Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|911
Gene name
LocationContig_119:35876..36167
Strand-
Gene length (bp)291
Transcript length (bp)207
Coding sequence length (bp)207
Protein length (aa) 69

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm 0.6495 0.5259 0.2157 0.1098 0.2274 0.0316 0.1107 0.0442 0.0996 0.1604

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup4400
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|459
Ophiocordyceps australis map64 (Brazil) OphauB2|4822
Ophiocordyceps camponoti-floridani Ophcf2|03002
Ophiocordyceps camponoti-rufipedis Ophun1|1246
Ophiocordyceps kimflemingae Ophio5|4339
Ophiocordyceps subramaniannii Hirsu2|911 (this protein)

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|911
LDDDFDYAAVDDSPDLDFLAERDAEEAYFDDEEPSEEAPPDAGAGSPLPAEERSEIAIQCARRINLRL*
Coding >Hirsu2|911
CTGGACGACGACTTCGACTACGCCGCCGTCGACGACAGCCCCGACCTCGACTTCCTTGCAGAGAGGGACGCCGAG
GAGGCCTACTTCGACGACGAGGAGCCCAGCGAGGAGGCCCCTCCGGACGCAGGCGCCGGCAGTCCGCTCCCGGCG
GAGGAGCGCTCCGAAATAGCAATCCAATGCGCACGACGCATAAACCTACGCCTCTGA
Transcript >Hirsu2|911
CTGGACGACGACTTCGACTACGCCGCCGTCGACGACAGCCCCGACCTCGACTTCCTTGCAGAGAGGGACGCCGAG
GAGGCCTACTTCGACGACGAGGAGCCCAGCGAGGAGGCCCCTCCGGACGCAGGCGCCGGCAGTCCGCTCCCGGCG
GAGGAGCGCTCCGAAATAGCAATCCAATGCGCACGACGCATAAACCTACGCCTCTGA
Gene >Hirsu2|911
CTGGACGACGACTTCGACTACGCCGCCGTCGACGACAGCCCCGACCTCGACTTCCTTGCAGAGAGGGACGCCGAG
GAGGCCTACTTCGACGACGAGGAGCCCAGCGAGGAGGCCCCTCCGGACGCAGGCGCCGGCAGTCCGCTCCCGGCG
GAGGAGCGCTCCGAAATAGCAATCCAGTACGACCTCTGAAGCATCGAATCCTCGCCTTCGCCCCTCCCCCCTCCC
CCCCAAATCATCATCACCAGCTACCCGCGCGATAGATGCGCACGACGCATAAACCTACGCCTCTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail