Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|9109
Gene name
LocationContig_64:20564..21732
Strand-
Gene length (bp)1168
Transcript length (bp)1059
Coding sequence length (bp)1059
Protein length (aa) 353

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00856 SET SET domain 2.5E-17 196 319
PF05033 Pre-SET Pre-SET motif 2.5E-17 37 177

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q8X225|DIM5_NEUCR Histone-lysine N-methyltransferase, H3 lysine-9 specific dim-5 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=dim-5 PE=1 SV=2 1 352 2.0E-146
sp|O60016|CLR4_SCHPO Histone-lysine N-methyltransferase, H3 lysine-9 specific OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=clr4 PE=1 SV=2 40 352 1.0E-51
sp|Q5RB81|SUV91_PONAB Histone-lysine N-methyltransferase SUV39H1 OS=Pongo abelii GN=SUV39H1 PE=2 SV=1 40 352 8.0E-43
sp|O43463|SUV91_HUMAN Histone-lysine N-methyltransferase SUV39H1 OS=Homo sapiens GN=SUV39H1 PE=1 SV=1 40 352 8.0E-43
sp|Q2NL30|SUV91_BOVIN Histone-lysine N-methyltransferase SUV39H1 OS=Bos taurus GN=SUV39H1 PE=2 SV=1 40 352 8.0E-43
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q8X225|DIM5_NEUCR Histone-lysine N-methyltransferase, H3 lysine-9 specific dim-5 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=dim-5 PE=1 SV=2 1 352 2.0E-146
sp|O60016|CLR4_SCHPO Histone-lysine N-methyltransferase, H3 lysine-9 specific OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=clr4 PE=1 SV=2 40 352 1.0E-51
sp|Q5RB81|SUV91_PONAB Histone-lysine N-methyltransferase SUV39H1 OS=Pongo abelii GN=SUV39H1 PE=2 SV=1 40 352 8.0E-43
sp|O43463|SUV91_HUMAN Histone-lysine N-methyltransferase SUV39H1 OS=Homo sapiens GN=SUV39H1 PE=1 SV=1 40 352 8.0E-43
sp|Q2NL30|SUV91_BOVIN Histone-lysine N-methyltransferase SUV39H1 OS=Bos taurus GN=SUV39H1 PE=2 SV=1 40 352 8.0E-43
sp|O54864|SUV91_MOUSE Histone-lysine N-methyltransferase SUV39H1 OS=Mus musculus GN=Suv39h1 PE=1 SV=1 40 352 2.0E-42
sp|Q6NRE8|SUV91_XENLA Histone-lysine N-methyltransferase SUV39H1 OS=Xenopus laevis GN=suv39h1 PE=2 SV=1 25 352 2.0E-41
sp|Q5F3W5|SUV92_CHICK Histone-lysine N-methyltransferase SUV39H2 OS=Gallus gallus GN=SUV39H2 PE=2 SV=1 1 351 1.0E-39
sp|Q294B9|SUV39_DROPS Histone-lysine N-methyltransferase Su(var)3-9 OS=Drosophila pseudoobscura pseudoobscura GN=Su(var)3-9 PE=3 SV=1 37 352 2.0E-37
sp|Q28CQ7|SUV92_XENTR Histone-lysine N-methyltransferase SUV39H2 OS=Xenopus tropicalis GN=suv39h2 PE=2 SV=2 28 351 3.0E-37
sp|Q9H5I1|SUV92_HUMAN Histone-lysine N-methyltransferase SUV39H2 OS=Homo sapiens GN=SUV39H2 PE=1 SV=2 40 351 5.0E-37
sp|Q4R3E0|SUV92_MACFA Histone-lysine N-methyltransferase SUV39H2 OS=Macaca fascicularis GN=SUV39H2 PE=2 SV=2 40 351 6.0E-37
sp|Q6DGD3|SV91A_DANRE Histone-lysine N-methyltransferase SUV39H1-A OS=Danio rerio GN=suv39h1a PE=2 SV=2 40 352 2.0E-36
sp|Q32PH7|SUV92_BOVIN Histone-lysine N-methyltransferase SUV39H2 OS=Bos taurus GN=SUV39H2 PE=2 SV=1 1 351 3.0E-36
sp|Q9EQQ0|SUV92_MOUSE Histone-lysine N-methyltransferase SUV39H2 OS=Mus musculus GN=Suv39h2 PE=1 SV=1 1 351 3.0E-35
sp|Q5DW34|EHMT1_MOUSE Histone-lysine N-methyltransferase EHMT1 OS=Mus musculus GN=Ehmt1 PE=1 SV=2 39 348 3.0E-32
sp|Q96KQ7|EHMT2_HUMAN Histone-lysine N-methyltransferase EHMT2 OS=Homo sapiens GN=EHMT2 PE=1 SV=3 35 348 1.0E-30
sp|Q9Z148|EHMT2_MOUSE Histone-lysine N-methyltransferase EHMT2 OS=Mus musculus GN=Ehmt2 PE=1 SV=2 35 348 3.0E-30
sp|Q9H9B1|EHMT1_HUMAN Histone-lysine N-methyltransferase EHMT1 OS=Homo sapiens GN=EHMT1 PE=1 SV=4 39 348 3.0E-30
sp|Q5I0M0|SETMR_RAT Histone-lysine N-methyltransferase SETMAR OS=Rattus norvegicus GN=Setmar PE=2 SV=1 160 351 3.0E-29
sp|Q80UJ9|SETMR_MOUSE Histone-lysine N-methyltransferase SETMAR OS=Mus musculus GN=Setmar PE=2 SV=2 160 351 9.0E-29
sp|Q0VD24|SETMR_BOVIN Histone-lysine N-methyltransferase SETMAR OS=Bos taurus GN=SETMAR PE=2 SV=1 160 351 9.0E-28
sp|P45975|SUV39_DROME Histone-lysine N-methyltransferase Su(var)3-9 OS=Drosophila melanogaster GN=Su(var)3-9 PE=1 SV=2 37 352 3.0E-26
sp|Q53H47|SETMR_HUMAN Histone-lysine N-methyltransferase SETMAR OS=Homo sapiens GN=SETMAR PE=1 SV=2 55 351 6.0E-26
sp|O82175|SUVH5_ARATH Histone-lysine N-methyltransferase, H3 lysine-9 specific SUVH5 OS=Arabidopsis thaliana GN=SUVH5 PE=1 SV=1 133 352 9.0E-25
sp|Q93YF5|SUVH1_TOBAC Histone-lysine N-methyltransferase, H3 lysine-9 specific SUVH1 OS=Nicotiana tabacum GN=SUVH1 PE=1 SV=1 154 352 7.0E-24
sp|O64827|SUVR5_ARATH Histone-lysine N-methyltransferase SUVR5 OS=Arabidopsis thaliana GN=SUVR5 PE=1 SV=3 160 351 8.0E-24
sp|Q8VZ17|SUVH6_ARATH Histone-lysine N-methyltransferase, H3 lysine-9 specific SUVH6 OS=Arabidopsis thaliana GN=SUVH6 PE=2 SV=2 157 352 1.0E-23
sp|Q95Y12|SET23_CAEEL Probable histone-lysine N-methyltransferase set-23 OS=Caenorhabditis elegans GN=set-23 PE=3 SV=1 153 351 2.0E-23
sp|A8XI75|SET23_CAEBR Probable histone-lysine N-methyltransferase set-23 OS=Caenorhabditis briggsae GN=set-23 PE=3 SV=1 161 351 4.0E-23
sp|Q9SRV2|SUVR3_ARATH Histone-lysine N-methyltransferase SUVR3 OS=Arabidopsis thaliana GN=SUVR3 PE=2 SV=4 163 347 1.0E-22
sp|Q9C5P4|SUVH3_ARATH Histone-lysine N-methyltransferase, H3 lysine-9 specific SUVH3 OS=Arabidopsis thaliana GN=SUVH3 PE=2 SV=2 154 348 1.0E-22
sp|Q946J2|SUVR1_ARATH Probable inactive histone-lysine N-methyltransferase SUVR1 OS=Arabidopsis thaliana GN=SUVR1 PE=1 SV=2 153 348 2.0E-22
sp|Q9FF80|SUVH1_ARATH Histone-lysine N-methyltransferase, H3 lysine-9 specific SUVH1 OS=Arabidopsis thaliana GN=SUVH1 PE=2 SV=1 154 348 1.0E-21
sp|Q8W595|SUVR4_ARATH Histone-lysine N-methyltransferase SUVR4 OS=Arabidopsis thaliana GN=SUVR4 PE=1 SV=2 161 348 2.0E-20
sp|O88491|NSD1_MOUSE Histone-lysine N-methyltransferase, H3 lysine-36 and H4 lysine-20 specific OS=Mus musculus GN=Nsd1 PE=1 SV=1 157 351 1.0E-19
sp|Q8GZB6|SUVH4_ARATH Histone-lysine N-methyltransferase, H3 lysine-9 specific SUVH4 OS=Arabidopsis thaliana GN=SUVH4 PE=1 SV=2 153 352 1.0E-19
sp|Q9NR48|ASH1L_HUMAN Histone-lysine N-methyltransferase ASH1L OS=Homo sapiens GN=ASH1L PE=1 SV=2 157 348 3.0E-19
sp|Q99MY8|ASH1L_MOUSE Histone-lysine N-methyltransferase ASH1L OS=Mus musculus GN=Ash1l PE=1 SV=3 157 348 4.0E-19
sp|Q96L73|NSD1_HUMAN Histone-lysine N-methyltransferase, H3 lysine-36 and H4 lysine-20 specific OS=Homo sapiens GN=NSD1 PE=1 SV=1 157 351 7.0E-19
sp|Q9FNC7|SUVR2_ARATH Probable inactive histone-lysine N-methyltransferase SUVR2 OS=Arabidopsis thaliana GN=SUVR2 PE=1 SV=2 153 348 1.0E-18
sp|Q949T8|ASHR3_ARATH Histone-lysine N-methyltransferase ASHR3 OS=Arabidopsis thaliana GN=ASHR3 PE=1 SV=1 164 351 4.0E-18
sp|Q9VYD1|C1716_DROME Probable histone-lysine N-methyltransferase CG1716 OS=Drosophila melanogaster GN=Set2 PE=1 SV=2 157 351 2.0E-17
sp|Q84WW6|ASHH1_ARATH Histone-lysine N-methyltransferase ASHH1 OS=Arabidopsis thaliana GN=ASHH1 PE=1 SV=1 163 351 5.0E-17
sp|Q9VW15|ASH1_DROME Histone-lysine N-methyltransferase ash1 OS=Drosophila melanogaster GN=ash1 PE=1 SV=3 163 348 6.0E-17
sp|P46995|SET2_YEAST Histone-lysine N-methyltransferase, H3 lysine-36 specific OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SET2 PE=1 SV=2 157 351 7.0E-17
sp|O22781|SUVH2_ARATH Histone-lysine N-methyltransferase family member SUVH2 OS=Arabidopsis thaliana GN=SUVH2 PE=1 SV=1 38 319 9.0E-17
sp|Q9C5P1|SUVH7_ARATH Histone-lysine N-methyltransferase, H3 lysine-9 specific SUVH7 OS=Arabidopsis thaliana GN=SUVH7 PE=2 SV=1 161 348 1.0E-16
sp|Q1DR06|SET1_COCIM Histone-lysine N-methyltransferase, H3 lysine-4 specific OS=Coccidioides immitis (strain RS) GN=SET1 PE=3 SV=1 181 351 3.0E-16
sp|Q2UMH3|SET1_ASPOR Histone-lysine N-methyltransferase, H3 lysine-4 specific OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=set1 PE=3 SV=1 181 351 3.0E-16
sp|Q5B0Y5|SET1_EMENI Histone-lysine N-methyltransferase, H3 lysine-4 specific OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=set1 PE=3 SV=1 181 351 3.0E-16
sp|Q4WNH8|SET1_ASPFU Histone-lysine N-methyltransferase, H3 lysine-4 specific OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=set1 PE=3 SV=1 181 351 7.0E-16
sp|Q8MT36|MES4_DROME Probable histone-lysine N-methyltransferase Mes-4 OS=Drosophila melanogaster GN=Mes-4 PE=1 SV=2 141 347 8.0E-16
sp|Q9BZ95|NSD3_HUMAN Histone-lysine N-methyltransferase NSD3 OS=Homo sapiens GN=WHSC1L1 PE=1 SV=1 162 351 1.0E-15
sp|Q5ASA5|SET2_EMENI Histone-lysine N-methyltransferase, H3 lysine-36 specific OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=set2 PE=3 SV=1 163 351 2.0E-15
sp|Q8BVE8|NSD2_MOUSE Histone-lysine N-methyltransferase NSD2 OS=Mus musculus GN=Whsc1 PE=1 SV=2 157 351 2.0E-15
sp|Q2UTN6|SET2_ASPOR Histone-lysine N-methyltransferase, H3 lysine-36 specific OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=set2 PE=3 SV=1 163 351 2.0E-15
sp|Q6P2L6|NSD3_MOUSE Histone-lysine N-methyltransferase NSD3 OS=Mus musculus GN=Whsc1l1 PE=1 SV=2 157 351 3.0E-15
sp|Q8X0S9|SET1_NEUCR Histone-lysine N-methyltransferase, H3 lysine-4 specific OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=set-1 PE=3 SV=1 181 351 3.0E-15
sp|Q4PBL3|SET2_USTMA Histone-lysine N-methyltransferase, H3 lysine-36 specific OS=Ustilago maydis (strain 521 / FGSC 9021) GN=SET2 PE=3 SV=1 157 347 4.0E-15
sp|Q4WTT2|SET2_ASPFU Histone-lysine N-methyltransferase, H3 lysine-36 specific OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=set2 PE=3 SV=1 163 351 4.0E-15
sp|Q6C5G5|SET2_YARLI Histone-lysine N-methyltransferase, H3 lysine-36 specific OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=set-2 PE=3 SV=1 157 351 5.0E-15
sp|O96028|NSD2_HUMAN Histone-lysine N-methyltransferase NSD2 OS=Homo sapiens GN=WHSC1 PE=1 SV=1 157 351 5.0E-15
sp|Q6BM04|SET2_DEBHA Histone-lysine N-methyltransferase, H3 lysine-36 specific OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=SET2 PE=3 SV=2 163 351 5.0E-15
sp|Q9T0G7|SUVH9_ARATH Histone-lysine N-methyltransferase family member SUVH9 OS=Arabidopsis thaliana GN=SUVH9 PE=1 SV=1 37 319 2.0E-14
sp|Q6CXP5|SET2_KLULA Histone-lysine N-methyltransferase, H3 lysine-36 specific OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=SET2 PE=3 SV=1 161 351 2.0E-14
sp|Q5ABG1|SET1_CANAL Histone-lysine N-methyltransferase, H3 lysine-4 specific OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SET1 PE=3 SV=1 183 351 2.0E-14
sp|Q2GWF3|SET1_CHAGB Histone-lysine N-methyltransferase, H3 lysine-4 specific OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=SET1 PE=3 SV=1 181 351 3.0E-14
sp|Q59XV0|SET2_CANAL Histone-lysine N-methyltransferase, H3 lysine-36 specific OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SET2 PE=3 SV=1 157 351 3.0E-14
sp|Q9C5P0|SUVH8_ARATH Histone-lysine N-methyltransferase, H3 lysine-9 specific SUVH8 OS=Arabidopsis thaliana GN=SUVH8 PE=3 SV=1 170 348 7.0E-14
sp|Q757Y8|SET2_ASHGO Histone-lysine N-methyltransferase, H3 lysine-36 specific OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=SET2 PE=3 SV=2 157 319 8.0E-14
sp|Q9M364|ATX3_ARATH Histone-lysine N-methyltransferase ATX3 OS=Arabidopsis thaliana GN=ATX3 PE=2 SV=2 196 351 1.0E-13
sp|Q6FKB1|SET1_CANGA Histone-lysine N-methyltransferase, H3 lysine-4 specific OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=SET1 PE=3 SV=1 183 351 2.0E-13
sp|Q2LAE1|ASHH2_ARATH Histone-lysine N-methyltransferase ASHH2 OS=Arabidopsis thaliana GN=ASHH2 PE=1 SV=1 163 351 2.0E-13
sp|Q75D88|SET1_ASHGO Histone-lysine N-methyltransferase, H3 lysine-4 specific OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=SET1 PE=3 SV=2 167 351 3.0E-13
sp|Q4I5R3|SET1_GIBZE Histone-lysine N-methyltransferase, H3 lysine-4 specific OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=SET1 PE=3 SV=2 181 351 4.0E-13
sp|Q24742|TRX_DROVI Histone-lysine N-methyltransferase trithorax OS=Drosophila virilis GN=trx PE=3 SV=1 189 351 4.0E-13
sp|Q6BKL7|SET1_DEBHA Histone-lysine N-methyltransferase, H3 lysine-4 specific OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=SET1 PE=3 SV=2 183 351 6.0E-13
sp|P38827|SET1_YEAST Histone-lysine N-methyltransferase, H3 lysine-4 specific OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SET1 PE=1 SV=1 183 351 8.0E-13
sp|A7E2Z2|EZH1_BOVIN Histone-lysine N-methyltransferase EZH1 OS=Bos taurus GN=EZH1 PE=2 SV=2 171 331 8.0E-13
sp|Q2H988|SET2_CHAGB Histone-lysine N-methyltransferase, H3 lysine-36 specific OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=SET2 PE=3 SV=1 163 351 9.0E-13
sp|O08550|KMT2B_MOUSE Histone-lysine N-methyltransferase 2B OS=Mus musculus GN=Kmt2b PE=1 SV=3 189 351 1.0E-12
sp|Q9UMN6|KMT2B_HUMAN Histone-lysine N-methyltransferase 2B OS=Homo sapiens GN=KMT2B PE=1 SV=1 189 351 1.0E-12
sp|P70351|EZH1_MOUSE Histone-lysine N-methyltransferase EZH1 OS=Mus musculus GN=Ezh1 PE=1 SV=1 165 331 1.0E-12
sp|Q98SM3|EZH2A_XENLA Histone-lysine N-methyltransferase EZH2 OS=Xenopus laevis GN=ezh2-a PE=2 SV=1 169 331 1.0E-12
sp|Q92800|EZH1_HUMAN Histone-lysine N-methyltransferase EZH1 OS=Homo sapiens GN=EZH1 PE=1 SV=2 171 331 1.0E-12
sp|Q8IE95|SETVS_PLAF7 Variant-silencing SET domain-containing protein OS=Plasmodium falciparum (isolate 3D7) GN=SETVS PE=2 SV=1 174 350 1.0E-12
sp|Q08BS4|EZH2_DANRE Histone-lysine N-methyltransferase EZH2 OS=Danio rerio GN=ezh2 PE=2 SV=1 169 331 1.0E-12
sp|Q9NH52|MES4_CAEEL Histone-lysine N-methyltransferase mes-4 OS=Caenorhabditis elegans GN=mes-4 PE=1 SV=1 162 347 1.0E-12
sp|Q5QD03|SUVH3_CHLRE Histone-lysine N-methyltransferase, H3 lysine-9 specific SUVH3 OS=Chlamydomonas reinhardtii GN=SUVH3 PE=2 SV=1 37 248 1.0E-12
sp|Q6FX50|SET2_CANGA Histone-lysine N-methyltransferase, H3 lysine-36 specific OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=SET2 PE=3 SV=1 157 351 2.0E-12
sp|Q1DU03|SET2_COCIM Histone-lysine N-methyltransferase, H3 lysine-36 specific OS=Coccidioides immitis (strain RS) GN=SET2 PE=3 SV=2 163 351 2.0E-12
sp|P20659|TRX_DROME Histone-lysine N-methyltransferase trithorax OS=Drosophila melanogaster GN=trx PE=1 SV=4 189 351 2.0E-12
sp|Q4V863|EZH2B_XENLA Histone-lysine N-methyltransferase EZH2 OS=Xenopus laevis GN=ezh2-b PE=2 SV=1 169 331 3.0E-12
sp|Q9M1X9|ASHH4_ARATH Putative histone-lysine N-methyltransferase ASHH4 OS=Arabidopsis thaliana GN=ASHH4 PE=3 SV=1 176 351 3.0E-12
sp|Q4R381|EZH2_MACFA Histone-lysine N-methyltransferase EZH2 OS=Macaca fascicularis GN=EZH2 PE=2 SV=1 169 331 3.0E-12
sp|P42124|EZ_DROME Histone-lysine N-methyltransferase E(z) OS=Drosophila melanogaster GN=E(z) PE=1 SV=2 172 322 4.0E-12
sp|Q15910|EZH2_HUMAN Histone-lysine N-methyltransferase EZH2 OS=Homo sapiens GN=EZH2 PE=1 SV=2 169 331 4.0E-12
sp|Q61188|EZH2_MOUSE Histone-lysine N-methyltransferase EZH2 OS=Mus musculus GN=Ezh2 PE=1 SV=2 169 331 4.0E-12
sp|Q03164|KMT2A_HUMAN Histone-lysine N-methyltransferase 2A OS=Homo sapiens GN=KMT2A PE=1 SV=5 189 351 4.0E-12
sp|Q28D84|EZH2_XENTR Histone-lysine N-methyltransferase EZH2 OS=Xenopus tropicalis GN=ezh2 PE=2 SV=1 169 331 4.0E-12
sp|Q9BYW2|SETD2_HUMAN Histone-lysine N-methyltransferase SETD2 OS=Homo sapiens GN=SETD2 PE=1 SV=3 157 351 6.0E-12
sp|P55200|KMT2A_MOUSE Histone-lysine N-methyltransferase 2A OS=Mus musculus GN=Kmt2a PE=1 SV=3 189 351 6.0E-12
sp|Q5RDS6|EZH1_PONAB Histone-lysine N-methyltransferase EZH1 OS=Pongo abelii GN=EZH1 PE=2 SV=1 171 331 6.0E-12
sp|Q945S8|ASHH3_ARATH Histone-lysine N-methyltransferase ASHH3 OS=Arabidopsis thaliana GN=ASHH3 PE=2 SV=2 176 351 6.0E-12
sp|Q4PB36|SET1_USTMA Histone-lysine N-methyltransferase, H3 lysine-4 specific OS=Ustilago maydis (strain 521 / FGSC 9021) GN=SET1 PE=3 SV=1 181 351 8.0E-12
sp|E9Q5F9|SETD2_MOUSE Histone-lysine N-methyltransferase SETD2 OS=Mus musculus GN=Setd2 PE=1 SV=1 157 351 8.0E-12
sp|Q6CIT4|SET1_KLULA Histone-lysine N-methyltransferase, H3 lysine-4 specific OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=SET1 PE=3 SV=1 176 351 1.0E-11
sp|Q4IB50|SET2_GIBZE Histone-lysine N-methyltransferase, H3 lysine-36 specific OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=SET2 PE=3 SV=2 163 351 1.0E-11
sp|Q28Z18|SETB1_DROPS Histone-lysine N-methyltransferase eggless OS=Drosophila pseudoobscura pseudoobscura GN=egg PE=3 SV=2 148 225 4.0E-11
sp|Q7RZU4|SET2_NEUCR Histone-lysine N-methyltransferase, H3 lysine-36 specific OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=set-2 PE=3 SV=1 163 351 6.0E-11
sp|Q9SUE7|ATX4_ARATH Histone-lysine N-methyltransferase ATX4 OS=Arabidopsis thaliana GN=ATX4 PE=2 SV=3 191 351 8.0E-11
sp|Q6CEK8|SET1_YARLI Histone-lysine N-methyltransferase, H3 lysine-4 specific OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=SET1 PE=3 SV=1 181 351 8.0E-11
sp|C6KTD2|SET1_PLAF7 Putative histone-lysine N-methyltransferase 1 OS=Plasmodium falciparum (isolate 3D7) GN=SET1 PE=2 SV=1 187 347 9.0E-11
sp|Q08BR4|STB1B_DANRE Histone-lysine N-methyltransferase SETDB1-B OS=Danio rerio GN=setdb1b PE=2 SV=2 161 226 2.0E-10
sp|Q6INA9|SETB1_XENLA Histone-lysine N-methyltransferase SETDB1 OS=Xenopus laevis GN=setdb1 PE=2 SV=1 161 226 2.0E-10
sp|Q54HS3|SET1_DICDI Histone-lysine N-methyltransferase set1 OS=Dictyostelium discoideum GN=set1 PE=1 SV=1 181 351 2.0E-10
sp|Q9Y7R4|SET1_SCHPO Histone-lysine N-methyltransferase, H3 lysine-4 specific OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=set1 PE=1 SV=1 198 351 3.0E-10
sp|O65312|MEDEA_ARATH Histone-lysine N-methyltransferase MEDEA OS=Arabidopsis thaliana GN=MEA PE=1 SV=1 172 322 4.0E-10
sp|P0CO28|SET2_CRYNJ Histone-lysine N-methyltransferase, H3 lysine-36 specific OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=SET2 PE=3 SV=1 161 347 5.0E-10
sp|P0CO29|SET2_CRYNB Histone-lysine N-methyltransferase, H3 lysine-36 specific OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=SET2 PE=3 SV=1 161 347 5.0E-10
sp|O14026|SET2_SCHPO Histone-lysine N-methyltransferase, H3 lysine-36 specific OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=set2 PE=1 SV=1 170 351 6.0E-10
sp|P0CO27|SET1_CRYNB Histone-lysine N-methyltransferase, H3 lysine-4 specific OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=SET1 PE=3 SV=1 181 351 7.0E-10
sp|P0CO26|SET1_CRYNJ Histone-lysine N-methyltransferase, H3 lysine-4 specific OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=SET1 PE=3 SV=1 181 351 7.0E-10
sp|P34544|MET2_CAEEL Histone-lysine N-methyltransferase met-2 OS=Caenorhabditis elegans GN=met-2 PE=3 SV=5 149 230 8.0E-10
sp|O88974|SETB1_MOUSE Histone-lysine N-methyltransferase SETDB1 OS=Mus musculus GN=Setdb1 PE=1 SV=1 161 226 1.0E-09
sp|Q15047|SETB1_HUMAN Histone-lysine N-methyltransferase SETDB1 OS=Homo sapiens GN=SETDB1 PE=1 SV=1 161 226 1.0E-09
sp|Q8NEZ4|KMT2C_HUMAN Histone-lysine N-methyltransferase 2C OS=Homo sapiens GN=KMT2C PE=1 SV=3 191 351 2.0E-09
sp|Q32KD2|SETB1_DROME Histone-lysine N-methyltransferase eggless OS=Drosophila melanogaster GN=egg PE=1 SV=1 161 225 2.0E-09
sp|Q8BRH4|KMT2C_MOUSE Histone-lysine N-methyltransferase 2C OS=Mus musculus GN=Kmt2c PE=1 SV=2 191 351 2.0E-09
sp|Q96T68|SETB2_HUMAN Histone-lysine N-methyltransferase SETDB2 OS=Homo sapiens GN=SETDB2 PE=1 SV=2 161 226 7.0E-09
sp|Q06ZW3|SETB2_DANRE Histone-lysine N-methyltransferase SETDB2 OS=Danio rerio GN=setdb2 PE=2 SV=2 142 330 2.0E-08
sp|Q8C267|SETB2_MOUSE Histone-lysine N-methyltransferase SETDB2 OS=Mus musculus GN=Setdb2 PE=2 SV=2 161 226 3.0E-08
sp|Q6YI93|SETB2_XENLA Histone-lysine N-methyltransferase SETDB2 OS=Xenopus laevis GN=setdb2 PE=2 SV=2 161 219 4.0E-08
sp|A4IGY9|SETB2_XENTR Histone-lysine N-methyltransferase SETDB2 OS=Xenopus tropicalis GN=setdb2 PE=2 SV=1 161 219 5.0E-08
sp|Q18221|SET2_CAEEL Probable histone-lysine N-methyltransferase set-2 OS=Caenorhabditis elegans GN=set-2 PE=2 SV=2 183 351 5.0E-08
sp|O14686|KMT2D_HUMAN Histone-lysine N-methyltransferase 2D OS=Homo sapiens GN=KMT2D PE=1 SV=2 191 351 7.0E-07
sp|Q6PDK2|KMT2D_MOUSE Histone-lysine N-methyltransferase 2D OS=Mus musculus GN=Kmt2d PE=1 SV=2 191 351 7.0E-07
sp|Q9ZSM8|EZA1_ARATH Histone-lysine N-methyltransferase EZA1 OS=Arabidopsis thaliana GN=EZA1 PE=1 SV=1 196 336 9.0E-07
sp|P0CB22|ATX2_ARATH Histone-lysine N-methyltransferase ATX2 OS=Arabidopsis thaliana GN=ATX2 PE=2 SV=1 196 348 3.0E-06
sp|Q8S4P5|EZ2_MAIZE Histone-lysine N-methyltransferase EZ2 OS=Zea mays GN=EZ2 PE=2 SV=1 174 322 3.0E-06
sp|Q1L8U8|STB1A_DANRE Histone-lysine N-methyltransferase SETDB1-A OS=Danio rerio GN=setdb1a PE=3 SV=1 147 219 3.0E-06
sp|Q8S4P4|EZ3_MAIZE Histone-lysine N-methyltransferase EZ3 OS=Zea mays GN=EZ3 PE=2 SV=1 174 322 5.0E-06
sp|F4K1J4|ATXR7_ARATH Histone-lysine N-methyltransferase ATXR7 OS=Arabidopsis thaliana GN=ATXR7 PE=2 SV=1 181 319 5.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0034968 histone lysine methylation Yes
GO:0018024 histone-lysine N-methyltransferase activity Yes
GO:0008270 zinc ion binding Yes
GO:0005634 nucleus Yes
GO:0003824 catalytic activity No
GO:0008152 metabolic process No
GO:0008213 protein alkylation No
GO:0044260 cellular macromolecule metabolic process No
GO:0032259 methylation No
GO:0009987 cellular process No
GO:0043229 intracellular organelle No
GO:0018193 peptidyl-amino acid modification No
GO:0008276 protein methyltransferase activity No
GO:0018022 peptidyl-lysine methylation No
GO:0016570 histone modification No
GO:0071704 organic substance metabolic process No
GO:0006479 protein methylation No
GO:0008170 N-methyltransferase activity No
GO:0005488 binding No
GO:0016279 protein-lysine N-methyltransferase activity No
GO:0019538 protein metabolic process No
GO:0043226 organelle No
GO:0008150 biological_process No
GO:0016741 transferase activity, transferring one-carbon groups No
GO:0016571 histone methylation No
GO:0018205 peptidyl-lysine modification No
GO:0110165 cellular anatomical entity No
GO:0016740 transferase activity No
GO:0043227 membrane-bounded organelle No
GO:0016278 lysine N-methyltransferase activity No
GO:0043170 macromolecule metabolic process No
GO:0043231 intracellular membrane-bounded organelle No
GO:0036211 protein modification process No
GO:0044237 cellular metabolic process No
GO:0043414 macromolecule methylation No
GO:0005575 cellular_component No
GO:0046914 transition metal ion binding No
GO:0003674 molecular_function No
GO:0043412 macromolecule modification No
GO:0140096 catalytic activity, acting on a protein No
GO:1901564 organonitrogen compound metabolic process No
GO:0008757 S-adenosylmethionine-dependent methyltransferase activity No
GO:0046872 metal ion binding No
GO:0043167 ion binding No
GO:0042054 histone methyltransferase activity No
GO:0044238 primary metabolic process No
GO:0043169 cation binding No
GO:0006807 nitrogen compound metabolic process No
GO:0008168 methyltransferase activity No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Nucleus 0.45 0.8346 0.0976 0.0141 0.2102 0.023 0.1073 0.0661 0.0476 0.0622

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup4399
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4195
Ophiocordyceps australis map64 (Brazil) OphauB2|8078
Ophiocordyceps camponoti-floridani Ophcf2|04718
Ophiocordyceps camponoti-rufipedis Ophun1|6403
Ophiocordyceps kimflemingae Ophio5|8592
Ophiocordyceps subramaniannii Hirsu2|9109 (this protein)

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|9109
MEEAVKRHFFHHGRDEAAHERDGCHWCQLRSFPTHATAPITVVNDVDSEVLPPDFRFINENVLGHGVKPAELSFR
SGCVCADDADCQFKGCLCLADLEDDNDDDGQDVDDDDDDDDDEDSAMGNGYSSSAPPRSRKAYAYHRHGAKAGLL
RSKLHSSKLPLYECHQGCSCTVDCPNRVVERGRTVPLQIFRTEDRGWGVRTQETIKTGQFVDRYVGEVITSAEAD
RRRAAAIVSQRKDVYLFALDKFTDPASLDPRLRGPPLEVDGEFMSGPTRFINHSCGPNLRIFARVGDHADKHLHD
LALFAIRDIQKGEELTFDYVDGVSLEADEREGNAEDMTRCLCGSARCRKFLW*
Coding >Hirsu2|9109
ATGGAGGAGGCAGTCAAAAGACATTTTTTCCACCACGGCAGAGACGAAGCTGCGCACGAGCGGGATGGCTGTCAC
TGGTGCCAGCTGCGCTCGTTCCCGACGCACGCCACTGCGCCCATCACCGTTGTCAACGACGTGGACAGCGAGGTG
CTGCCGCCTGACTTCCGCTTCATCAACGAAAATGTGCTCGGCCATGGCGTGAAGCCGGCCGAGCTGAGCTTCCGC
AGTGGCTGCGTGTGCGCCGACGACGCCGACTGCCAGTTCAAGGGCTGCTTGTGTCTGGCGGATCTTGAGGACGAC
AACGACGACGATGGCCAAGATGTCGATGACGACGACGACGACGACGACGACGAAGACAGTGCCATGGGCAACGGG
TACAGCTCTTCTGCCCCCCCGCGGTCGAGGAAAGCGTACGCCTATCACAGACACGGCGCCAAGGCCGGCTTGCTG
CGATCAAAGCTGCACAGCTCCAAGCTGCCCCTGTACGAGTGCCACCAGGGCTGCTCCTGCACCGTCGACTGTCCG
AACCGCGTGGTCGAGCGCGGCCGCACCGTCCCGCTCCAGATTTTCCGTACGGAGGACCGAGGCTGGGGTGTCCGG
ACGCAGGAGACCATCAAGACGGGCCAGTTTGTCGACCGTTACGTCGGCGAGGTCATCACGTCGGCCGAAGCTGAC
CGCCGGCGCGCGGCGGCCATCGTCTCGCAGCGTAAGGACGTCTATCTCTTTGCCCTCGACAAGTTTACGGATCCG
GCATCGCTCGACCCGCGGCTCCGCGGCCCGCCGCTGGAGGTGGACGGCGAGTTCATGTCGGGGCCGACGCGCTTC
ATCAACCACTCGTGCGGGCCCAACCTCCGCATCTTCGCGCGCGTCGGCGACCACGCCGACAAGCACCTGCACGAC
CTGGCCCTCTTCGCCATCCGGGACATCCAGAAGGGCGAGGAGCTGACGTTCGACTACGTCGACGGCGTCTCGCTC
GAGGCCGACGAGCGCGAGGGCAACGCCGAGGACATGACGCGCTGCCTCTGCGGCAGCGCCAGGTGCAGGAAGTTT
CTGTGGTAG
Transcript >Hirsu2|9109
ATGGAGGAGGCAGTCAAAAGACATTTTTTCCACCACGGCAGAGACGAAGCTGCGCACGAGCGGGATGGCTGTCAC
TGGTGCCAGCTGCGCTCGTTCCCGACGCACGCCACTGCGCCCATCACCGTTGTCAACGACGTGGACAGCGAGGTG
CTGCCGCCTGACTTCCGCTTCATCAACGAAAATGTGCTCGGCCATGGCGTGAAGCCGGCCGAGCTGAGCTTCCGC
AGTGGCTGCGTGTGCGCCGACGACGCCGACTGCCAGTTCAAGGGCTGCTTGTGTCTGGCGGATCTTGAGGACGAC
AACGACGACGATGGCCAAGATGTCGATGACGACGACGACGACGACGACGACGAAGACAGTGCCATGGGCAACGGG
TACAGCTCTTCTGCCCCCCCGCGGTCGAGGAAAGCGTACGCCTATCACAGACACGGCGCCAAGGCCGGCTTGCTG
CGATCAAAGCTGCACAGCTCCAAGCTGCCCCTGTACGAGTGCCACCAGGGCTGCTCCTGCACCGTCGACTGTCCG
AACCGCGTGGTCGAGCGCGGCCGCACCGTCCCGCTCCAGATTTTCCGTACGGAGGACCGAGGCTGGGGTGTCCGG
ACGCAGGAGACCATCAAGACGGGCCAGTTTGTCGACCGTTACGTCGGCGAGGTCATCACGTCGGCCGAAGCTGAC
CGCCGGCGCGCGGCGGCCATCGTCTCGCAGCGTAAGGACGTCTATCTCTTTGCCCTCGACAAGTTTACGGATCCG
GCATCGCTCGACCCGCGGCTCCGCGGCCCGCCGCTGGAGGTGGACGGCGAGTTCATGTCGGGGCCGACGCGCTTC
ATCAACCACTCGTGCGGGCCCAACCTCCGCATCTTCGCGCGCGTCGGCGACCACGCCGACAAGCACCTGCACGAC
CTGGCCCTCTTCGCCATCCGGGACATCCAGAAGGGCGAGGAGCTGACGTTCGACTACGTCGACGGCGTCTCGCTC
GAGGCCGACGAGCGCGAGGGCAACGCCGAGGACATGACGCGCTGCCTCTGCGGCAGCGCCAGGTGCAGGAAGTTT
CTGTGGTAG
Gene >Hirsu2|9109
ATGGAGGAGGCAGTCAAAAGACATTTTTTCCACCACGGCAGAGACGTATTCCCCCCCCTCTTCATCTCCAATGAG
GGTCGCATGCTGACCGTCTTGGCTCTGCAGGAAGCTGCGCACGAGCGGGATGGCTGTCACTGGTGCCAGCTGCGC
TCGTTCCCGACGCACGCCACTGCGCCCATCACCGTTGTCAACGACGTGGACAGCGAGGTGCTGCCGCCTGACTTC
CGCTTCATCAACGAAAATGTGCTCGGCCATGGCGTGAAGCCGGCCGAGCTGAGCTTCCGCAGTGGCTGCGTGTGC
GCCGACGACGCCGACTGCCAGTTCAAGGGCTGCTTGTGTCTGGCGGATCTTGAGGACGACAACGACGACGATGGC
CAAGATGTCGATGACGACGACGACGACGACGACGACGAAGACAGTGCCATGGGCAACGGGTACAGCTCTTCTGCC
CCCCCGCGGTCGAGGAAAGCGTACGCCTATCACAGACACGGCGCCAAGGCCGGCTTGCTGCGATCAAAGCTGCAC
AGCTCCAAGCTGCCCCTGTACGAGTGCCACCAGGGCTGCTCCTGCACCGTCGACTGTCCGAACCGCGTGGTCGAG
CGCGGCCGCACCGTCCCGCTCCAGATTTTCCGTACGGAGGACCGAGGCTGGGGTCCGTGTCCCCCGTTCCGCTTG
CGCCGGCGTGGCTGACGCGGTCGCAGGTGTCCGGACGCAGGAGACCATCAAGACGGGCCAGTTTGTCGACCGTTA
CGTCGGCGAGGTCATCACGTCGGCCGAAGCTGACCGCCGGCGCGCGGCGGCCATCGTCTCGCAGCGTAAGGACGT
CTATCTCTTTGCCCTCGACAAGTTTACGGATCCGGCATCGCTCGACCCGCGGCTCCGCGGCCCGCCGCTGGAGGT
GGACGGCGAGTTCATGTCGGGGCCGACGCGCTTCATCAACCACTCGTGCGGGCCCAACCTCCGCATCTTCGCGCG
CGTCGGCGACCACGCCGACAAGCACCTGCACGACCTGGCCCTCTTCGCCATCCGGGACATCCAGAAGGGCGAGGA
GCTGACGTTCGACTACGTCGACGGCGTCTCGCTCGAGGCCGACGAGCGCGAGGGCAACGCCGAGGACATGACGCG
CTGCCTCTGCGGCAGCGCCAGGTGCAGGAAGTTTCTGTGGTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail