Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|9110
Gene name
LocationContig_64:22356..23472
Strand+
Gene length (bp)1116
Transcript length (bp)912
Coding sequence length (bp)912
Protein length (aa) 304

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF16455 UBD Ubiquitin-binding domain 2.2E-39 61 175
PF00240 ubiquitin Ubiquitin family 6.5E-07 236 299
PF11976 Rad60-SLD Ubiquitin-2 like Rad60 SUMO-like 7.6E-06 237 297

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q6DG43|UBTD2_DANRE Ubiquitin domain-containing protein 2 OS=Danio rerio GN=ubtd2 PE=2 SV=1 62 300 3.0E-15
sp|Q4V8W7|UBTD1_DANRE Ubiquitin domain-containing protein 1 OS=Danio rerio GN=ubtd1 PE=2 SV=1 62 300 1.0E-14
sp|Q6PGH0|UBTD2_MOUSE Ubiquitin domain-containing protein 2 OS=Mus musculus GN=Ubtd2 PE=2 SV=1 62 300 2.0E-13
sp|Q8WUN7|UBTD2_HUMAN Ubiquitin domain-containing protein 2 OS=Homo sapiens GN=UBTD2 PE=1 SV=2 62 300 7.0E-13
sp|Q5EAE3|UBTD2_BOVIN Ubiquitin domain-containing protein 2 OS=Bos taurus GN=UBTD2 PE=2 SV=1 62 300 7.0E-13
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q6DG43|UBTD2_DANRE Ubiquitin domain-containing protein 2 OS=Danio rerio GN=ubtd2 PE=2 SV=1 62 300 3.0E-15
sp|Q4V8W7|UBTD1_DANRE Ubiquitin domain-containing protein 1 OS=Danio rerio GN=ubtd1 PE=2 SV=1 62 300 1.0E-14
sp|Q6PGH0|UBTD2_MOUSE Ubiquitin domain-containing protein 2 OS=Mus musculus GN=Ubtd2 PE=2 SV=1 62 300 2.0E-13
sp|Q8WUN7|UBTD2_HUMAN Ubiquitin domain-containing protein 2 OS=Homo sapiens GN=UBTD2 PE=1 SV=2 62 300 7.0E-13
sp|Q5EAE3|UBTD2_BOVIN Ubiquitin domain-containing protein 2 OS=Bos taurus GN=UBTD2 PE=2 SV=1 62 300 7.0E-13
sp|Q640W6|UBTD1_XENLA Ubiquitin domain-containing protein 1 OS=Xenopus laevis GN=ubtd1 PE=2 SV=1 62 300 8.0E-13
sp|Q3ZBQ1|UBTD1_BOVIN Ubiquitin domain-containing protein 1 OS=Bos taurus GN=UBTD1 PE=2 SV=1 62 300 5.0E-11
sp|Q9HAC8|UBTD1_HUMAN Ubiquitin domain-containing protein 1 OS=Homo sapiens GN=UBTD1 PE=1 SV=1 62 300 6.0E-11
sp|Q68FV8|UBTD1_RAT Ubiquitin domain-containing protein 1 OS=Rattus norvegicus GN=Ubtd1 PE=2 SV=1 62 300 9.0E-11
sp|Q6GL38|UBTD1_XENTR Ubiquitin domain-containing protein 1 OS=Xenopus tropicalis GN=ubtd1 PE=2 SV=1 62 274 1.0E-10
sp|Q91WB7|UBTD1_MOUSE Ubiquitin domain-containing protein 1 OS=Mus musculus GN=Ubtd1 PE=2 SV=1 62 300 2.0E-10
sp|Q9HDW4|YFW7_SCHPO Uncharacterized protein PB2B4.07 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAPB2B4.07 PE=1 SV=1 78 299 4.0E-08
[Show less]

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0003674 molecular_function No
GO:0005488 binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 53 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|9110
MGCCFSSSAGPNSPYPGGGPNASARHINPPSLNPPEGGPAPAAQPSTRRRRRDAGPLDQHINKPLRRHEWASKDR
QWSRRDLDAERADFFDTRVTGRPEIWQTIRAALQVLGQPAIPDDSNDEDLDGLATAQSILSAAEISLPTGDLANG
AYDSLGNYYQLPPWVVADPTNLAQDAPLRHARTHSAAADASADDDDDEDDDDDDLARRSSQRRREEKGKAVLDLR
DQVVLRARLSETGRDIELAVAKSDTVRSVARHIALESSLPSSKKIKLAYMGKMLKENSSLESQGWQSGHVVNAFV
FPR*
Coding >Hirsu2|9110
ATGGGCTGCTGCTTCTCCTCCTCGGCCGGCCCCAACTCGCCGTACCCGGGCGGCGGCCCCAACGCCTCCGCCCGC
CACATCAACCCGCCTTCTCTGAACCCGCCCGAGGGCGGCCCGGCTCCGGCCGCCCAGCCGTCGACCCGCCGCCGC
CGCCGCGATGCCGGCCCTCTGGACCAGCACATCAACAAGCCGCTGCGTCGCCACGAGTGGGCCTCCAAGGATCGC
CAGTGGTCCCGTCGCGACCTCGACGCGGAGCGCGCCGACTTCTTCGACACCAGGGTCACCGGCCGCCCCGAGATA
TGGCAGACCATCCGCGCCGCCCTCCAGGTCCTTGGCCAGCCCGCCATCCCGGACGACTCCAATGACGAGGACCTC
GACGGCCTCGCCACCGCCCAGTCCATCCTCTCCGCCGCAGAGATCTCTCTCCCCACCGGCGACCTGGCCAACGGC
GCCTACGACTCGCTCGGCAACTACTATCAGCTTCCCCCGTGGGTCGTCGCCGACCCCACCAACCTGGCCCAGGAC
GCGCCTCTGCGCCATGCGAGGACCCATTCCGCCGCGGCCGACGCTTCTGCCGATGATGACGACGATGAAGACGAC
GACGACGACGACCTGGCCCGTCGCAGCTCGCAAAGAAGGAGGGAGGAGAAGGGCAAGGCCGTTCTTGACCTGCGC
GACCAGGTTGTCCTCCGCGCCCGACTGAGCGAGACTGGCCGCGACATCGAGCTTGCCGTGGCCAAGTCGGACACG
GTGCGGAGCGTCGCCCGCCACATTGCATTGGAGTCATCACTTCCGTCCAGCAAAAAGATCAAACTTGCCTACATG
GGCAAGATGCTCAAGGAGAACTCGTCTCTCGAATCCCAGGGCTGGCAGAGCGGCCACGTCGTCAACGCCTTCGTC
TTCCCGCGATAA
Transcript >Hirsu2|9110
ATGGGCTGCTGCTTCTCCTCCTCGGCCGGCCCCAACTCGCCGTACCCGGGCGGCGGCCCCAACGCCTCCGCCCGC
CACATCAACCCGCCTTCTCTGAACCCGCCCGAGGGCGGCCCGGCTCCGGCCGCCCAGCCGTCGACCCGCCGCCGC
CGCCGCGATGCCGGCCCTCTGGACCAGCACATCAACAAGCCGCTGCGTCGCCACGAGTGGGCCTCCAAGGATCGC
CAGTGGTCCCGTCGCGACCTCGACGCGGAGCGCGCCGACTTCTTCGACACCAGGGTCACCGGCCGCCCCGAGATA
TGGCAGACCATCCGCGCCGCCCTCCAGGTCCTTGGCCAGCCCGCCATCCCGGACGACTCCAATGACGAGGACCTC
GACGGCCTCGCCACCGCCCAGTCCATCCTCTCCGCCGCAGAGATCTCTCTCCCCACCGGCGACCTGGCCAACGGC
GCCTACGACTCGCTCGGCAACTACTATCAGCTTCCCCCGTGGGTCGTCGCCGACCCCACCAACCTGGCCCAGGAC
GCGCCTCTGCGCCATGCGAGGACCCATTCCGCCGCGGCCGACGCTTCTGCCGATGATGACGACGATGAAGACGAC
GACGACGACGACCTGGCCCGTCGCAGCTCGCAAAGAAGGAGGGAGGAGAAGGGCAAGGCCGTTCTTGACCTGCGC
GACCAGGTTGTCCTCCGCGCCCGACTGAGCGAGACTGGCCGCGACATCGAGCTTGCCGTGGCCAAGTCGGACACG
GTGCGGAGCGTCGCCCGCCACATTGCATTGGAGTCATCACTTCCGTCCAGCAAAAAGATCAAACTTGCCTACATG
GGCAAGATGCTCAAGGAGAACTCGTCTCTCGAATCCCAGGGCTGGCAGAGCGGCCACGTCGTCAACGCCTTCGTC
TTCCCGCGATAA
Gene >Hirsu2|9110
ATGGTATGTCAGGCCTCGATCGATGGAGCGATGCCGCGGGCCCTCCGGCTGACCTCGTCCCCCGCTCAATACCCC
TCCAGGGCTGCTGCTTCTCCTCCTCGGCCGGCCCCAACTCGCCGTACCCGGGCGGCGGCCCCAACGCCTCCGCCC
GCCACATCAACCCGCCTTCTCTGAACCCGCCCGAGGGCGGCCCGGCTCCGGCCGCCCAGCCGTCGACCCGCCGCC
GCCGCCGCGATGCCGGCCCTCTGGACCAGCACATCAACAAGCCGCTGCGTCGCCACGAGTGGGCCTCCAAGGATC
GCCAGTGGTCCCGTCGCGACCTCGACGCGGAGCGCGCCGACTTCTTCGACACCAGGGTCACCGGCCGCCCCGAGA
TATGGCAGACCATCCGCGCCGCCCTCCAGGTCCTTGGCCAGCCCGCCATCCCGGACGACTCCAATGACGAGGACC
TCGACGGCCTCGCCACCGCCCAGTCCATCCTCTCCGCCGCAGAGATCTCTCTCCCCACCGGCGACCTGGCCAACG
GCGCCTACGACTCGCTCGGCAACTACTATCAGCTTCCCCCGTGGGTCGTCGCCGACCCCACCAACCTGGCCCAGG
ACGCGCCTCTGCGCCATGCGAGGACCCATTCCGCCGCGGCCGACGCTTCTGCCGATGATGACGACGATGAAGACG
ACGACGACGACGACCTGGCCCGTCGCAGCTCGCAAAGAAGGAGGGAGGAGAAGGGCAAGGCCGTTCTTGACCTGC
GCGACCAGGTTGTCCTCCGCGCCCGACTGAGCGAGACTGGCCGCGACATCGAGCTTGCCGTGGCCAAGTCGGACA
CGGTGCGGAGCGTCGCCCGCCACATTGCATTGGAGTCATCAGTTCGTCTACCTACCCTTCTACCCCCAGGCCCAG
CCCTGCGGCCACGCACCCGACCGCCTGACGTGTGGGTTCTTGCTGACGATGATCCCCCTCCCCCCCTTTTTCCCT
CTTGGCCCAATTCGCCAGCTTCCGTCCAGCAAAAAGATCAAACTTGCCTACATGGGCAAGATGCTCAAGGAGAAC
TCGTCTCTCGAATCCCAGGGCTGGCAGAGCGGCCACGTCGTCAACGCCTTCGTCTTCCCGCGATAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail