Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|9109
Gene name
LocationContig_64:20564..21732
Strand-
Gene length (bp)1168
Transcript length (bp)1059
Coding sequence length (bp)1059
Protein length (aa) 353

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05033 Pre-SET Pre-SET motif 1.3E-17 37 177
PF00856 SET SET domain 2.1E-17 196 319

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q8X225|DIM5_NEUCR Histone-lysine N-methyltransferase, H3 lysine-9 specific dim-5 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=dim-5 PE=1 SV=2 1 352 2.0E-146
sp|O60016|CLR4_SCHPO Histone-lysine N-methyltransferase, H3 lysine-9 specific OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=clr4 PE=1 SV=2 40 352 1.0E-51
sp|Q5RB81|SUV91_PONAB Histone-lysine N-methyltransferase SUV39H1 OS=Pongo abelii GN=SUV39H1 PE=2 SV=1 40 352 8.0E-43
sp|O43463|SUV91_HUMAN Histone-lysine N-methyltransferase SUV39H1 OS=Homo sapiens GN=SUV39H1 PE=1 SV=1 40 352 8.0E-43
sp|Q2NL30|SUV91_BOVIN Histone-lysine N-methyltransferase SUV39H1 OS=Bos taurus GN=SUV39H1 PE=2 SV=1 40 352 8.0E-43
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q8X225|DIM5_NEUCR Histone-lysine N-methyltransferase, H3 lysine-9 specific dim-5 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=dim-5 PE=1 SV=2 1 352 2.0E-146
sp|O60016|CLR4_SCHPO Histone-lysine N-methyltransferase, H3 lysine-9 specific OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=clr4 PE=1 SV=2 40 352 1.0E-51
sp|Q5RB81|SUV91_PONAB Histone-lysine N-methyltransferase SUV39H1 OS=Pongo abelii GN=SUV39H1 PE=2 SV=1 40 352 8.0E-43
sp|O43463|SUV91_HUMAN Histone-lysine N-methyltransferase SUV39H1 OS=Homo sapiens GN=SUV39H1 PE=1 SV=1 40 352 8.0E-43
sp|Q2NL30|SUV91_BOVIN Histone-lysine N-methyltransferase SUV39H1 OS=Bos taurus GN=SUV39H1 PE=2 SV=1 40 352 8.0E-43
sp|O54864|SUV91_MOUSE Histone-lysine N-methyltransferase SUV39H1 OS=Mus musculus GN=Suv39h1 PE=1 SV=1 40 352 2.0E-42
sp|Q6NRE8|SUV91_XENLA Histone-lysine N-methyltransferase SUV39H1 OS=Xenopus laevis GN=suv39h1 PE=2 SV=1 25 352 2.0E-41
sp|Q5F3W5|SUV92_CHICK Histone-lysine N-methyltransferase SUV39H2 OS=Gallus gallus GN=SUV39H2 PE=2 SV=1 1 351 1.0E-39
sp|Q294B9|SUV39_DROPS Histone-lysine N-methyltransferase Su(var)3-9 OS=Drosophila pseudoobscura pseudoobscura GN=Su(var)3-9 PE=3 SV=1 37 352 2.0E-37
sp|Q28CQ7|SUV92_XENTR Histone-lysine N-methyltransferase SUV39H2 OS=Xenopus tropicalis GN=suv39h2 PE=2 SV=2 28 351 3.0E-37
sp|Q9H5I1|SUV92_HUMAN Histone-lysine N-methyltransferase SUV39H2 OS=Homo sapiens GN=SUV39H2 PE=1 SV=2 40 351 5.0E-37
sp|Q4R3E0|SUV92_MACFA Histone-lysine N-methyltransferase SUV39H2 OS=Macaca fascicularis GN=SUV39H2 PE=2 SV=2 40 351 6.0E-37
sp|Q6DGD3|SV91A_DANRE Histone-lysine N-methyltransferase SUV39H1-A OS=Danio rerio GN=suv39h1a PE=2 SV=2 40 352 2.0E-36
sp|Q32PH7|SUV92_BOVIN Histone-lysine N-methyltransferase SUV39H2 OS=Bos taurus GN=SUV39H2 PE=2 SV=1 1 351 3.0E-36
sp|Q9EQQ0|SUV92_MOUSE Histone-lysine N-methyltransferase SUV39H2 OS=Mus musculus GN=Suv39h2 PE=1 SV=1 1 351 3.0E-35
sp|Q5DW34|EHMT1_MOUSE Histone-lysine N-methyltransferase EHMT1 OS=Mus musculus GN=Ehmt1 PE=1 SV=2 39 348 3.0E-32
sp|Q96KQ7|EHMT2_HUMAN Histone-lysine N-methyltransferase EHMT2 OS=Homo sapiens GN=EHMT2 PE=1 SV=3 35 348 1.0E-30
sp|Q9Z148|EHMT2_MOUSE Histone-lysine N-methyltransferase EHMT2 OS=Mus musculus GN=Ehmt2 PE=1 SV=2 35 348 3.0E-30
sp|Q9H9B1|EHMT1_HUMAN Histone-lysine N-methyltransferase EHMT1 OS=Homo sapiens GN=EHMT1 PE=1 SV=4 39 348 3.0E-30
sp|Q5I0M0|SETMR_RAT Histone-lysine N-methyltransferase SETMAR OS=Rattus norvegicus GN=Setmar PE=2 SV=1 160 351 3.0E-29
sp|Q80UJ9|SETMR_MOUSE Histone-lysine N-methyltransferase SETMAR OS=Mus musculus GN=Setmar PE=2 SV=2 160 351 9.0E-29
sp|Q0VD24|SETMR_BOVIN Histone-lysine N-methyltransferase SETMAR OS=Bos taurus GN=SETMAR PE=2 SV=1 160 351 9.0E-28
sp|P45975|SUV39_DROME Histone-lysine N-methyltransferase Su(var)3-9 OS=Drosophila melanogaster GN=Su(var)3-9 PE=1 SV=2 37 352 3.0E-26
sp|Q53H47|SETMR_HUMAN Histone-lysine N-methyltransferase SETMAR OS=Homo sapiens GN=SETMAR PE=1 SV=2 55 351 6.0E-26
sp|O82175|SUVH5_ARATH Histone-lysine N-methyltransferase, H3 lysine-9 specific SUVH5 OS=Arabidopsis thaliana GN=SUVH5 PE=1 SV=1 133 352 9.0E-25
sp|Q93YF5|SUVH1_TOBAC Histone-lysine N-methyltransferase, H3 lysine-9 specific SUVH1 OS=Nicotiana tabacum GN=SUVH1 PE=1 SV=1 154 352 7.0E-24
sp|O64827|SUVR5_ARATH Histone-lysine N-methyltransferase SUVR5 OS=Arabidopsis thaliana GN=SUVR5 PE=1 SV=3 160 351 8.0E-24
sp|Q8VZ17|SUVH6_ARATH Histone-lysine N-methyltransferase, H3 lysine-9 specific SUVH6 OS=Arabidopsis thaliana GN=SUVH6 PE=2 SV=2 157 352 1.0E-23
sp|Q95Y12|SET23_CAEEL Probable histone-lysine N-methyltransferase set-23 OS=Caenorhabditis elegans GN=set-23 PE=3 SV=1 153 351 2.0E-23
sp|A8XI75|SET23_CAEBR Probable histone-lysine N-methyltransferase set-23 OS=Caenorhabditis briggsae GN=set-23 PE=3 SV=1 161 351 4.0E-23
sp|Q9SRV2|SUVR3_ARATH Histone-lysine N-methyltransferase SUVR3 OS=Arabidopsis thaliana GN=SUVR3 PE=2 SV=4 163 347 1.0E-22
sp|Q9C5P4|SUVH3_ARATH Histone-lysine N-methyltransferase, H3 lysine-9 specific SUVH3 OS=Arabidopsis thaliana GN=SUVH3 PE=2 SV=2 154 348 1.0E-22
sp|Q946J2|SUVR1_ARATH Probable inactive histone-lysine N-methyltransferase SUVR1 OS=Arabidopsis thaliana GN=SUVR1 PE=1 SV=2 153 348 2.0E-22
sp|Q9FF80|SUVH1_ARATH Histone-lysine N-methyltransferase, H3 lysine-9 specific SUVH1 OS=Arabidopsis thaliana GN=SUVH1 PE=2 SV=1 154 348 1.0E-21
sp|Q8W595|SUVR4_ARATH Histone-lysine N-methyltransferase SUVR4 OS=Arabidopsis thaliana GN=SUVR4 PE=1 SV=2 161 348 2.0E-20
sp|O88491|NSD1_MOUSE Histone-lysine N-methyltransferase, H3 lysine-36 and H4 lysine-20 specific OS=Mus musculus GN=Nsd1 PE=1 SV=1 157 351 1.0E-19
sp|Q8GZB6|SUVH4_ARATH Histone-lysine N-methyltransferase, H3 lysine-9 specific SUVH4 OS=Arabidopsis thaliana GN=SUVH4 PE=1 SV=2 153 352 1.0E-19
sp|Q9NR48|ASH1L_HUMAN Histone-lysine N-methyltransferase ASH1L OS=Homo sapiens GN=ASH1L PE=1 SV=2 157 348 3.0E-19
sp|Q99MY8|ASH1L_MOUSE Histone-lysine N-methyltransferase ASH1L OS=Mus musculus GN=Ash1l PE=1 SV=3 157 348 4.0E-19
sp|Q96L73|NSD1_HUMAN Histone-lysine N-methyltransferase, H3 lysine-36 and H4 lysine-20 specific OS=Homo sapiens GN=NSD1 PE=1 SV=1 157 351 7.0E-19
sp|Q9FNC7|SUVR2_ARATH Probable inactive histone-lysine N-methyltransferase SUVR2 OS=Arabidopsis thaliana GN=SUVR2 PE=1 SV=2 153 348 1.0E-18
sp|Q949T8|ASHR3_ARATH Histone-lysine N-methyltransferase ASHR3 OS=Arabidopsis thaliana GN=ASHR3 PE=1 SV=1 164 351 4.0E-18
sp|Q9VYD1|C1716_DROME Probable histone-lysine N-methyltransferase CG1716 OS=Drosophila melanogaster GN=Set2 PE=1 SV=2 157 351 2.0E-17
sp|Q84WW6|ASHH1_ARATH Histone-lysine N-methyltransferase ASHH1 OS=Arabidopsis thaliana GN=ASHH1 PE=1 SV=1 163 351 5.0E-17
sp|Q9VW15|ASH1_DROME Histone-lysine N-methyltransferase ash1 OS=Drosophila melanogaster GN=ash1 PE=1 SV=3 163 348 6.0E-17
sp|P46995|SET2_YEAST Histone-lysine N-methyltransferase, H3 lysine-36 specific OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SET2 PE=1 SV=2 157 351 7.0E-17
sp|O22781|SUVH2_ARATH Histone-lysine N-methyltransferase family member SUVH2 OS=Arabidopsis thaliana GN=SUVH2 PE=1 SV=1 38 319 9.0E-17
sp|Q9C5P1|SUVH7_ARATH Histone-lysine N-methyltransferase, H3 lysine-9 specific SUVH7 OS=Arabidopsis thaliana GN=SUVH7 PE=2 SV=1 161 348 1.0E-16
sp|Q1DR06|SET1_COCIM Histone-lysine N-methyltransferase, H3 lysine-4 specific OS=Coccidioides immitis (strain RS) GN=SET1 PE=3 SV=1 181 351 3.0E-16
sp|Q2UMH3|SET1_ASPOR Histone-lysine N-methyltransferase, H3 lysine-4 specific OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=set1 PE=3 SV=1 181 351 3.0E-16
sp|Q5B0Y5|SET1_EMENI Histone-lysine N-methyltransferase, H3 lysine-4 specific OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=set1 PE=3 SV=1 181 351 3.0E-16
sp|Q4WNH8|SET1_ASPFU Histone-lysine N-methyltransferase, H3 lysine-4 specific OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=set1 PE=3 SV=1 181 351 7.0E-16
sp|Q8MT36|MES4_DROME Probable histone-lysine N-methyltransferase Mes-4 OS=Drosophila melanogaster GN=Mes-4 PE=1 SV=2 141 347 8.0E-16
sp|Q9BZ95|NSD3_HUMAN Histone-lysine N-methyltransferase NSD3 OS=Homo sapiens GN=WHSC1L1 PE=1 SV=1 162 351 1.0E-15
sp|Q5ASA5|SET2_EMENI Histone-lysine N-methyltransferase, H3 lysine-36 specific OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=set2 PE=3 SV=1 163 351 2.0E-15
sp|Q8BVE8|NSD2_MOUSE Histone-lysine N-methyltransferase NSD2 OS=Mus musculus GN=Whsc1 PE=1 SV=2 157 351 2.0E-15
sp|Q2UTN6|SET2_ASPOR Histone-lysine N-methyltransferase, H3 lysine-36 specific OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=set2 PE=3 SV=1 163 351 2.0E-15
sp|Q6P2L6|NSD3_MOUSE Histone-lysine N-methyltransferase NSD3 OS=Mus musculus GN=Whsc1l1 PE=1 SV=2 157 351 3.0E-15
sp|Q8X0S9|SET1_NEUCR Histone-lysine N-methyltransferase, H3 lysine-4 specific OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=set-1 PE=3 SV=1 181 351 3.0E-15
sp|Q4PBL3|SET2_USTMA Histone-lysine N-methyltransferase, H3 lysine-36 specific OS=Ustilago maydis (strain 521 / FGSC 9021) GN=SET2 PE=3 SV=1 157 347 4.0E-15
sp|Q4WTT2|SET2_ASPFU Histone-lysine N-methyltransferase, H3 lysine-36 specific OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=set2 PE=3 SV=1 163 351 4.0E-15
sp|Q6C5G5|SET2_YARLI Histone-lysine N-methyltransferase, H3 lysine-36 specific OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=set-2 PE=3 SV=1 157 351 5.0E-15
sp|O96028|NSD2_HUMAN Histone-lysine N-methyltransferase NSD2 OS=Homo sapiens GN=WHSC1 PE=1 SV=1 157 351 5.0E-15
sp|Q6BM04|SET2_DEBHA Histone-lysine N-methyltransferase, H3 lysine-36 specific OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=SET2 PE=3 SV=2 163 351 5.0E-15
sp|Q9T0G7|SUVH9_ARATH Histone-lysine N-methyltransferase family member SUVH9 OS=Arabidopsis thaliana GN=SUVH9 PE=1 SV=1 37 319 2.0E-14
sp|Q6CXP5|SET2_KLULA Histone-lysine N-methyltransferase, H3 lysine-36 specific OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=SET2 PE=3 SV=1 161 351 2.0E-14
sp|Q5ABG1|SET1_CANAL Histone-lysine N-methyltransferase, H3 lysine-4 specific OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SET1 PE=3 SV=1 183 351 2.0E-14
sp|Q2GWF3|SET1_CHAGB Histone-lysine N-methyltransferase, H3 lysine-4 specific OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=SET1 PE=3 SV=1 181 351 3.0E-14
sp|Q59XV0|SET2_CANAL Histone-lysine N-methyltransferase, H3 lysine-36 specific OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SET2 PE=3 SV=1 157 351 3.0E-14
sp|Q9C5P0|SUVH8_ARATH Histone-lysine N-methyltransferase, H3 lysine-9 specific SUVH8 OS=Arabidopsis thaliana GN=SUVH8 PE=3 SV=1 170 348 7.0E-14
sp|Q757Y8|SET2_ASHGO Histone-lysine N-methyltransferase, H3 lysine-36 specific OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=SET2 PE=3 SV=2 157 319 8.0E-14
sp|Q9M364|ATX3_ARATH Histone-lysine N-methyltransferase ATX3 OS=Arabidopsis thaliana GN=ATX3 PE=2 SV=2 196 351 1.0E-13
sp|Q6FKB1|SET1_CANGA Histone-lysine N-methyltransferase, H3 lysine-4 specific OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=SET1 PE=3 SV=1 183 351 2.0E-13
sp|Q2LAE1|ASHH2_ARATH Histone-lysine N-methyltransferase ASHH2 OS=Arabidopsis thaliana GN=ASHH2 PE=1 SV=1 163 351 2.0E-13
sp|Q75D88|SET1_ASHGO Histone-lysine N-methyltransferase, H3 lysine-4 specific OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=SET1 PE=3 SV=2 167 351 3.0E-13
sp|Q4I5R3|SET1_GIBZE Histone-lysine N-methyltransferase, H3 lysine-4 specific OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=SET1 PE=3 SV=2 181 351 4.0E-13
sp|Q24742|TRX_DROVI Histone-lysine N-methyltransferase trithorax OS=Drosophila virilis GN=trx PE=3 SV=1 189 351 4.0E-13
sp|Q6BKL7|SET1_DEBHA Histone-lysine N-methyltransferase, H3 lysine-4 specific OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=SET1 PE=3 SV=2 183 351 6.0E-13
sp|P38827|SET1_YEAST Histone-lysine N-methyltransferase, H3 lysine-4 specific OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SET1 PE=1 SV=1 183 351 8.0E-13
sp|A7E2Z2|EZH1_BOVIN Histone-lysine N-methyltransferase EZH1 OS=Bos taurus GN=EZH1 PE=2 SV=2 171 331 8.0E-13
sp|Q2H988|SET2_CHAGB Histone-lysine N-methyltransferase, H3 lysine-36 specific OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=SET2 PE=3 SV=1 163 351 9.0E-13
sp|O08550|KMT2B_MOUSE Histone-lysine N-methyltransferase 2B OS=Mus musculus GN=Kmt2b PE=1 SV=3 189 351 1.0E-12
sp|Q9UMN6|KMT2B_HUMAN Histone-lysine N-methyltransferase 2B OS=Homo sapiens GN=KMT2B PE=1 SV=1 189 351 1.0E-12
sp|P70351|EZH1_MOUSE Histone-lysine N-methyltransferase EZH1 OS=Mus musculus GN=Ezh1 PE=1 SV=1 165 331 1.0E-12
sp|Q98SM3|EZH2A_XENLA Histone-lysine N-methyltransferase EZH2 OS=Xenopus laevis GN=ezh2-a PE=2 SV=1 169 331 1.0E-12
sp|Q92800|EZH1_HUMAN Histone-lysine N-methyltransferase EZH1 OS=Homo sapiens GN=EZH1 PE=1 SV=2 171 331 1.0E-12
sp|Q8IE95|SETVS_PLAF7 Variant-silencing SET domain-containing protein OS=Plasmodium falciparum (isolate 3D7) GN=SETVS PE=2 SV=1 174 350 1.0E-12
sp|Q08BS4|EZH2_DANRE Histone-lysine N-methyltransferase EZH2 OS=Danio rerio GN=ezh2 PE=2 SV=1 169 331 1.0E-12
sp|Q9NH52|MES4_CAEEL Histone-lysine N-methyltransferase mes-4 OS=Caenorhabditis elegans GN=mes-4 PE=1 SV=1 162 347 1.0E-12
sp|Q5QD03|SUVH3_CHLRE Histone-lysine N-methyltransferase, H3 lysine-9 specific SUVH3 OS=Chlamydomonas reinhardtii GN=SUVH3 PE=2 SV=1 37 248 1.0E-12
sp|Q6FX50|SET2_CANGA Histone-lysine N-methyltransferase, H3 lysine-36 specific OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=SET2 PE=3 SV=1 157 351 2.0E-12
sp|Q1DU03|SET2_COCIM Histone-lysine N-methyltransferase, H3 lysine-36 specific OS=Coccidioides immitis (strain RS) GN=SET2 PE=3 SV=2 163 351 2.0E-12
sp|P20659|TRX_DROME Histone-lysine N-methyltransferase trithorax OS=Drosophila melanogaster GN=trx PE=1 SV=4 189 351 2.0E-12
sp|Q4V863|EZH2B_XENLA Histone-lysine N-methyltransferase EZH2 OS=Xenopus laevis GN=ezh2-b PE=2 SV=1 169 331 3.0E-12
sp|Q9M1X9|ASHH4_ARATH Putative histone-lysine N-methyltransferase ASHH4 OS=Arabidopsis thaliana GN=ASHH4 PE=3 SV=1 176 351 3.0E-12
sp|Q4R381|EZH2_MACFA Histone-lysine N-methyltransferase EZH2 OS=Macaca fascicularis GN=EZH2 PE=2 SV=1 169 331 3.0E-12
sp|P42124|EZ_DROME Histone-lysine N-methyltransferase E(z) OS=Drosophila melanogaster GN=E(z) PE=1 SV=2 172 322 4.0E-12
sp|Q15910|EZH2_HUMAN Histone-lysine N-methyltransferase EZH2 OS=Homo sapiens GN=EZH2 PE=1 SV=2 169 331 4.0E-12
sp|Q61188|EZH2_MOUSE Histone-lysine N-methyltransferase EZH2 OS=Mus musculus GN=Ezh2 PE=1 SV=2 169 331 4.0E-12
sp|Q03164|KMT2A_HUMAN Histone-lysine N-methyltransferase 2A OS=Homo sapiens GN=KMT2A PE=1 SV=5 189 351 4.0E-12
sp|Q28D84|EZH2_XENTR Histone-lysine N-methyltransferase EZH2 OS=Xenopus tropicalis GN=ezh2 PE=2 SV=1 169 331 4.0E-12
sp|Q9BYW2|SETD2_HUMAN Histone-lysine N-methyltransferase SETD2 OS=Homo sapiens GN=SETD2 PE=1 SV=3 157 351 6.0E-12
sp|P55200|KMT2A_MOUSE Histone-lysine N-methyltransferase 2A OS=Mus musculus GN=Kmt2a PE=1 SV=3 189 351 6.0E-12
sp|Q5RDS6|EZH1_PONAB Histone-lysine N-methyltransferase EZH1 OS=Pongo abelii GN=EZH1 PE=2 SV=1 171 331 6.0E-12
sp|Q945S8|ASHH3_ARATH Histone-lysine N-methyltransferase ASHH3 OS=Arabidopsis thaliana GN=ASHH3 PE=2 SV=2 176 351 6.0E-12
sp|Q4PB36|SET1_USTMA Histone-lysine N-methyltransferase, H3 lysine-4 specific OS=Ustilago maydis (strain 521 / FGSC 9021) GN=SET1 PE=3 SV=1 181 351 8.0E-12
sp|E9Q5F9|SETD2_MOUSE Histone-lysine N-methyltransferase SETD2 OS=Mus musculus GN=Setd2 PE=1 SV=1 157 351 8.0E-12
sp|Q6CIT4|SET1_KLULA Histone-lysine N-methyltransferase, H3 lysine-4 specific OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=SET1 PE=3 SV=1 176 351 1.0E-11
sp|Q4IB50|SET2_GIBZE Histone-lysine N-methyltransferase, H3 lysine-36 specific OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=SET2 PE=3 SV=2 163 351 1.0E-11
sp|Q28Z18|SETB1_DROPS Histone-lysine N-methyltransferase eggless OS=Drosophila pseudoobscura pseudoobscura GN=egg PE=3 SV=2 148 225 4.0E-11
sp|Q7RZU4|SET2_NEUCR Histone-lysine N-methyltransferase, H3 lysine-36 specific OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=set-2 PE=3 SV=1 163 351 6.0E-11
sp|Q9SUE7|ATX4_ARATH Histone-lysine N-methyltransferase ATX4 OS=Arabidopsis thaliana GN=ATX4 PE=2 SV=3 191 351 8.0E-11
sp|Q6CEK8|SET1_YARLI Histone-lysine N-methyltransferase, H3 lysine-4 specific OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=SET1 PE=3 SV=1 181 351 8.0E-11
sp|C6KTD2|SET1_PLAF7 Putative histone-lysine N-methyltransferase 1 OS=Plasmodium falciparum (isolate 3D7) GN=SET1 PE=2 SV=1 187 347 9.0E-11
sp|Q08BR4|STB1B_DANRE Histone-lysine N-methyltransferase SETDB1-B OS=Danio rerio GN=setdb1b PE=2 SV=2 161 226 2.0E-10
sp|Q6INA9|SETB1_XENLA Histone-lysine N-methyltransferase SETDB1 OS=Xenopus laevis GN=setdb1 PE=2 SV=1 161 226 2.0E-10
sp|Q54HS3|SET1_DICDI Histone-lysine N-methyltransferase set1 OS=Dictyostelium discoideum GN=set1 PE=1 SV=1 181 351 2.0E-10
sp|Q9Y7R4|SET1_SCHPO Histone-lysine N-methyltransferase, H3 lysine-4 specific OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=set1 PE=1 SV=1 198 351 3.0E-10
sp|O65312|MEDEA_ARATH Histone-lysine N-methyltransferase MEDEA OS=Arabidopsis thaliana GN=MEA PE=1 SV=1 172 322 4.0E-10
sp|P0CO28|SET2_CRYNJ Histone-lysine N-methyltransferase, H3 lysine-36 specific OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=SET2 PE=3 SV=1 161 347 5.0E-10
sp|P0CO29|SET2_CRYNB Histone-lysine N-methyltransferase, H3 lysine-36 specific OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=SET2 PE=3 SV=1 161 347 5.0E-10
sp|O14026|SET2_SCHPO Histone-lysine N-methyltransferase, H3 lysine-36 specific OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=set2 PE=1 SV=1 170 351 6.0E-10
sp|P0CO27|SET1_CRYNB Histone-lysine N-methyltransferase, H3 lysine-4 specific OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=SET1 PE=3 SV=1 181 351 7.0E-10
sp|P0CO26|SET1_CRYNJ Histone-lysine N-methyltransferase, H3 lysine-4 specific OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=SET1 PE=3 SV=1 181 351 7.0E-10
sp|P34544|MET2_CAEEL Histone-lysine N-methyltransferase met-2 OS=Caenorhabditis elegans GN=met-2 PE=3 SV=5 149 230 8.0E-10
sp|O88974|SETB1_MOUSE Histone-lysine N-methyltransferase SETDB1 OS=Mus musculus GN=Setdb1 PE=1 SV=1 161 226 1.0E-09
sp|Q15047|SETB1_HUMAN Histone-lysine N-methyltransferase SETDB1 OS=Homo sapiens GN=SETDB1 PE=1 SV=1 161 226 1.0E-09
sp|Q8NEZ4|KMT2C_HUMAN Histone-lysine N-methyltransferase 2C OS=Homo sapiens GN=KMT2C PE=1 SV=3 191 351 2.0E-09
sp|Q32KD2|SETB1_DROME Histone-lysine N-methyltransferase eggless OS=Drosophila melanogaster GN=egg PE=1 SV=1 161 225 2.0E-09
sp|Q8BRH4|KMT2C_MOUSE Histone-lysine N-methyltransferase 2C OS=Mus musculus GN=Kmt2c PE=1 SV=2 191 351 2.0E-09
sp|Q96T68|SETB2_HUMAN Histone-lysine N-methyltransferase SETDB2 OS=Homo sapiens GN=SETDB2 PE=1 SV=2 161 226 7.0E-09
sp|Q06ZW3|SETB2_DANRE Histone-lysine N-methyltransferase SETDB2 OS=Danio rerio GN=setdb2 PE=2 SV=2 142 330 2.0E-08
sp|Q8C267|SETB2_MOUSE Histone-lysine N-methyltransferase SETDB2 OS=Mus musculus GN=Setdb2 PE=2 SV=2 161 226 3.0E-08
sp|Q6YI93|SETB2_XENLA Histone-lysine N-methyltransferase SETDB2 OS=Xenopus laevis GN=setdb2 PE=2 SV=2 161 219 4.0E-08
sp|A4IGY9|SETB2_XENTR Histone-lysine N-methyltransferase SETDB2 OS=Xenopus tropicalis GN=setdb2 PE=2 SV=1 161 219 5.0E-08
sp|Q18221|SET2_CAEEL Probable histone-lysine N-methyltransferase set-2 OS=Caenorhabditis elegans GN=set-2 PE=2 SV=2 183 351 5.0E-08
sp|O14686|KMT2D_HUMAN Histone-lysine N-methyltransferase 2D OS=Homo sapiens GN=KMT2D PE=1 SV=2 191 351 7.0E-07
sp|Q6PDK2|KMT2D_MOUSE Histone-lysine N-methyltransferase 2D OS=Mus musculus GN=Kmt2d PE=1 SV=2 191 351 7.0E-07
sp|Q9ZSM8|EZA1_ARATH Histone-lysine N-methyltransferase EZA1 OS=Arabidopsis thaliana GN=EZA1 PE=1 SV=1 196 336 9.0E-07
sp|P0CB22|ATX2_ARATH Histone-lysine N-methyltransferase ATX2 OS=Arabidopsis thaliana GN=ATX2 PE=2 SV=1 196 348 3.0E-06
sp|Q8S4P5|EZ2_MAIZE Histone-lysine N-methyltransferase EZ2 OS=Zea mays GN=EZ2 PE=2 SV=1 174 322 3.0E-06
sp|Q1L8U8|STB1A_DANRE Histone-lysine N-methyltransferase SETDB1-A OS=Danio rerio GN=setdb1a PE=3 SV=1 147 219 3.0E-06
sp|Q8S4P4|EZ3_MAIZE Histone-lysine N-methyltransferase EZ3 OS=Zea mays GN=EZ3 PE=2 SV=1 174 322 5.0E-06
sp|F4K1J4|ATXR7_ARATH Histone-lysine N-methyltransferase ATXR7 OS=Arabidopsis thaliana GN=ATXR7 PE=2 SV=1 181 319 5.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005634 nucleus Yes
GO:0018024 histone-lysine N-methyltransferase activity Yes
GO:0008270 zinc ion binding Yes
GO:0005515 protein binding Yes
GO:0034968 histone lysine methylation Yes
GO:0016570 histone modification No
GO:0043169 cation binding No
GO:0044267 cellular protein metabolic process No
GO:0008168 methyltransferase activity No
GO:0046872 metal ion binding No
GO:0018205 peptidyl-lysine modification No
GO:0008152 metabolic process No
GO:0005488 binding No
GO:0006807 nitrogen compound metabolic process No
GO:0008276 protein methyltransferase activity No
GO:0071704 organic substance metabolic process No
GO:0008170 N-methyltransferase activity No
GO:0044238 primary metabolic process No
GO:0032259 methylation No
GO:0008150 biological_process No
GO:0044260 cellular macromolecule metabolic process No
GO:0043226 organelle No
GO:0036211 protein modification process No
GO:0016279 protein-lysine N-methyltransferase activity No
GO:0016740 transferase activity No
GO:0003674 molecular_function No
GO:0042054 histone methyltransferase activity No
GO:0016741 transferase activity, transferring one-carbon groups No
GO:0005575 cellular_component No
GO:0043414 macromolecule methylation No
GO:0043227 membrane-bounded organelle No
GO:0009987 cellular process No
GO:1901564 organonitrogen compound metabolic process No
GO:0018193 peptidyl-amino acid modification No
GO:0043167 ion binding No
GO:0018022 peptidyl-lysine methylation No
GO:0044424 intracellular part No
GO:0016569 covalent chromatin modification No
GO:0016043 cellular component organization No
GO:0003824 catalytic activity No
GO:0071840 cellular component organization or biogenesis No
GO:0008757 S-adenosylmethionine-dependent methyltransferase activity No
GO:0016278 lysine N-methyltransferase activity No
GO:0006479 protein methylation No
GO:0016571 histone methylation No
GO:0019538 protein metabolic process No
GO:0008213 protein alkylation No
GO:0044464 cell part No
GO:0043231 intracellular membrane-bounded organelle No
GO:0006325 chromatin organization No
GO:0046914 transition metal ion binding No
GO:0043229 intracellular organelle No
GO:0140096 catalytic activity, acting on a protein No
GO:0043412 macromolecule modification No
GO:0044237 cellular metabolic process No
GO:0043170 macromolecule metabolic process No
GO:0006464 cellular protein modification process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 49 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|9109
MEEAVKRHFFHHGRDEAAHERDGCHWCQLRSFPTHATAPITVVNDVDSEVLPPDFRFINENVLGHGVKPAELSFR
SGCVCADDADCQFKGCLCLADLEDDNDDDGQDVDDDDDDDDDEDSAMGNGYSSSAPPRSRKAYAYHRHGAKAGLL
RSKLHSSKLPLYECHQGCSCTVDCPNRVVERGRTVPLQIFRTEDRGWGVRTQETIKTGQFVDRYVGEVITSAEAD
RRRAAAIVSQRKDVYLFALDKFTDPASLDPRLRGPPLEVDGEFMSGPTRFINHSCGPNLRIFARVGDHADKHLHD
LALFAIRDIQKGEELTFDYVDGVSLEADEREGNAEDMTRCLCGSARCRKFLW*
Coding >Hirsu2|9109
ATGGAGGAGGCAGTCAAAAGACATTTTTTCCACCACGGCAGAGACGAAGCTGCGCACGAGCGGGATGGCTGTCAC
TGGTGCCAGCTGCGCTCGTTCCCGACGCACGCCACTGCGCCCATCACCGTTGTCAACGACGTGGACAGCGAGGTG
CTGCCGCCTGACTTCCGCTTCATCAACGAAAATGTGCTCGGCCATGGCGTGAAGCCGGCCGAGCTGAGCTTCCGC
AGTGGCTGCGTGTGCGCCGACGACGCCGACTGCCAGTTCAAGGGCTGCTTGTGTCTGGCGGATCTTGAGGACGAC
AACGACGACGATGGCCAAGATGTCGATGACGACGACGACGACGACGACGACGAAGACAGTGCCATGGGCAACGGG
TACAGCTCTTCTGCCCCCCCGCGGTCGAGGAAAGCGTACGCCTATCACAGACACGGCGCCAAGGCCGGCTTGCTG
CGATCAAAGCTGCACAGCTCCAAGCTGCCCCTGTACGAGTGCCACCAGGGCTGCTCCTGCACCGTCGACTGTCCG
AACCGCGTGGTCGAGCGCGGCCGCACCGTCCCGCTCCAGATTTTCCGTACGGAGGACCGAGGCTGGGGTGTCCGG
ACGCAGGAGACCATCAAGACGGGCCAGTTTGTCGACCGTTACGTCGGCGAGGTCATCACGTCGGCCGAAGCTGAC
CGCCGGCGCGCGGCGGCCATCGTCTCGCAGCGTAAGGACGTCTATCTCTTTGCCCTCGACAAGTTTACGGATCCG
GCATCGCTCGACCCGCGGCTCCGCGGCCCGCCGCTGGAGGTGGACGGCGAGTTCATGTCGGGGCCGACGCGCTTC
ATCAACCACTCGTGCGGGCCCAACCTCCGCATCTTCGCGCGCGTCGGCGACCACGCCGACAAGCACCTGCACGAC
CTGGCCCTCTTCGCCATCCGGGACATCCAGAAGGGCGAGGAGCTGACGTTCGACTACGTCGACGGCGTCTCGCTC
GAGGCCGACGAGCGCGAGGGCAACGCCGAGGACATGACGCGCTGCCTCTGCGGCAGCGCCAGGTGCAGGAAGTTT
CTGTGGTAG
Transcript >Hirsu2|9109
ATGGAGGAGGCAGTCAAAAGACATTTTTTCCACCACGGCAGAGACGAAGCTGCGCACGAGCGGGATGGCTGTCAC
TGGTGCCAGCTGCGCTCGTTCCCGACGCACGCCACTGCGCCCATCACCGTTGTCAACGACGTGGACAGCGAGGTG
CTGCCGCCTGACTTCCGCTTCATCAACGAAAATGTGCTCGGCCATGGCGTGAAGCCGGCCGAGCTGAGCTTCCGC
AGTGGCTGCGTGTGCGCCGACGACGCCGACTGCCAGTTCAAGGGCTGCTTGTGTCTGGCGGATCTTGAGGACGAC
AACGACGACGATGGCCAAGATGTCGATGACGACGACGACGACGACGACGACGAAGACAGTGCCATGGGCAACGGG
TACAGCTCTTCTGCCCCCCCGCGGTCGAGGAAAGCGTACGCCTATCACAGACACGGCGCCAAGGCCGGCTTGCTG
CGATCAAAGCTGCACAGCTCCAAGCTGCCCCTGTACGAGTGCCACCAGGGCTGCTCCTGCACCGTCGACTGTCCG
AACCGCGTGGTCGAGCGCGGCCGCACCGTCCCGCTCCAGATTTTCCGTACGGAGGACCGAGGCTGGGGTGTCCGG
ACGCAGGAGACCATCAAGACGGGCCAGTTTGTCGACCGTTACGTCGGCGAGGTCATCACGTCGGCCGAAGCTGAC
CGCCGGCGCGCGGCGGCCATCGTCTCGCAGCGTAAGGACGTCTATCTCTTTGCCCTCGACAAGTTTACGGATCCG
GCATCGCTCGACCCGCGGCTCCGCGGCCCGCCGCTGGAGGTGGACGGCGAGTTCATGTCGGGGCCGACGCGCTTC
ATCAACCACTCGTGCGGGCCCAACCTCCGCATCTTCGCGCGCGTCGGCGACCACGCCGACAAGCACCTGCACGAC
CTGGCCCTCTTCGCCATCCGGGACATCCAGAAGGGCGAGGAGCTGACGTTCGACTACGTCGACGGCGTCTCGCTC
GAGGCCGACGAGCGCGAGGGCAACGCCGAGGACATGACGCGCTGCCTCTGCGGCAGCGCCAGGTGCAGGAAGTTT
CTGTGGTAG
Gene >Hirsu2|9109
ATGGAGGAGGCAGTCAAAAGACATTTTTTCCACCACGGCAGAGACGTATTCCCCCCCCTCTTCATCTCCAATGAG
GGTCGCATGCTGACCGTCTTGGCTCTGCAGGAAGCTGCGCACGAGCGGGATGGCTGTCACTGGTGCCAGCTGCGC
TCGTTCCCGACGCACGCCACTGCGCCCATCACCGTTGTCAACGACGTGGACAGCGAGGTGCTGCCGCCTGACTTC
CGCTTCATCAACGAAAATGTGCTCGGCCATGGCGTGAAGCCGGCCGAGCTGAGCTTCCGCAGTGGCTGCGTGTGC
GCCGACGACGCCGACTGCCAGTTCAAGGGCTGCTTGTGTCTGGCGGATCTTGAGGACGACAACGACGACGATGGC
CAAGATGTCGATGACGACGACGACGACGACGACGACGAAGACAGTGCCATGGGCAACGGGTACAGCTCTTCTGCC
CCCCCGCGGTCGAGGAAAGCGTACGCCTATCACAGACACGGCGCCAAGGCCGGCTTGCTGCGATCAAAGCTGCAC
AGCTCCAAGCTGCCCCTGTACGAGTGCCACCAGGGCTGCTCCTGCACCGTCGACTGTCCGAACCGCGTGGTCGAG
CGCGGCCGCACCGTCCCGCTCCAGATTTTCCGTACGGAGGACCGAGGCTGGGGTCCGTGTCCCCCGTTCCGCTTG
CGCCGGCGTGGCTGACGCGGTCGCAGGTGTCCGGACGCAGGAGACCATCAAGACGGGCCAGTTTGTCGACCGTTA
CGTCGGCGAGGTCATCACGTCGGCCGAAGCTGACCGCCGGCGCGCGGCGGCCATCGTCTCGCAGCGTAAGGACGT
CTATCTCTTTGCCCTCGACAAGTTTACGGATCCGGCATCGCTCGACCCGCGGCTCCGCGGCCCGCCGCTGGAGGT
GGACGGCGAGTTCATGTCGGGGCCGACGCGCTTCATCAACCACTCGTGCGGGCCCAACCTCCGCATCTTCGCGCG
CGTCGGCGACCACGCCGACAAGCACCTGCACGACCTGGCCCTCTTCGCCATCCGGGACATCCAGAAGGGCGAGGA
GCTGACGTTCGACTACGTCGACGGCGTCTCGCTCGAGGCCGACGAGCGCGAGGGCAACGCCGAGGACATGACGCG
CTGCCTCTGCGGCAGCGCCAGGTGCAGGAAGTTTCTGTGGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail