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=zwf PE=3 SV=1 18 483 9.0E-79
sp|Q89AI7|G6PD_BUCBP Glucose-6-phosphate 1-dehydrogenase OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=zwf PE=3 SV=1 18 488 2.0E-78
sp|P9WN71|G6PD1_MYCTU Glucose-6-phosphate 1-dehydrogenase 1 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=zwf1 PE=1 SV=1 18 472 1.0E-72
sp|P0A587|G6PD1_MYCBO Glucose-6-phosphate 1-dehydrogenase 1 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=zwf1 PE=3 SV=1 18 472 1.0E-72
sp|P9WN70|G6PD1_MYCTO Glucose-6-phosphate 1-dehydrogenase 1 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=zwf1 PE=3 SV=1 18 472 3.0E-72
sp|O95479|G6PE_HUMAN GDH/6PGL endoplasmic bifunctional protein OS=Homo sapiens GN=H6PD PE=1 SV=2 8 486 2.0E-64
sp|Q8CFX1|G6PE_MOUSE GDH/6PGL endoplasmic bifunctional protein OS=Mus musculus GN=H6pd PE=1 SV=2 8 476 1.0E-62
sp|P56110|G6PD_HELPY Glucose-6-phosphate 1-dehydrogenase OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=zwf PE=3 SV=1 18 457 8.0E-62
sp|P56201|G6PE_RABIT GDH/6PGL endoplasmic bifunctional protein OS=Oryctolagus cuniculus GN=H6PD PE=1 SV=2 11 482 9.0E-61
sp|Q9ZKB2|G6PD_HELPJ Glucose-6-phosphate 1-dehydrogenase OS=Helicobacter pylori (strain J99 / ATCC 700824) GN=zwf PE=3 SV=1 18 457 8.0E-60
sp|Q23711|G6PD_CULPI Glucose-6-phosphate 1-dehydrogenase (Fragment) OS=Culex pipiens GN=ZW PE=2 SV=1 36 190 1.0E-35
sp|Q25019|G6PD_HYACE Glucose-6-phosphate 1-dehydrogenase (Fragment) OS=Hyalophora cecropia GN=ZW PE=2 SV=1 36 190 3.0E-35
sp|Q24625|G6PD_DROSI Glucose-6-phosphate 1-dehydrogenase (Fragment) OS=Drosophila simulans GN=Zw PE=2 SV=1 36 190 8.0E-33
sp|Q25537|G6PD_NEOBL Glucose-6-phosphate 1-dehydrogenase (Fragment) OS=Neobellieria bullata GN=ZW PE=2 SV=1 36 190 1.0E-32
sp|Q8SR89|G6PD_ENCCU Glucose-6-phosphate 1-dehydrogenase OS=Encephalitozoon cuniculi (strain GB-M1) GN=ZWF1 PE=1 SV=1 18 451 1.0E-32
sp|P15588|G6PD_DIDVI Glucose-6-phosphate 1-dehydrogenase (Fragments) OS=Didelphis virginiana GN=G6PD PE=3 SV=1 432 494 6.0E-08
[Show less]

GO

GO Term Description Terminal node
GO:0006006 glucose metabolic process Yes
GO:0004345 glucose-6-phosphate dehydrogenase activity Yes
GO:0055114 oxidation-reduction process Yes
GO:0050661 NADP binding Yes
GO:0097159 organic cyclic compound binding No
GO:0016616 oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor No
GO:0003674 molecular_function No
GO:0036094 small molecule binding No
GO:0008150 biological_process No
GO:0008152 metabolic process No
GO:0044238 primary metabolic process No
GO:1901265 nucleoside phosphate binding No
GO:0005488 binding No
GO:0005975 carbohydrate metabolic process No
GO:0071704 organic substance metabolic process No
GO:0016614 oxidoreductase activity, acting on CH-OH group of donors No
GO:1901363 heterocyclic compound binding No
GO:0048037 cofactor binding No
GO:0016491 oxidoreductase activity No
GO:0050662 coenzyme binding No
GO:0019318 hexose metabolic process No
GO:0005996 monosaccharide metabolic process No
GO:0003824 catalytic activity No
GO:0000166 nucleotide binding No
GO:0044281 small molecule metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|9124
MDLSHAAKTMELKDNTTIVVLGASGDLAKKKTYPALFGLYRNQFLPKDVRIVGYARTKMDHDEYLRRIKSYMKTP
TKEIEQQLDEFCRLCSYISGSYDKDESFQVLNRHLQELEKGRPETHRLFYMALPPSVFTTVSQHLKKCCYPTKGI
ARVIVEKPFGKDLASSRELQKSLQPDWKEAELFRIDHYLGKEMVKNILILRFGNLFLGATWNRQHIDNVQISFKE
PFGTEGRGGYFDEFGIIRDVMQNHLLQVLTLLAMDRPISFDSEDIRDEKVRVLRAIPAIEPKNVIIGQYGKSLDG
SKPSYKEDDTVPRDSRCPTFCALVAYIKNERWDGVPFIMKAGKALNEQKTEIRIQFKDVSSGIFKDIPRNELVMR
IQPNESVYIKMNSKLPGLSMQTVVTELDLTYRRRFSDLKIPEAYESLILDCLKGDHSNFVRDDELDASWRIFTPL
LHYLDDNKEIIPMEYPYGSRGPAVLDDFTASYGYKFSDAAGYQWPTTAATPPNKF*
Coding >Hirsu2|9124
ATGGACCTCTCCCACGCAGCTAAGACGATGGAGCTCAAGGACAACACGACAATCGTCGTGCTCGGCGCCTCGGGC
GACCTGGCCAAGAAGAAGACGTACCCCGCGCTCTTTGGCCTGTATCGAAACCAGTTCCTGCCCAAGGATGTCAGA
ATCGTCGGCTATGCCCGCACCAAGATGGACCACGACGAGTACCTGCGACGCATCAAGTCGTACATGAAGACGCCG
ACCAAGGAGATCGAACAGCAGCTGGATGAGTTCTGCCGCCTCTGCTCCTACATCTCCGGCTCCTACGACAAGGAC
GAGAGCTTCCAGGTGCTCAACCGGCATCTCCAGGAGCTGGAGAAGGGCCGGCCCGAGACGCACCGACTCTTCTAC
ATGGCTCTGCCGCCCAGCGTCTTCACTACCGTCTCTCAGCATCTCAAGAAGTGCTGCTACCCGACCAAGGGTATC
GCACGTGTCATTGTCGAGAAACCATTCGGCAAAGACCTCGCCAGCTCGCGGGAGCTCCAAAAGTCCCTCCAGCCC
GACTGGAAGGAGGCGGAGCTGTTCCGAATCGACCATTATCTCGGCAAGGAAATGGTCAAGAACATCTTGATCTTG
CGTTTTGGCAACTTGTTTCTCGGCGCCACCTGGAACCGCCAGCACATCGACAACGTGCAAATCTCCTTCAAGGAG
CCCTTCGGCACCGAGGGCAGGGGCGGCTACTTCGACGAGTTTGGCATCATCCGCGACGTGATGCAGAACCATCTC
CTGCAGGTTCTCACCCTGCTCGCCATGGATCGGCCCATCTCGTTCGACTCGGAGGACATACGCGACGAAAAGGTC
CGAGTGCTCCGTGCCATCCCCGCCATCGAACCCAAGAACGTCATCATCGGCCAGTACGGAAAGTCGCTCGACGGC
AGCAAGCCTTCGTACAAGGAGGACGACACGGTCCCCAGGGACTCGAGGTGCCCGACCTTCTGCGCACTCGTCGCC
TACATCAAGAACGAGCGCTGGGACGGCGTCCCCTTCATCATGAAGGCCGGCAAGGCGCTCAACGAGCAGAAGACG
GAGATTCGGATTCAGTTCAAGGACGTCTCCTCCGGCATCTTCAAAGACATTCCGCGGAACGAACTTGTTATGCGC
ATTCAGCCCAACGAGAGTGTCTACATCAAGATGAACTCGAAGCTGCCAGGCTTGAGCATGCAGACCGTCGTCACC
GAGCTCGACCTCACCTACCGACGGCGATTCTCCGACCTCAAGATCCCGGAGGCGTACGAATCCCTCATTCTCGAC
TGCCTCAAGGGCGACCACTCCAACTTTGTGCGCGACGACGAGCTCGACGCCAGCTGGCGCATCTTCACGCCACTC
CTTCACTACCTAGACGACAATAAGGAAATCATTCCCATGGAATATCCTTATGGATCTCGCGGCCCGGCCGTCCTC
GATGACTTCACGGCCTCCTACGGGTACAAGTTCAGCGACGCCGCCGGCTACCAGTGGCCAACCACGGCTGCAACC
CCTCCAAACAAGTTCTAA
Transcript >Hirsu2|9124
ATGGACCTCTCCCACGCAGCTAAGACGATGGAGCTCAAGGACAACACGACAATCGTCGTGCTCGGCGCCTCGGGC
GACCTGGCCAAGAAGAAGACGTACCCCGCGCTCTTTGGCCTGTATCGAAACCAGTTCCTGCCCAAGGATGTCAGA
ATCGTCGGCTATGCCCGCACCAAGATGGACCACGACGAGTACCTGCGACGCATCAAGTCGTACATGAAGACGCCG
ACCAAGGAGATCGAACAGCAGCTGGATGAGTTCTGCCGCCTCTGCTCCTACATCTCCGGCTCCTACGACAAGGAC
GAGAGCTTCCAGGTGCTCAACCGGCATCTCCAGGAGCTGGAGAAGGGCCGGCCCGAGACGCACCGACTCTTCTAC
ATGGCTCTGCCGCCCAGCGTCTTCACTACCGTCTCTCAGCATCTCAAGAAGTGCTGCTACCCGACCAAGGGTATC
GCACGTGTCATTGTCGAGAAACCATTCGGCAAAGACCTCGCCAGCTCGCGGGAGCTCCAAAAGTCCCTCCAGCCC
GACTGGAAGGAGGCGGAGCTGTTCCGAATCGACCATTATCTCGGCAAGGAAATGGTCAAGAACATCTTGATCTTG
CGTTTTGGCAACTTGTTTCTCGGCGCCACCTGGAACCGCCAGCACATCGACAACGTGCAAATCTCCTTCAAGGAG
CCCTTCGGCACCGAGGGCAGGGGCGGCTACTTCGACGAGTTTGGCATCATCCGCGACGTGATGCAGAACCATCTC
CTGCAGGTTCTCACCCTGCTCGCCATGGATCGGCCCATCTCGTTCGACTCGGAGGACATACGCGACGAAAAGGTC
CGAGTGCTCCGTGCCATCCCCGCCATCGAACCCAAGAACGTCATCATCGGCCAGTACGGAAAGTCGCTCGACGGC
AGCAAGCCTTCGTACAAGGAGGACGACACGGTCCCCAGGGACTCGAGGTGCCCGACCTTCTGCGCACTCGTCGCC
TACATCAAGAACGAGCGCTGGGACGGCGTCCCCTTCATCATGAAGGCCGGCAAGGCGCTCAACGAGCAGAAGACG
GAGATTCGGATTCAGTTCAAGGACGTCTCCTCCGGCATCTTCAAAGACATTCCGCGGAACGAACTTGTTATGCGC
ATTCAGCCCAACGAGAGTGTCTACATCAAGATGAACTCGAAGCTGCCAGGCTTGAGCATGCAGACCGTCGTCACC
GAGCTCGACCTCACCTACCGACGGCGATTCTCCGACCTCAAGATCCCGGAGGCGTACGAATCCCTCATTCTCGAC
TGCCTCAAGGGCGACCACTCCAACTTTGTGCGCGACGACGAGCTCGACGCCAGCTGGCGCATCTTCACGCCACTC
CTTCACTACCTAGACGACAATAAGGAAATCATTCCCATGGAATATCCTTATGGATCTCGCGGCCCGGCCGTCCTC
GATGACTTCACGGCCTCCTACGGGTACAAGTTCAGCGACGCCGCCGGCTACCAGTGGCCAACCACGGCTGCAACC
CCTCCAAACAAGTTCTAA
Gene >Hirsu2|9124
ATGGACCTCTCCCACGCAGCGTGAGTTCCCCTCTGCTACCCCACCACGCCGACCCGAGCCCGGATTTCGGCGGCA
ACGGGCGGCCAGGCTGATGTACGCGCCAAAGTAAGACGATGGAGCTCAAGGACAACACGACAATCGTCGTGCTCG
GCGCCTCGGGCGACCTGGCCAAGAAGAAGACGGTGAGAGGCCCTGCCGGCCGGTCCGACCTTTCCAGTCCTGCGT
CCGCTAACGAAGCCGTTGTCGACCAGTACCCCGCGCTCTTTGGCCTGGTGAGCTCCCATCCAACCCATGGCCCTC
AGACGGCAACGTCAGGCAGCCTAACCACCCACCGCAGTATCGAAACCAGTTCCTGCCCAAGGATGTCAGAATCGT
CGGCTATGCCCGCACCAAGATGGACCACGACGAGTACCTGCGACGCATCAAGTCGTACATGAAGACGCCGACCAA
GGAGATCGAACAGCAGCTGGATGAGTTCTGCCGCCTCTGCTCCTACATCTCCGGCTCCTACGACAAGGACGAGAG
CTTCCAGGTGCTCAACCGGCATCTCCAGGAGCTGGAGAAGGGCCGGCCCGAGACGCACCGACTCTTCTACATGGC
TCTGCCGCCCAGCGTCTTCACTACCGTCTCTCAGCATCTCAAGAAGTGCTGCTACCCGACCAAGGGTATCGCACG
TGTCATTGTGAGCGACGACTCCCTCCTCTCCCCTTTCTTCGTCCCGCCGCATGCTGAACAGTCCTTTCCAGGTCG
AGAAACCATTCGGCAAAGACCTCGCCAGCTCGCGGGAGCTCCAAAAGTCCCTCCAGCCCGACTGGAAGGAGGCGG
AGCTGTTCCGAATCGACCATTATCTCGGCAAGGAAATGGTCAAGAACATCTTGATCTTGCGTTTTGGCAACTTGT
TTCTCGGCGCCACCTGGAACCGCCAGCACATCGACAACGTGCAAATCTCCTTCAAGGAGCCCTTCGGCACCGAGG
GCAGGGGCGGCTACTTCGACGAGTTTGGCATCATCCGCGACGTGATGCAGAACCATCTCCTGCAGGTTCTCACCC
TGCTCGCCATGGATCGGCCCATCTCGTTCGACTCGGAGGACATACGCGACGAAAAGGTCCGAGTGCTCCGTGCCA
TCCCCGCCATCGAACCCAAGAACGTCATCATCGGCCAGTACGGAAAGTCGCTCGACGGCAGCAAGCCTTCGTACA
AGGAGGACGACACGGTCCCCAGGGACTCGAGGTGCCCGACCTTCTGCGCACTCGTCGCCTACATCAAGAACGAGC
GCTGGGACGGCGTCCCCTTCATCATGAAGGCCGGCAAGGCGCTCAACGAGCAGAAGACGGAGATTCGGATTCAGT
TCAAGGACGTCTCCTCCGGCATCTTCAAAGACATTCCGCGGAACGAACTTGTTATGCGCATTCAGCCCAACGAGA
GTGTCTACATCAAGATGAACTCGAAGCTGCCAGGCTTGAGCATGCAGACCGTCGTCACCGAGCTCGACCTCACCT
ACCGACGGCGATTCTCCGACCTCAAGATCCCGGAGGCGTACGAATCCCTCATTCTCGACTGCCTCAAGGGCGACC
ACTCCAACTTTGTGCGCGACGACGAGCTCGACGCCAGCTGGCGCATCTTCACGCCACTCCTTCACTACCTAGACG
ACAATAAGGAAATCATTCCCATGGAATATCCTTATGGTGAGAGCTTGCGCCTTTTCCGAACGTTGTTACCCTCTG
CTCACCTCCGTCGGCAGGATCTCGCGGCCCGGCCGTCCTCGATGACTTCACGGCCTCCTACGGGTACAAGTTCAG
CGACGCCGCCGGCTACCAGTGGCCAACCACGGCTGCAACCCCTCCAAACAAGTTGTAAGTATGTCGCCGTCCCAG
GCGCCGATGTCTCGTGCCACTGAGACGTGAACATCCGATGGATCCACGTGACTGACAATCATCGCAGCTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail