Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|9119
Gene name
LocationContig_64:38469..40915
Strand+
Gene length (bp)2446
Transcript length (bp)2388
Coding sequence length (bp)2388
Protein length (aa) 796

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF09511 RNA_lig_T4_1 RNA ligase 1.2E-84 73 305
PF08302 tRNA_lig_CPD Fungal tRNA ligase phosphodiesterase domain 1.4E-80 556 793
PF08303 tRNA_lig_kinase tRNA ligase kinase domain 2.8E-50 396 553

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q10313|TRNL_SCHPO tRNA ligase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=trl1 PE=3 SV=2 28 775 2.0E-163
sp|P09880|TRNL_YEAST tRNA ligase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TRL1 PE=1 SV=1 48 789 4.0E-163
sp|P43075|TRNL_CANAL tRNA ligase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=LIG1 PE=3 SV=2 15 746 1.0E-139

GO

GO Term Description Terminal node
GO:0005524 ATP binding Yes
GO:0006388 tRNA splicing, via endonucleolytic cleavage and ligation Yes
GO:0003972 RNA ligase (ATP) activity Yes
GO:0005488 binding No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0044237 cellular metabolic process No
GO:0043170 macromolecule metabolic process No
GO:0032559 adenyl ribonucleotide binding No
GO:0097159 organic cyclic compound binding No
GO:0016070 RNA metabolic process No
GO:0071704 organic substance metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:1901360 organic cyclic compound metabolic process No
GO:1901265 nucleoside phosphate binding No
GO:0044238 primary metabolic process No
GO:0008152 metabolic process No
GO:0008033 tRNA processing No
GO:0016874 ligase activity No
GO:0008150 biological_process No
GO:0036094 small molecule binding No
GO:0046483 heterocycle metabolic process No
GO:0008144 drug binding No
GO:0008452 RNA ligase activity No
GO:0003674 molecular_function No
GO:0090304 nucleic acid metabolic process No
GO:0140098 catalytic activity, acting on RNA No
GO:0009987 cellular process No
GO:1901363 heterocyclic compound binding No
GO:0006396 RNA processing No
GO:0000166 nucleotide binding No
GO:0043167 ion binding No
GO:0008380 RNA splicing No
GO:0043168 anion binding No
GO:0006399 tRNA metabolic process No
GO:0097367 carbohydrate derivative binding No
GO:0003824 catalytic activity No
GO:0017076 purine nucleotide binding No
GO:0034470 ncRNA processing No
GO:0006725 cellular aromatic compound metabolic process No
GO:0016886 ligase activity, forming phosphoric ester bonds No
GO:0032555 purine ribonucleotide binding No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0032553 ribonucleotide binding No
GO:0000394 RNA splicing, via endonucleolytic cleavage and ligation No
GO:0030554 adenyl nucleotide binding No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0034660 ncRNA metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|9119
MAAAAPGGAAAGDFAELAELMRALDVASKEKRRGGFSVKKTTFQVKSSRDSLKVDSWRLKDWDYKRADLPTYARG
LFTTKTRDGPEIAVRGYDKFFNVGEVGETKWDNIIAKTQPPYELTLKENGCIIFIAGLEDETLLVCSKHSTGDRA
DVNLSHASAGERRLEQQLAALGKTKADLARELRRRGVTAVAELCDDSFEEHILAYGPEKAGLYLHGVNLNRPTFA
TYPSSAVQEFAGQWGFRKTGVIVMDDVHQVKAFLEETAETGAHDGRDVEGFVVRCKMRADADTRPGQDWFFKFKF
EEPYLMYRQWRECTKSLIAGKQAKFKKHVKITGEYLAYARKRLAADPALGKLYNQNHGIIGLRDDFLKFKNMKGS
DAANMDESEPLVMADVVGNVILCPIATIGCGKTTIALALTKLFGWGHVQNDNITGKGRPPRFTAAVFEELQKQPV
AFADRNNAWRHERGQLIDDVKAQSPTAKLVCLNFRHDEDSMDEIRRITRERVLARGDNHQTIHAATDGQKFLGVM
ESFISRFEPCNPYARPDDGFDAVIDLDPTAGSRKNVEVVITRLHKHFPNLVKQMPSPAQLDAAIEEAMVYKPSLR
HDIPSRANGQRREQKQAPKPQKRKSLEYMSVEVATETVKAALDEAFGRVDAETARFYEQLKETGRVQDRFHVTLM
HRATAGQHPELWRRYTQLYEAASGTDDRIGSCDLILERVVFDDRVMAIVVRLADDEGKWECVNRVAHITVGTRDA
SVKPKESNDLLGRWLDDGLADGEMREVLFEHKPKARGDVKGVLSR*
Coding >Hirsu2|9119
ATGGCAGCGGCAGCTCCCGGCGGTGCCGCCGCTGGGGATTTCGCGGAGCTGGCCGAACTGATGCGCGCGTTGGAC
GTGGCTAGCAAGGAGAAACGACGCGGCGGCTTCTCCGTCAAGAAGACGACCTTCCAGGTCAAGTCGTCTCGGGAC
AGCCTCAAGGTGGACTCTTGGAGACTCAAGGACTGGGACTACAAGCGGGCCGACTTGCCCACCTACGCCCGGGGC
CTCTTCACCACCAAGACGCGGGACGGCCCCGAAATCGCCGTCAGGGGCTACGACAAGTTCTTCAACGTCGGCGAA
GTCGGCGAGACCAAGTGGGACAACATCATCGCCAAGACCCAGCCGCCCTACGAGCTGACTCTCAAGGAGAACGGC
TGCATCATCTTCATCGCCGGCCTCGAGGACGAGACGCTGCTCGTCTGCAGCAAGCACTCGACCGGCGACCGGGCC
GACGTCAACCTCAGCCACGCCAGTGCGGGCGAGCGCCGCCTGGAGCAGCAGCTGGCCGCTCTCGGCAAGACCAAG
GCGGATCTCGCGCGGGAGCTCCGCCGAAGGGGCGTCACGGCCGTTGCCGAGCTCTGCGACGACTCGTTCGAGGAG
CACATCCTGGCATACGGGCCCGAAAAGGCCGGCCTGTACCTCCACGGCGTCAACCTCAACCGGCCGACCTTTGCC
ACCTACCCGAGCTCTGCCGTCCAGGAGTTTGCCGGGCAGTGGGGCTTCCGCAAGACGGGCGTCATCGTCATGGAC
GACGTCCACCAAGTCAAGGCCTTCCTCGAGGAGACGGCCGAGACCGGGGCACACGACGGGCGGGACGTCGAAGGC
TTCGTCGTGCGCTGCAAGATGAGGGCCGACGCCGACACGCGCCCCGGCCAGGACTGGTTCTTCAAGTTCAAGTTT
GAGGAGCCGTACCTGATGTATCGCCAGTGGCGAGAGTGCACCAAGTCGCTCATTGCCGGCAAGCAGGCCAAGTTC
AAGAAGCACGTGAAGATCACGGGAGAGTACCTGGCCTACGCCCGCAAACGACTGGCGGCGGACCCGGCGCTCGGC
AAGCTGTACAACCAGAACCACGGCATCATCGGCCTCCGTGACGACTTCCTTAAGTTCAAGAACATGAAGGGTTCC
GACGCCGCCAACATGGACGAGTCCGAACCGTTGGTCATGGCCGACGTCGTTGGCAACGTCATCCTGTGTCCGATC
GCAACCATCGGCTGCGGCAAGACAACGATTGCTCTCGCCCTCACGAAGCTCTTCGGTTGGGGGCACGTCCAGAAC
GACAACATCACCGGCAAGGGCCGCCCGCCTCGGTTCACTGCGGCTGTTTTCGAAGAGCTCCAGAAGCAGCCGGTC
GCGTTTGCAGACCGAAATAACGCGTGGAGGCACGAAAGAGGGCAGCTTATCGACGACGTGAAGGCGCAAAGTCCC
ACGGCAAAGCTCGTCTGTCTCAACTTTCGCCACGACGAGGATTCGATGGACGAGATCCGACGGATCACGCGAGAG
AGGGTTCTGGCTCGCGGCGACAACCACCAGACGATCCACGCCGCGACCGACGGACAGAAGTTTCTGGGCGTCATG
GAGAGCTTCATCAGCCGGTTCGAGCCCTGCAACCCCTACGCGCGGCCGGACGACGGCTTCGACGCGGTCATTGAC
CTCGACCCGACCGCGGGAAGCCGCAAAAATGTCGAAGTCGTCATCACGCGGCTGCACAAGCACTTCCCCAATCTG
GTCAAGCAAATGCCCTCACCGGCGCAACTCGATGCCGCAATCGAGGAGGCCATGGTGTACAAGCCCAGCCTCCGA
CACGACATCCCGAGCAGGGCGAACGGGCAGAGGAGGGAACAGAAGCAGGCGCCGAAACCGCAGAAGCGGAAGTCG
CTCGAGTACATGTCGGTGGAGGTGGCGACGGAAACGGTCAAGGCAGCACTGGACGAAGCCTTTGGCCGTGTCGAC
GCAGAGACAGCCCGCTTCTATGAGCAGCTGAAGGAGACGGGGAGGGTGCAGGACAGGTTTCACGTTACGCTCATG
CATCGCGCGACTGCGGGCCAGCATCCCGAGTTGTGGCGGCGATACACGCAGCTGTACGAAGCAGCCAGCGGGACA
GACGACAGGATCGGCAGCTGTGACCTGATACTCGAACGGGTTGTGTTTGACGATCGCGTCATGGCCATCGTGGTC
CGTCTCGCCGACGACGAGGGAAAGTGGGAGTGCGTGAACCGCGTCGCTCACATCACCGTCGGAACTCGGGACGCG
TCGGTCAAGCCCAAGGAAAGCAACGACCTGCTCGGCAGGTGGCTGGATGACGGGCTCGCCGACGGCGAGATGAGG
GAGGTCCTCTTCGAGCACAAGCCCAAGGCGAGGGGTGATGTCAAGGGCGTCTTATCCCGGTAG
Transcript >Hirsu2|9119
ATGGCAGCGGCAGCTCCCGGCGGTGCCGCCGCTGGGGATTTCGCGGAGCTGGCCGAACTGATGCGCGCGTTGGAC
GTGGCTAGCAAGGAGAAACGACGCGGCGGCTTCTCCGTCAAGAAGACGACCTTCCAGGTCAAGTCGTCTCGGGAC
AGCCTCAAGGTGGACTCTTGGAGACTCAAGGACTGGGACTACAAGCGGGCCGACTTGCCCACCTACGCCCGGGGC
CTCTTCACCACCAAGACGCGGGACGGCCCCGAAATCGCCGTCAGGGGCTACGACAAGTTCTTCAACGTCGGCGAA
GTCGGCGAGACCAAGTGGGACAACATCATCGCCAAGACCCAGCCGCCCTACGAGCTGACTCTCAAGGAGAACGGC
TGCATCATCTTCATCGCCGGCCTCGAGGACGAGACGCTGCTCGTCTGCAGCAAGCACTCGACCGGCGACCGGGCC
GACGTCAACCTCAGCCACGCCAGTGCGGGCGAGCGCCGCCTGGAGCAGCAGCTGGCCGCTCTCGGCAAGACCAAG
GCGGATCTCGCGCGGGAGCTCCGCCGAAGGGGCGTCACGGCCGTTGCCGAGCTCTGCGACGACTCGTTCGAGGAG
CACATCCTGGCATACGGGCCCGAAAAGGCCGGCCTGTACCTCCACGGCGTCAACCTCAACCGGCCGACCTTTGCC
ACCTACCCGAGCTCTGCCGTCCAGGAGTTTGCCGGGCAGTGGGGCTTCCGCAAGACGGGCGTCATCGTCATGGAC
GACGTCCACCAAGTCAAGGCCTTCCTCGAGGAGACGGCCGAGACCGGGGCACACGACGGGCGGGACGTCGAAGGC
TTCGTCGTGCGCTGCAAGATGAGGGCCGACGCCGACACGCGCCCCGGCCAGGACTGGTTCTTCAAGTTCAAGTTT
GAGGAGCCGTACCTGATGTATCGCCAGTGGCGAGAGTGCACCAAGTCGCTCATTGCCGGCAAGCAGGCCAAGTTC
AAGAAGCACGTGAAGATCACGGGAGAGTACCTGGCCTACGCCCGCAAACGACTGGCGGCGGACCCGGCGCTCGGC
AAGCTGTACAACCAGAACCACGGCATCATCGGCCTCCGTGACGACTTCCTTAAGTTCAAGAACATGAAGGGTTCC
GACGCCGCCAACATGGACGAGTCCGAACCGTTGGTCATGGCCGACGTCGTTGGCAACGTCATCCTGTGTCCGATC
GCAACCATCGGCTGCGGCAAGACAACGATTGCTCTCGCCCTCACGAAGCTCTTCGGTTGGGGGCACGTCCAGAAC
GACAACATCACCGGCAAGGGCCGCCCGCCTCGGTTCACTGCGGCTGTTTTCGAAGAGCTCCAGAAGCAGCCGGTC
GCGTTTGCAGACCGAAATAACGCGTGGAGGCACGAAAGAGGGCAGCTTATCGACGACGTGAAGGCGCAAAGTCCC
ACGGCAAAGCTCGTCTGTCTCAACTTTCGCCACGACGAGGATTCGATGGACGAGATCCGACGGATCACGCGAGAG
AGGGTTCTGGCTCGCGGCGACAACCACCAGACGATCCACGCCGCGACCGACGGACAGAAGTTTCTGGGCGTCATG
GAGAGCTTCATCAGCCGGTTCGAGCCCTGCAACCCCTACGCGCGGCCGGACGACGGCTTCGACGCGGTCATTGAC
CTCGACCCGACCGCGGGAAGCCGCAAAAATGTCGAAGTCGTCATCACGCGGCTGCACAAGCACTTCCCCAATCTG
GTCAAGCAAATGCCCTCACCGGCGCAACTCGATGCCGCAATCGAGGAGGCCATGGTGTACAAGCCCAGCCTCCGA
CACGACATCCCGAGCAGGGCGAACGGGCAGAGGAGGGAACAGAAGCAGGCGCCGAAACCGCAGAAGCGGAAGTCG
CTCGAGTACATGTCGGTGGAGGTGGCGACGGAAACGGTCAAGGCAGCACTGGACGAAGCCTTTGGCCGTGTCGAC
GCAGAGACAGCCCGCTTCTATGAGCAGCTGAAGGAGACGGGGAGGGTGCAGGACAGGTTTCACGTTACGCTCATG
CATCGCGCGACTGCGGGCCAGCATCCCGAGTTGTGGCGGCGATACACGCAGCTGTACGAAGCAGCCAGCGGGACA
GACGACAGGATCGGCAGCTGTGACCTGATACTCGAACGGGTTGTGTTTGACGATCGCGTCATGGCCATCGTGGTC
CGTCTCGCCGACGACGAGGGAAAGTGGGAGTGCGTGAACCGCGTCGCTCACATCACCGTCGGAACTCGGGACGCG
TCGGTCAAGCCCAAGGAAAGCAACGACCTGCTCGGCAGGTGGCTGGATGACGGGCTCGCCGACGGCGAGATGAGG
GAGGTCCTCTTCGAGCACAAGCCCAAGGCGAGGGGTGATGTCAAGGGCGTCTTATCCCGGTAG
Gene >Hirsu2|9119
ATGGCAGCGGCAGCTCCCGGCGGTGCCGCCGCTGGGGATTTCGCGGAGCTGGCCGAACTGATGCGCGCGTTGGAC
GTGGCTAGCAAGGAGAAACGACGCGGCGGCTTCTCCGTCAAGAAGACGACCTTCCAGGTCAAGTCGTCTCGGGAC
AGCCTCAAGGTGGACTCTTGGAGACTCAAGGACTGGGACTACAAGCGGGCCGACTTGCCCACCTACGCCCGGGGC
CTCTTCACCACCAAGACGCGGGACGGCCCCGAAATCGCCGTCAGGGGCTACGACAAGTTCTTCAACGTCGGCGAA
GTCGGCGAGACCAAGTGGGACAACATCATCGCCAAGACCCAGCCGCCCTACGAGCTGACTCTCAAGGAGAACGGC
TGCATCATCTTCATCGCCGGCCTCGAGGACGAGACGCTGCTCGTCTGCAGCAAGCACTCGACCGGCGACCGGGCC
GACGTCAACCTCAGCCACGCCAGTGCGGGCGAGCGCCGCCTGGAGCAGCAGCTGGCCGCTCTCGGCAAGACCAAG
GCGGATCTCGCGCGGGAGCTCCGCCGAAGGGGCGTCACGGCCGTTGCCGAGCTCTGCGACGACTCGTTCGAGGAG
CACATCCTGGCATACGGGCCCGAAAAGGCCGGCCTGTACCTCCACGGCGTCAACCTCAACCGGCCGACCTTTGCC
ACCTACCCGAGCTCTGCCGTCCAGGAGTTTGCCGGGCAGTGGGGCTTCCGCAAGACGGGCGTCATCGTCATGGAC
GACGTCCACCAAGTCAAGGCCTTCCTCGAGGAGACGGCCGAGACCGGGGCACACGACGGGCGGGACGTCGAAGGC
TTCGTCGTGCGCTGCAAGATGAGGGCCGACGCCGACACGCGCCCCGGCCAGGACTGGTTCTTCAAGTTCAAGTTT
GAGGAGCCGTACCTGATGTATCGCCAGTGGCGAGAGTGCACCAAGTCGCTCATTGCCGGCAAGCAGGCCAAGTTC
AAGAAGCACGTGAAGATCACGGGAGAGTACCTGGCCTACGCCCGCAAACGACTGGCGGCGGACCCGGCGCTCGGC
AAGCTGTACAACCAGAACCACGGCATCATCGGCCTCCGTGACGACTTCCTTAAGTTCAAGAACATGAAGGGTTCC
GACGCCGCCAACATGGACGAGTCCGAACCGTTGGTCATGGCCGACGTCGTTGGCAACGTCATCCTGTGTCCGATC
GCAACCATCGGCTGCGGCAAGACAACGATTGCTCTCGCCCTCACGAAGCTCTTCGGTTGGGGGCACGTCCAGAAC
GACAACATCACCGGCAAGGGCCGCCCGCCTCGGTTCACTGCGGCTGTTTTCGAAGAGCTCCAGAAGCAGCCGGTC
GCGTTTGCAGACCGAAATAACGCGTGGAGGCACGAAAGAGGGCAGCTTATCGACGACGTGAAGGCGCAAAGTCCC
ACGGCAAAGCTCGTCTGTCTCAACTTTCGCCACGACGAGGATTCGATGGACGAGATCCGACGGATCACGCGAGAG
AGGGTTCTGGCTCGCGGCGACAACCACCAGACGATCCACGCCGCGACCGACGGACAGAAGTTTCTGGGCGTCATG
GAGAGCTTCATCAGCCGGTTCGAGCCCTGCAACCCCTACGCGCGGCCGGACGACGGCTTCGACGCGGTCATTGAC
CTCGACCCGACCGCGGGAAGCCGCAAAAATGTCGAAGTCGTCATCACGCGGCTGCACAAGCACTTCCCCAATCTG
GTCAAGCAAATGCCCTCACCGGCGCAACTCGATGCCGCAATCGAGGAGGCCATGGTGTACAAGCCCAGCCTCCGA
CACGACATCCCGAGCAGGGCGAACGGGCAGAGGAGGGAACAGAAGCAGGCGCCGAAACCGCAGAAGCGGAAGTCG
CTCGAGTACATGTCGGTGGAGGTGGCGACGGAAACGGTCAAGGCAGCACTGGACGAAGCCTTTGGCCGTGTCGAC
GCAGAGACAGCCCGCTTCTATGAGCAGCTGAAGGAGACGGGGAGGGTGCAGGACAGGTTTCACGTTACGCTCATG
CATCGCGCGACTGCGGGCCAGCATCCCGAGTTGTGGCGGCGATACACGCAGCTGTACGAAGCAGCCAGCGGGACA
GACGACAGGATCGGCAGCTGTGACCTGATACTCGAACGGGTACGTCAAGGGCCGCGAAAGCTGTACGAGTCGCCC
CTAACCATTCGCTGTGCTCTAGGTTGTGTTTGACGATCGCGTCATGGCCATCGTGGTCCGTCTCGCCGACGACGA
GGGAAAGTGGGAGTGCGTGAACCGCGTCGCTCACATCACCGTCGGAACTCGGGACGCGTCGGTCAAGCCCAAGGA
AAGCAACGACCTGCTCGGCAGGTGGCTGGATGACGGGCTCGCCGACGGCGAGATGAGGGAGGTCCTCTTCGAGCA
CAAGCCCAAGGCGAGGGGTGATGTCAAGGGCGTCTTATCCCGGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail