Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|912
Gene name
LocationContig_1190:205..1131
Strand+
Gene length (bp)926
Transcript length (bp)762
Coding sequence length (bp)762
Protein length (aa) 254

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 23 0.45

Transmembrane Domains

Domain # Start End Length
1 54 76 22
2 122 144 22
3 170 192 22
4 212 234 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|912
MVSTRSSSSRAGSLGPDPPTSAGDTPSPPPSKAAVAVAKRRGPSSSSSGRRAAAWAHTPSPATLFWMAVSLPLVA
WDTAYVLGRPHTMEGGAAHWPLWAPYKLYGEVDHVYGWKAWHARNGFTGAQALLNLVETVMYLVYLGLYYRRAVV
VGPSSSLPGRPRVRAIRGRAGAVAVLVGFSAAVMTLSKTVLYWMNEYYSGFDNIGHNPFIELVYLWIIPNGAWLV
GSTYMIYSLGTDILDGLETASTTPVKQE*
Coding >Hirsu2|912
ATGGTCAGCACGCGCTCGTCGTCGTCGCGCGCCGGCAGCCTCGGCCCGGACCCGCCGACGTCGGCCGGCGACACG
CCCAGCCCGCCGCCGTCCAAGGCCGCCGTCGCCGTCGCCAAGCGCCGGGGCCCGTCGTCGTCGTCGTCCGGCCGC
CGCGCCGCCGCCTGGGCGCACACGCCGTCGCCCGCGACGCTGTTCTGGATGGCCGTCTCGCTCCCCCTCGTCGCC
TGGGACACGGCCTACGTCCTCGGCCGGCCGCACACGATGGAGGGCGGCGCGGCGCACTGGCCGCTGTGGGCGCCC
TACAAGCTGTACGGCGAGGTCGACCACGTGTACGGCTGGAAGGCCTGGCACGCCCGCAACGGCTTCACCGGTGCC
CAGGCGCTGCTGAACCTGGTCGAGACGGTCATGTATCTCGTCTACCTCGGCCTGTACTACCGCCGCGCCGTCGTC
GTCGGGCCCTCCTCGTCCCTTCCCGGCCGTCCGCGCGTCCGGGCCATCCGCGGCCGCGCCGGCGCCGTCGCCGTC
CTCGTCGGCTTCAGCGCCGCCGTCATGACTCTTAGCAAGACGGTCCTCTACTGGATGAACGAGTACTACAGCGGC
TTCGACAATATCGGCCACAACCCCTTCATCGAGCTCGTCTACCTCTGGATCATCCCCAATGGCGCATGGCTCGTG
GGCTCGACCTACATGATCTACTCCCTCGGCACCGACATCCTCGACGGCCTCGAGACGGCCTCTACTACCCCCGTC
AAGCAGGAATAG
Transcript >Hirsu2|912
ATGGTCAGCACGCGCTCGTCGTCGTCGCGCGCCGGCAGCCTCGGCCCGGACCCGCCGACGTCGGCCGGCGACACG
CCCAGCCCGCCGCCGTCCAAGGCCGCCGTCGCCGTCGCCAAGCGCCGGGGCCCGTCGTCGTCGTCGTCCGGCCGC
CGCGCCGCCGCCTGGGCGCACACGCCGTCGCCCGCGACGCTGTTCTGGATGGCCGTCTCGCTCCCCCTCGTCGCC
TGGGACACGGCCTACGTCCTCGGCCGGCCGCACACGATGGAGGGCGGCGCGGCGCACTGGCCGCTGTGGGCGCCC
TACAAGCTGTACGGCGAGGTCGACCACGTGTACGGCTGGAAGGCCTGGCACGCCCGCAACGGCTTCACCGGTGCC
CAGGCGCTGCTGAACCTGGTCGAGACGGTCATGTATCTCGTCTACCTCGGCCTGTACTACCGCCGCGCCGTCGTC
GTCGGGCCCTCCTCGTCCCTTCCCGGCCGTCCGCGCGTCCGGGCCATCCGCGGCCGCGCCGGCGCCGTCGCCGTC
CTCGTCGGCTTCAGCGCCGCCGTCATGACTCTTAGCAAGACGGTCCTCTACTGGATGAACGAGTACTACAGCGGC
TTCGACAATATCGGCCACAACCCCTTCATCGAGCTCGTCTACCTCTGGATCATCCCCAATGGCGCATGGCTCGTG
GGCTCGACCTACATGATCTACTCCCTCGGCACCGACATCCTCGACGGCCTCGAGACGGCCTCTACTACCCCCGTC
AAGCAGGAATAG
Gene >Hirsu2|912
ATGGTCAGCACGCGCTCGTCGTCGTCGCGCGCCGGCAGCCTCGGCCCGGACCCGCCGACGTCGGCCGGCGACACG
CCCAGCCCGCCGCCGTCCAAGGCCGCCGTCGCCGTCGCCAAGCGCCGGGGCCCGTCGTCGTCGTCGTCCGGCCGC
CGCGCCGCCGCCTGGGCGCACACGCCGTCGCCCGCGACGCTGTTCTGGATGGCCGTCTCGCTCCCCCTCGTCGCC
TGGGACACGGCCTACGTCCTCGGCCGGCCGCACACGATGGAGGGCGGCGCGGCGCACTGGCCGCTGTGGGCGCCC
TACAAGCTGTACGGCGAGGTCGACCACGTGTACGGCTGGAAGGCCTGGCACGCCCGCAACGGCTTCACCGGTGCC
CAGGCGCTGCTGAACCTGGTCGAGACGGTCATGTATCTCGTCTACCTCGGCCTGTACTACCGCCGCGCCGTCGTC
GTCGGGCCCTCCTCGTCCCTTCCCGGCCGTCCGCGCGTCCGGGCCATCCGCGGCCGCGCCGGCGCCGTCGCCGTC
CTCGTCGGCTTCAGCGCCGCCGTCATGACTCTTAGCAAGACGGTCCTCTACTGTCAGCCGCCTTCGCTGCCTGCT
CCCCTCTCTGTCTATCTCTGCTGCCGGTCTGACTCTGTTTCTCGGCAGGGATGAACGAGTACTACAGCGGCTTCG
ACAATATCGGCCACAACCCCTTCATCGAGCTCGTCTACCTCTGGATCATCCCCAAGTCCGTAACACTCTCCCTCC
CTGCTATTCTTGGGCCTGTCCTCTCGTCGCTCCGCCCGGCGAACAGTAGCCGGCACTAACCCGCGGTTTCTAGTG
GCGCATGGCTCGTGGGCTCGACCTACATGATCTACTCCCTCGGCACCGACATCCTCGACGGCCTCGAGACGGCCT
CTACTACCCCCGTCAAGCAGGAATAG

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail