Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|9103
Gene name
LocationContig_64:9439..12062
Strand+
Gene length (bp)2623
Transcript length (bp)2454
Coding sequence length (bp)2454
Protein length (aa) 818

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12569 NatA_aux_su N-terminal acetyltransferase A, auxiliary subunit 2.1E-191 184 683
PF13432 TPR_16 Tetratricopeptide repeat 2.1E-03 84 121
PF13432 TPR_16 Tetratricopeptide repeat 1.3E-02 226 259
PF14559 TPR_19 Tetratricopeptide repeat 7.3E-06 381 442
PF13414 TPR_11 TPR repeat 2.0E-06 84 123
PF13181 TPR_8 Tetratricopeptide repeat 1.0E-03 80 109

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O74985|NAT1_SCHPO N-terminal acetyltransferase A complex subunit nat1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=nat1 PE=1 SV=1 5 683 2.0E-157
sp|Q9DBB4|NAA16_MOUSE N-alpha-acetyltransferase 16, NatA auxiliary subunit OS=Mus musculus GN=Naa16 PE=2 SV=1 1 771 3.0E-157
sp|Q6N069|NAA16_HUMAN N-alpha-acetyltransferase 16, NatA auxiliary subunit OS=Homo sapiens GN=NAA16 PE=1 SV=2 1 771 1.0E-156
sp|Q9BXJ9|NAA15_HUMAN N-alpha-acetyltransferase 15, NatA auxiliary subunit OS=Homo sapiens GN=NAA15 PE=1 SV=1 5 752 7.0E-156
sp|Q5R4J9|NAA15_PONAB N-alpha-acetyltransferase 15, NatA auxiliary subunit OS=Pongo abelii GN=NAA15 PE=2 SV=1 5 752 9.0E-155
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O74985|NAT1_SCHPO N-terminal acetyltransferase A complex subunit nat1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=nat1 PE=1 SV=1 5 683 2.0E-157
sp|Q9DBB4|NAA16_MOUSE N-alpha-acetyltransferase 16, NatA auxiliary subunit OS=Mus musculus GN=Naa16 PE=2 SV=1 1 771 3.0E-157
sp|Q6N069|NAA16_HUMAN N-alpha-acetyltransferase 16, NatA auxiliary subunit OS=Homo sapiens GN=NAA16 PE=1 SV=2 1 771 1.0E-156
sp|Q9BXJ9|NAA15_HUMAN N-alpha-acetyltransferase 15, NatA auxiliary subunit OS=Homo sapiens GN=NAA15 PE=1 SV=1 5 752 7.0E-156
sp|Q5R4J9|NAA15_PONAB N-alpha-acetyltransferase 15, NatA auxiliary subunit OS=Pongo abelii GN=NAA15 PE=2 SV=1 5 752 9.0E-155
sp|Q80UM3|NAA15_MOUSE N-alpha-acetyltransferase 15, NatA auxiliary subunit OS=Mus musculus GN=Naa15 PE=1 SV=1 5 808 2.0E-153
sp|P12945|NAT1_YEAST N-terminal acetyltransferase A complex subunit NAT1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NAT1 PE=1 SV=2 2 645 1.0E-93
sp|Q9Y7X2|YOP2_SCHPO N-terminal acetyltransferase A complex subunit-like protein C418.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC418.02 PE=3 SV=1 5 649 1.0E-53
sp|O06917|Y263_METJA TPR repeat-containing protein MJ0263 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ0263 PE=3 SV=1 2 218 1.0E-08
[Show less]

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0003674 molecular_function No
GO:0005488 binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 15 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|9103
MPQPLAPKEAAHFRAVIRSYEDKQYKRGLKTADLILKKHPKHGDTMAMKALILNSQAKTDEAFALAKEALTVDMK
SHICWHVYGLLYRANKNFEEAIKAYKFALKLEPESPQIQRDLAILQVQMRDYQGYIQSRTAMLQARPQLRQSWTA
LAIAHHLAGNLSEAENVLTTYEGTLKATPSRNDIEHSEAVMYKNSLIAEQGDYQRALDHLDSAAKHNLDRLAVME
ARADSLCKLGRKEESAKAYRALLDRNSEHPAYYEKLMSVLDIPEDDCKARKAIYDEYVRKSPRSDAARRLPLDFL
QGDDFTQAAREYMALMLNKGVPSTFANLKHLYADSGKKESLRRLAEEYLQSQSTDSSSKDKGEAAALYYLAQHYN
HHLCRDLDQAMRLVDRAIEKDPKSVDFHMTKARILKHAGNLQRASEMMDHARTLDLKDRYINSKAAKYQLRNNET
EKALKTVGMFTRAETVGGPLADLLDMQCVWYLTEDGEAYARQGNIGLALKRFHAIGNIFDVWQEDQFDFHSFSLR
KGQVRAYMGMMRWEDHVRDHPFYARAALDAIDVYVKMADRPSANGVNGAEELDGADALAKKKALKKAKKEQQRLE
REAAEKQAKQDPNKSGPDSEAKKDDDALGLKLAATTDPLGEATKFLTPLLQARPRSVEAQSAGFEVYMRRKKYVL
ALRCLNAALALDPDFPKAVEQVVGFQTMLDGASDLDAKVREVLTAEFRAAGEAGGVRKYVEEWQNRHKGSVRHAA
SALGARRLMGEDKVKCEKEAAGLLDAAGATSADAVWLLETLRGWRSSEAAAFKKAAQAKWPEVTRLA*
Coding >Hirsu2|9103
ATGCCGCAACCGCTGGCGCCCAAAGAGGCGGCGCACTTCAGGGCCGTCATCCGCAGCTACGAGGACAAGCAATAC
AAACGCGGCCTGAAGACGGCCGACCTCATCCTGAAGAAACACCCCAAACATGGAGACACAATGGCCATGAAGGCC
CTCATCCTCAACAGTCAAGCCAAGACGGACGAAGCTTTTGCCCTGGCCAAGGAGGCCCTGACGGTCGACATGAAG
TCGCACATCTGCTGGCACGTCTACGGGCTGCTGTACCGGGCCAACAAAAACTTCGAGGAGGCCATCAAGGCCTAC
AAGTTCGCGCTCAAGCTCGAGCCCGAGTCGCCGCAGATCCAACGAGACCTGGCCATTCTCCAGGTCCAAATGCGC
GATTATCAAGGATACATCCAGAGCCGCACCGCCATGCTCCAGGCGCGACCGCAGCTGCGTCAAAGCTGGACGGCC
CTCGCAATCGCGCACCACCTTGCCGGCAACCTGTCCGAGGCGGAAAATGTCCTCACCACGTACGAAGGGACGTTG
AAGGCGACCCCCTCGCGCAACGACATTGAGCACTCGGAGGCGGTCATGTACAAGAACTCTTTGATCGCCGAGCAG
GGCGACTACCAGCGAGCTCTGGACCACCTAGACAGCGCCGCCAAGCACAACCTGGACCGGCTGGCCGTCATGGAA
GCGCGAGCCGACTCTCTCTGCAAGCTGGGACGGAAAGAAGAGTCGGCCAAGGCATACAGGGCTCTGCTCGACCGC
AACTCGGAGCACCCTGCGTATTACGAGAAGCTCATGTCGGTGCTGGACATTCCGGAAGACGACTGCAAGGCGCGC
AAGGCCATCTACGACGAGTACGTGCGCAAGTCTCCGCGCTCCGACGCCGCCAGGCGCCTGCCCCTCGACTTTCTC
CAAGGCGACGATTTCACGCAGGCCGCCAGGGAGTACATGGCCCTCATGCTGAACAAGGGCGTGCCTTCGACATTT
GCCAATCTGAAGCACCTGTACGCCGACTCGGGCAAGAAGGAGTCTTTGAGACGGCTGGCCGAGGAGTACCTGCAG
TCACAGTCTACCGACTCGTCGAGCAAGGACAAGGGCGAGGCGGCGGCCCTGTATTACCTCGCACAACACTACAAC
CACCACCTCTGTCGGGATCTCGATCAAGCGATGCGGCTCGTCGATCGGGCGATCGAGAAGGATCCGAAGAGCGTC
GACTTTCACATGACCAAGGCCAGAATACTGAAACACGCAGGCAACCTCCAAAGGGCATCCGAGATGATGGACCAC
GCTCGGACACTGGATCTCAAGGACCGGTACATCAACAGCAAGGCGGCCAAGTACCAGCTGCGCAACAACGAAACC
GAAAAGGCGCTCAAGACGGTCGGCATGTTCACGCGGGCCGAGACGGTGGGGGGCCCGCTCGCGGACCTCCTGGAC
ATGCAGTGCGTCTGGTACCTGACGGAAGACGGCGAGGCGTACGCCAGGCAGGGAAACATTGGCCTGGCACTGAAG
CGCTTCCACGCCATCGGCAACATCTTTGACGTCTGGCAGGAGGACCAGTTCGACTTCCACAGCTTCTCGCTGAGA
AAGGGCCAGGTGCGGGCGTACATGGGCATGATGCGATGGGAGGACCACGTGCGCGACCACCCCTTCTACGCGAGG
GCGGCGCTGGATGCCATCGACGTGTACGTCAAGATGGCCGACAGGCCGTCGGCGAACGGGGTGAACGGGGCGGAG
GAGCTGGACGGCGCGGACGCGCTGGCCAAGAAGAAGGCGCTCAAGAAGGCCAAGAAGGAGCAGCAGCGACTGGAG
CGCGAGGCGGCGGAGAAGCAGGCGAAGCAGGACCCCAACAAGAGCGGGCCGGACAGCGAGGCGAAGAAGGACGAC
GACGCGCTGGGCCTGAAGCTGGCGGCGACGACGGACCCGCTGGGCGAGGCGACCAAGTTCCTCACGCCCCTGCTG
CAGGCGCGTCCGAGGAGCGTCGAGGCGCAAAGCGCGGGGTTCGAGGTCTACATGCGGCGCAAGAAGTACGTGCTG
GCGCTGCGCTGCCTGAACGCCGCGCTGGCGCTGGACCCCGACTTCCCCAAGGCGGTGGAGCAGGTGGTGGGTTTC
CAGACGATGCTGGACGGCGCATCGGACCTGGACGCCAAGGTGCGCGAGGTGCTCACGGCCGAGTTCAGGGCAGCG
GGCGAGGCGGGGGGCGTACGGAAGTACGTCGAGGAGTGGCAGAACAGGCACAAGGGCAGCGTGCGGCACGCGGCC
TCGGCCCTGGGCGCGCGGAGGCTGATGGGCGAGGACAAGGTCAAGTGCGAGAAGGAGGCGGCGGGCCTGTTGGAT
GCGGCGGGCGCCACGTCGGCCGACGCCGTCTGGTTGCTGGAGACGCTGCGAGGCTGGAGAAGCTCCGAGGCGGCG
GCGTTCAAGAAGGCGGCACAGGCCAAGTGGCCGGAGGTGACGAGACTGGCCTGA
Transcript >Hirsu2|9103
ATGCCGCAACCGCTGGCGCCCAAAGAGGCGGCGCACTTCAGGGCCGTCATCCGCAGCTACGAGGACAAGCAATAC
AAACGCGGCCTGAAGACGGCCGACCTCATCCTGAAGAAACACCCCAAACATGGAGACACAATGGCCATGAAGGCC
CTCATCCTCAACAGTCAAGCCAAGACGGACGAAGCTTTTGCCCTGGCCAAGGAGGCCCTGACGGTCGACATGAAG
TCGCACATCTGCTGGCACGTCTACGGGCTGCTGTACCGGGCCAACAAAAACTTCGAGGAGGCCATCAAGGCCTAC
AAGTTCGCGCTCAAGCTCGAGCCCGAGTCGCCGCAGATCCAACGAGACCTGGCCATTCTCCAGGTCCAAATGCGC
GATTATCAAGGATACATCCAGAGCCGCACCGCCATGCTCCAGGCGCGACCGCAGCTGCGTCAAAGCTGGACGGCC
CTCGCAATCGCGCACCACCTTGCCGGCAACCTGTCCGAGGCGGAAAATGTCCTCACCACGTACGAAGGGACGTTG
AAGGCGACCCCCTCGCGCAACGACATTGAGCACTCGGAGGCGGTCATGTACAAGAACTCTTTGATCGCCGAGCAG
GGCGACTACCAGCGAGCTCTGGACCACCTAGACAGCGCCGCCAAGCACAACCTGGACCGGCTGGCCGTCATGGAA
GCGCGAGCCGACTCTCTCTGCAAGCTGGGACGGAAAGAAGAGTCGGCCAAGGCATACAGGGCTCTGCTCGACCGC
AACTCGGAGCACCCTGCGTATTACGAGAAGCTCATGTCGGTGCTGGACATTCCGGAAGACGACTGCAAGGCGCGC
AAGGCCATCTACGACGAGTACGTGCGCAAGTCTCCGCGCTCCGACGCCGCCAGGCGCCTGCCCCTCGACTTTCTC
CAAGGCGACGATTTCACGCAGGCCGCCAGGGAGTACATGGCCCTCATGCTGAACAAGGGCGTGCCTTCGACATTT
GCCAATCTGAAGCACCTGTACGCCGACTCGGGCAAGAAGGAGTCTTTGAGACGGCTGGCCGAGGAGTACCTGCAG
TCACAGTCTACCGACTCGTCGAGCAAGGACAAGGGCGAGGCGGCGGCCCTGTATTACCTCGCACAACACTACAAC
CACCACCTCTGTCGGGATCTCGATCAAGCGATGCGGCTCGTCGATCGGGCGATCGAGAAGGATCCGAAGAGCGTC
GACTTTCACATGACCAAGGCCAGAATACTGAAACACGCAGGCAACCTCCAAAGGGCATCCGAGATGATGGACCAC
GCTCGGACACTGGATCTCAAGGACCGGTACATCAACAGCAAGGCGGCCAAGTACCAGCTGCGCAACAACGAAACC
GAAAAGGCGCTCAAGACGGTCGGCATGTTCACGCGGGCCGAGACGGTGGGGGGCCCGCTCGCGGACCTCCTGGAC
ATGCAGTGCGTCTGGTACCTGACGGAAGACGGCGAGGCGTACGCCAGGCAGGGAAACATTGGCCTGGCACTGAAG
CGCTTCCACGCCATCGGCAACATCTTTGACGTCTGGCAGGAGGACCAGTTCGACTTCCACAGCTTCTCGCTGAGA
AAGGGCCAGGTGCGGGCGTACATGGGCATGATGCGATGGGAGGACCACGTGCGCGACCACCCCTTCTACGCGAGG
GCGGCGCTGGATGCCATCGACGTGTACGTCAAGATGGCCGACAGGCCGTCGGCGAACGGGGTGAACGGGGCGGAG
GAGCTGGACGGCGCGGACGCGCTGGCCAAGAAGAAGGCGCTCAAGAAGGCCAAGAAGGAGCAGCAGCGACTGGAG
CGCGAGGCGGCGGAGAAGCAGGCGAAGCAGGACCCCAACAAGAGCGGGCCGGACAGCGAGGCGAAGAAGGACGAC
GACGCGCTGGGCCTGAAGCTGGCGGCGACGACGGACCCGCTGGGCGAGGCGACCAAGTTCCTCACGCCCCTGCTG
CAGGCGCGTCCGAGGAGCGTCGAGGCGCAAAGCGCGGGGTTCGAGGTCTACATGCGGCGCAAGAAGTACGTGCTG
GCGCTGCGCTGCCTGAACGCCGCGCTGGCGCTGGACCCCGACTTCCCCAAGGCGGTGGAGCAGGTGGTGGGTTTC
CAGACGATGCTGGACGGCGCATCGGACCTGGACGCCAAGGTGCGCGAGGTGCTCACGGCCGAGTTCAGGGCAGCG
GGCGAGGCGGGGGGCGTACGGAAGTACGTCGAGGAGTGGCAGAACAGGCACAAGGGCAGCGTGCGGCACGCGGCC
TCGGCCCTGGGCGCGCGGAGGCTGATGGGCGAGGACAAGGTCAAGTGCGAGAAGGAGGCGGCGGGCCTGTTGGAT
GCGGCGGGCGCCACGTCGGCCGACGCCGTCTGGTTGCTGGAGACGCTGCGAGGCTGGAGAAGCTCCGAGGCGGCG
GCGTTCAAGAAGGCGGCACAGGCCAAGTGGCCGGAGGTGACGAGACTGGCCTGA
Gene >Hirsu2|9103
ATGCCGCAACCGCTGGCGCCCAAAGAGGCGGCGCACTTCAGGGCCGTCATCCGCAGCTACGAGGACAAGCAATAC
AAACGCGGCCTGAAGACGGCCGACCTCATCCTGAAGAAACACCCCAAACATGGAGACACAATGGCCATGAAGGCC
CTCATCCTCAACAGTCAAGCCAAGACGGACGAAGCTTTTGCCCTGGCCAAGGAGGCCCTGACGGTCGACATGAAG
TCGCACATCTGCTGGCACGTCTACGGGCTGCTGTACCGGGCCAACAAAAACTTCGAGGAGGCCATCAAGGCCTAC
AAGTTCGCGCTCAAGCTCGAGCCCGAGTCGCCGCAGATCCAACGAGACCTGGCCATTCTCCAGGTCCAAATGCGC
GATTATCAAGGATACATCCAGAGCCGCACCGCCATGCTCCAGGCGCGACCGCAGCTGCGTCAAAGCTGGACGGCC
CTCGCAATCGCGCACCACCTTGCCGGCAACCTGTCCGAGGCGGAAAATGTCCTCACCACGTACGAAGGGACGTTG
AAGGCGACCCCCTCGCGCAACGACATTGAGCACTCGGAGGCGGTCATGTACAAGAACTCTTTGATCGCCGAGCAG
GGCGACTACCAGCGAGCTCTGGACCACCTAGACAGCGCCGCCAAGCACAACCTGGACCGGCTGGCCGTCATGGAA
GCGCGAGCCGACTCTCTCTGCAAGCTGGGACGGAAAGAAGAGTCGGCCAAGGCATACAGGGCTCTGCTCGACCGC
AACTCGGAGCACCCTGCGTATTACGAGAAGCTCATGTCGGTGCTGGACATTCCGGAAGACGACTGCAAGGCGCGC
AAGGCCATCTACGACGAGTACGTGCGCAAGTCTCCGCGCTCCGACGCCGCCAGGCGCCTGCCCCTCGACTTTCTC
CAAGGTAAGAGCCGAGAGACGGCGTGTGTTCCCCCGATTCCTGTGGGGGGAGAAACGGCGGACGCTGGCTAAAGC
GTCGCATCTGAGCTCGCAGGCGACGATTTCACGCAGGCCGCCAGGGAGTACATGGCCCTCATGCTGAACAAGGGC
GTGCCTTCGACATTTGCCAATCTGAAGCACCTGTACGCCGACTCGGGCAAGAAGGAGTCTTTGAGACGGCTGGCC
GAGGAGTACCTGCAGTCACAGTCTACCGACTCGTCGAGCAAGGACAAGGGCGAGGCGGCGGCCCTGTATTACCTC
GCACAACACTACAACCACCACCTCTGTCGGGATCTCGATCAAGCGATGCGGCTCGTCGATCGGGCGATCGAGAAG
GATCCGAAGAGCGTCGACTTTCACATGACCAAGGCCAGAATACTGAAACACGCAGGCAACCTCCAAAGGGCATCC
GAGATGATGGACCACGCTCGGACACTGGATCTCAAGGACCGGTACATCAACAGCAAGGCGGCCAAGTACCAGCTG
CGCAACAACGAAACCGAAAAGGCGCTCAAGACGGTCGGCATGTTCACGCGGGCCGAGACGGTGGGGGGCCCGCTC
GCGGACCTCCTGGACATGCAGTGCGTCTGGTACCTGACGGAAGACGGCGAGGCGTACGCCAGGCAGGGAAACATT
GGCCTGGCACTGAAGCGCTTCCACGCCATCGGCAACATCTTTGACGTCTGGCAGGAGGACCAGTTCGACTTCCAC
AGCTTCTCGCTGAGAAAGGGCCAGGTGCGGGCGTACATGGGCATGATGCGATGGGAGGACCACGTGCGCGACCAC
CCCTTCTACGCGAGGGCGGCGCTGGATGCCATCGACGTGTACGTCAAGATGGCCGACAGGCCGTCGGCGAACGGG
GTGAACGGGGCGGAGGAGCTGGACGGCGCGGACGCGCTGGCCAAGAAGAAGGCGCTCAAGAAGGCCAAGAAGGAG
CAGCAGCGACTGGAGCGCGAGGCGGCGGAGAAGCAGGCGAAGCAGGACCCCAACAAGAGCGGGCCGGACAGCGAG
GCGAAGAAGGACGACGACGCGCTGGGCCTGAAGCTGGCGGCGACGACGGACCCGCTGGGCGAGGCGACCAAGTTC
CTCACGCCCCTGCTGCAGGCGCGTCCGAGGAGCGTCGAGGCGCAAAGCGCGGGGTTCGAGGTCTACATGCGGCGC
AGTAAGTACCGATCGAGGGCCGTGTGTGCCCGGAGACGACGACGAAGGTGGCAGACGAGGCTAATGGCGACGGCG
TACAGAGAAGTACGTGCTGGCGCTGCGCTGCCTGAACGCCGCGCTGGCGCTGGACCCCGACTTCCCCAAGGCGGT
GGAGCAGGTGGTGGGTTTCCAGACGATGCTGGACGGCGCATCGGACCTGGACGCCAAGGTGCGCGAGGTGCTCAC
GGCCGAGTTCAGGGCAGCGGGCGAGGCGGGGGGCGTACGGAAGTACGTCGAGGAGTGGCAGAACAGGCACAAGGG
CAGCGTGCGGCACGCGGCCTCGGCCCTGGGCGCGCGGAGGCTGATGGGCGAGGACAAGGTCAAGTGCGAGAAGGA
GGCGGCGGGCCTGTTGGATGCGGCGGGCGCCACGTCGGCCGACGCCGTCTGGTTGCTGGAGACGCTGCGAGGCTG
GAGAAGCTCCGAGGCGGCGGCGTTCAAGAAGGCGGCACAGGCCAAGTGGCCGGAGGTGACGAGACTGGCCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail