Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|9098
Gene name
LocationContig_64:1225..2629
Strand-
Gene length (bp)1404
Transcript length (bp)1404
Coding sequence length (bp)1404
Protein length (aa) 468

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08740 BCS1_N BCS1 N terminal 1.8E-39 31 209
PF00004 AAA ATPase family associated with various cellular activities (AAA) 2.0E-15 245 369

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P32839|BCS1_YEAST Mitochondrial chaperone BCS1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=BCS1 PE=1 SV=2 14 447 2.0E-118
sp|Q9P6Q3|BCS1_SCHPO Probable mitochondrial chaperone bcs1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC644.07 PE=2 SV=1 16 447 2.0E-109
sp|Q5E9H5|BCS1_BOVIN Mitochondrial chaperone BCS1 OS=Bos taurus GN=BCS1L PE=2 SV=1 15 447 2.0E-108
sp|Q9Y276|BCS1_HUMAN Mitochondrial chaperone BCS1 OS=Homo sapiens GN=BCS1L PE=1 SV=1 15 447 1.0E-104
sp|Q7ZTL7|BCS1_XENLA Mitochondrial chaperone BCS1 OS=Xenopus laevis GN=bcs1l PE=2 SV=1 15 441 6.0E-103
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P32839|BCS1_YEAST Mitochondrial chaperone BCS1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=BCS1 PE=1 SV=2 14 447 2.0E-118
sp|Q9P6Q3|BCS1_SCHPO Probable mitochondrial chaperone bcs1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC644.07 PE=2 SV=1 16 447 2.0E-109
sp|Q5E9H5|BCS1_BOVIN Mitochondrial chaperone BCS1 OS=Bos taurus GN=BCS1L PE=2 SV=1 15 447 2.0E-108
sp|Q9Y276|BCS1_HUMAN Mitochondrial chaperone BCS1 OS=Homo sapiens GN=BCS1L PE=1 SV=1 15 447 1.0E-104
sp|Q7ZTL7|BCS1_XENLA Mitochondrial chaperone BCS1 OS=Xenopus laevis GN=bcs1l PE=2 SV=1 15 441 6.0E-103
sp|Q9CZP5|BCS1_MOUSE Mitochondrial chaperone BCS1 OS=Mus musculus GN=Bcs1l PE=1 SV=1 7 441 4.0E-102
sp|Q7ZV60|BCS1_DANRE Mitochondrial chaperone BCS1 OS=Danio rerio GN=bcs1l PE=2 SV=2 13 441 2.0E-101
sp|Q54DY9|BCS1B_DICDI Probable mitochondrial chaperone BCS1-B OS=Dictyostelium discoideum GN=bcsl1b PE=3 SV=1 13 450 8.0E-96
sp|Q54HY8|BCS1A_DICDI Probable mitochondrial chaperone BCS1-A OS=Dictyostelium discoideum GN=bcs1la PE=3 SV=1 22 453 6.0E-72
sp|Q147F9|AATPC_ARATH AAA-ATPase At3g50940 OS=Arabidopsis thaliana GN=At3g50940 PE=2 SV=1 168 372 5.0E-32
sp|F4IQG2|AATP2_ARATH AAA-ATPase At2g18190 OS=Arabidopsis thaliana GN=At2g18190 PE=2 SV=1 208 372 9.0E-32
sp|F4KFX5|AATPJ_ARATH AAA-ATPase At5g40000 OS=Arabidopsis thaliana GN=At5g40000 PE=3 SV=1 208 390 1.0E-31
sp|Q8RY66|AATPD_ARATH AAA-ATPase At4g25835 OS=Arabidopsis thaliana GN=At4g25835 PE=2 SV=1 189 384 1.0E-31
sp|Q9FN75|AATPI_ARATH AAA-ATPase At5g17760 OS=Arabidopsis thaliana GN=At5g17760 PE=2 SV=1 208 404 3.0E-31
sp|F4J0C0|AATPA_ARATH AAA-ATPase At3g28600 OS=Arabidopsis thaliana GN=At3g28600 PE=2 SV=1 208 388 1.0E-30
sp|Q9FN78|AATPF_ARATH AAA-ATPase At5g17730 OS=Arabidopsis thaliana GN=At5g17730 PE=3 SV=1 183 372 5.0E-30
sp|Q8GW96|AATP3_ARATH AAA-ATPase At2g18193 OS=Arabidopsis thaliana GN=At2g18193 PE=2 SV=1 208 372 1.0E-29
sp|Q9LJJ5|AATPB_ARATH AAA-ATPase At3g28610 OS=Arabidopsis thaliana GN=At3g28610 PE=2 SV=1 208 388 2.0E-29
sp|Q8VZG2|HSR4_ARATH Protein HYPER-SENSITIVITY-RELATED 4 OS=Arabidopsis thaliana GN=HSR4 PE=2 SV=1 206 372 5.0E-29
sp|F4J0B7|AATP8_ARATH AAA-ATPase At3g28570, mitochondrial OS=Arabidopsis thaliana GN=At3g28570 PE=3 SV=1 208 388 2.0E-27
sp|Q9FKM3|AATPK_ARATH AAA-ATPase At5g57480 OS=Arabidopsis thaliana GN=At5g57480 PE=3 SV=1 165 366 3.0E-27
sp|F4JPK8|AATPE_ARATH AAA-ATPase At4g30250 OS=Arabidopsis thaliana GN=At4g30250 PE=3 SV=1 185 384 2.0E-26
sp|Q9FN77|AATPG_ARATH AAA-ATPase At5g17740 OS=Arabidopsis thaliana GN=At5g17740 PE=3 SV=1 161 375 4.0E-26
sp|F4KID5|AATPH_ARATH AAA-ATPase At5g17750 OS=Arabidopsis thaliana GN=At5g17750 PE=3 SV=1 215 404 2.0E-25
sp|Q9LJJ7|AATP9_ARATH AAA-ATPase At3g28580 OS=Arabidopsis thaliana GN=At3g28580 PE=2 SV=1 208 401 4.0E-25
sp|Q9LP11|AATP1_ARATH AAA-ATPase At1g43910 OS=Arabidopsis thaliana GN=At1g43910 PE=1 SV=1 208 374 2.0E-24
sp|Q9LH83|AATP6_ARATH AAA-ATPase At3g28520 OS=Arabidopsis thaliana GN=At3g28520 PE=3 SV=1 211 402 3.0E-24
sp|Q9FLD5|ASD_ARATH AAA-ATPase ASD, mitochondrial OS=Arabidopsis thaliana GN=AATP1 PE=1 SV=1 206 369 1.0E-23
sp|Q9LH84|AATP5_ARATH AAA-ATPase At3g28510 OS=Arabidopsis thaliana GN=At3g28510 PE=2 SV=1 208 388 1.0E-23
sp|Q9LH82|AATP7_ARATH AAA-ATPase At3g28540 OS=Arabidopsis thaliana GN=At3g28540 PE=2 SV=1 208 388 5.0E-23
sp|F4IJ77|AATP4_ARATH AAA-ATPase At2g46620 OS=Arabidopsis thaliana GN=At2g46620 PE=2 SV=1 208 366 2.0E-21
sp|Q5UR45|YL572_MIMIV Putative AAA family ATPase L572 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L572 PE=3 SV=1 281 385 7.0E-17
sp|O34703|YJOB_BACSU Uncharacterized ATPase YjoB OS=Bacillus subtilis (strain 168) GN=yjoB PE=1 SV=1 208 379 6.0E-14
sp|Q67JH0|FTSH3_SYMTH ATP-dependent zinc metalloprotease FtsH 3 OS=Symbiobacterium thermophilum (strain T / IAM 14863) GN=ftsH3 PE=3 SV=1 199 368 2.0E-13
sp|B0K657|FTSH2_THEPX ATP-dependent zinc metalloprotease FtsH 2 OS=Thermoanaerobacter sp. (strain X514) GN=ftsH2 PE=3 SV=1 211 369 9.0E-13
sp|D3FA80|FTSH2_CONWI ATP-dependent zinc metalloprotease FtsH 2 OS=Conexibacter woesei (strain DSM 14684 / JCM 11494 / NBRC 100937 / ID131577) GN=ftsH2 PE=3 SV=1 214 368 7.0E-12
sp|Q7UUZ7|FTSH1_RHOBA ATP-dependent zinc metalloprotease FtsH 1 OS=Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1) GN=ftsH1 PE=3 SV=1 213 372 1.0E-11
sp|Q5UPR4|YR776_MIMIV Uncharacterized protein R776 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R776 PE=4 SV=1 172 333 2.0E-11
sp|P48601|PRS4_DROME 26S protease regulatory subunit 4 OS=Drosophila melanogaster GN=Rpt2 PE=1 SV=2 213 363 2.0E-11
sp|Q90732|PRS4_CHICK 26S protease regulatory subunit 4 OS=Gallus gallus GN=PSMC1 PE=2 SV=1 211 363 3.0E-11
sp|C7N1I1|FTSH_SLAHD ATP-dependent zinc metalloprotease FtsH OS=Slackia heliotrinireducens (strain ATCC 29202 / DSM 20476 / NCTC 11029 / RHS 1) GN=ftsH PE=3 SV=1 212 368 3.0E-11
sp|P62193|PRS4_RAT 26S protease regulatory subunit 4 OS=Rattus norvegicus GN=Psmc1 PE=2 SV=1 211 363 4.0E-11
sp|P62192|PRS4_MOUSE 26S protease regulatory subunit 4 OS=Mus musculus GN=Psmc1 PE=1 SV=1 211 363 4.0E-11
sp|P62191|PRS4_HUMAN 26S protease regulatory subunit 4 OS=Homo sapiens GN=PSMC1 PE=1 SV=1 211 363 4.0E-11
sp|A6TWP7|FTSH2_ALKMQ ATP-dependent zinc metalloprotease FtsH 2 OS=Alkaliphilus metalliredigens (strain QYMF) GN=ftsH2 PE=3 SV=1 220 399 4.0E-11
sp|D5H7Z5|FTSH1_SALRM ATP-dependent zinc metalloprotease FtsH 1 OS=Salinibacter ruber (strain M8) GN=ftsH1 PE=3 SV=1 220 400 5.0E-11
sp|Q3A579|FTSH_PELCD ATP-dependent zinc metalloprotease FtsH OS=Pelobacter carbinolicus (strain DSM 2380 / Gra Bd 1) GN=ftsH PE=3 SV=1 211 368 7.0E-11
sp|P33297|PRS6A_YEAST 26S protease regulatory subunit 6A OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPT5 PE=1 SV=3 211 395 8.0E-11
sp|A0PXM8|FTSH_CLONN ATP-dependent zinc metalloprotease FtsH OS=Clostridium novyi (strain NT) GN=ftsH PE=3 SV=1 220 399 8.0E-11
sp|Q7URM7|FTSH2_RHOBA ATP-dependent zinc metalloprotease FtsH 2 OS=Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1) GN=ftsH2 PE=3 SV=1 214 368 8.0E-11
sp|Q9C5U3|PRS8A_ARATH 26S protease regulatory subunit 8 homolog A OS=Arabidopsis thaliana GN=RPT6A PE=1 SV=1 211 382 1.0E-10
sp|Q94BQ2|PRS8B_ARATH 26S protease regulatory subunit 8 homolog B OS=Arabidopsis thaliana GN=RPT6B PE=1 SV=1 211 382 1.0E-10
sp|D1C2C6|FTSH2_SPHTD ATP-dependent zinc metalloprotease FtsH 2 OS=Sphaerobacter thermophilus (strain DSM 20745 / S 6022) GN=ftsH2 PE=3 SV=1 213 366 1.0E-10
sp|A1AT11|FTSH_PELPD ATP-dependent zinc metalloprotease FtsH OS=Pelobacter propionicus (strain DSM 2379) GN=ftsH PE=3 SV=1 220 368 1.0E-10
sp|O16368|PRS4_CAEEL Probable 26S protease regulatory subunit 4 OS=Caenorhabditis elegans GN=rpt-2 PE=3 SV=1 211 363 1.0E-10
sp|O18413|PRS8_DROME 26S protease regulatory subunit 8 OS=Drosophila melanogaster GN=Rpt6 PE=1 SV=2 211 363 1.0E-10
sp|P54814|PRS8_MANSE 26S protease regulatory subunit 8 OS=Manduca sexta PE=2 SV=1 211 363 2.0E-10
sp|Q920A7|AFG31_MOUSE AFG3-like protein 1 OS=Mus musculus GN=Afg3l1 PE=1 SV=2 220 369 2.0E-10
sp|Q4A5F0|FTSH_MYCS5 ATP-dependent zinc metalloprotease FtsH OS=Mycoplasma synoviae (strain 53) GN=ftsH PE=3 SV=2 214 369 2.0E-10
sp|D3F124|FTSH1_CONWI ATP-dependent zinc metalloprotease FtsH 1 OS=Conexibacter woesei (strain DSM 14684 / JCM 11494 / NBRC 100937 / ID131577) GN=ftsH1 PE=3 SV=1 212 373 3.0E-10
sp|Q6F0E5|FTSH_MESFL ATP-dependent zinc metalloprotease FtsH OS=Mesoplasma florum (strain ATCC 33453 / NBRC 100688 / NCTC 11704 / L1) GN=ftsH PE=3 SV=1 214 368 3.0E-10
sp|Q6KHA4|FTSH_MYCMO ATP-dependent zinc metalloprotease FtsH OS=Mycoplasma mobile (strain ATCC 43663 / 163K / NCTC 11711) GN=ftsH PE=3 SV=1 212 369 3.0E-10
sp|B8I4B9|FTSH_CLOCE ATP-dependent zinc metalloprotease FtsH OS=Clostridium cellulolyticum (strain ATCC 35319 / DSM 5812 / JCM 6584 / H10) GN=ftsH PE=3 SV=1 199 369 3.0E-10
sp|D1BLD0|FTSH_VEIPT ATP-dependent zinc metalloprotease FtsH OS=Veillonella parvula (strain ATCC 10790 / DSM 2008 / JCM 12972 / Te3) GN=ftsH PE=3 SV=1 222 369 4.0E-10
sp|C0ZPK5|FTSH_RHOE4 ATP-dependent zinc metalloprotease FtsH OS=Rhodococcus erythropolis (strain PR4 / NBRC 100887) GN=ftsH PE=3 SV=1 212 369 4.0E-10
sp|Q4L3G8|FTSH_STAHJ ATP-dependent zinc metalloprotease FtsH OS=Staphylococcus haemolyticus (strain JCSC1435) GN=ftsH PE=3 SV=1 191 369 5.0E-10
sp|B3DY14|FTSH2_METI4 ATP-dependent zinc metalloprotease FtsH 2 OS=Methylacidiphilum infernorum (isolate V4) GN=ftsH2 PE=3 SV=1 214 368 5.0E-10
sp|P73437|FTSH4_SYNY3 ATP-dependent zinc metalloprotease FtsH 4 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=ftsH4 PE=2 SV=1 214 368 5.0E-10
sp|D1C8C0|FTSH4_SPHTD ATP-dependent zinc metalloprotease FtsH 4 OS=Sphaerobacter thermophilus (strain DSM 20745 / S 6022) GN=ftsh4 PE=3 SV=1 220 369 5.0E-10
sp|Q2KJI7|AFG32_BOVIN AFG3-like protein 2 OS=Bos taurus GN=AFG3L2 PE=2 SV=1 220 369 6.0E-10
sp|Q8JZQ2|AFG32_MOUSE AFG3-like protein 2 OS=Mus musculus GN=Afg3l2 PE=1 SV=1 220 369 7.0E-10
sp|Q9Y4W6|AFG32_HUMAN AFG3-like protein 2 OS=Homo sapiens GN=AFG3L2 PE=1 SV=2 220 369 8.0E-10
sp|B9L3S8|FTSH2_THERP ATP-dependent zinc metalloprotease FtsH 2 OS=Thermomicrobium roseum (strain ATCC 27502 / DSM 5159 / P-2) GN=ftsH2 PE=3 SV=1 220 369 8.0E-10
sp|P37476|FTSH_BACSU ATP-dependent zinc metalloprotease FtsH OS=Bacillus subtilis (strain 168) GN=ftsH PE=1 SV=1 220 368 8.0E-10
sp|B9MPK5|FTSH_CALBD ATP-dependent zinc metalloprotease FtsH OS=Caldicellulosiruptor bescii (strain ATCC BAA-1888 / DSM 6725 / Z-1320) GN=ftsH PE=3 SV=1 197 399 9.0E-10
sp|P62198|PRS8_RAT 26S protease regulatory subunit 8 OS=Rattus norvegicus GN=Psmc5 PE=1 SV=1 211 363 9.0E-10
sp|P62197|PRS8_PIG 26S protease regulatory subunit 8 OS=Sus scrofa GN=PSMC5 PE=2 SV=1 211 363 9.0E-10
sp|P62196|PRS8_MOUSE 26S protease regulatory subunit 8 OS=Mus musculus GN=Psmc5 PE=1 SV=1 211 363 9.0E-10
sp|P62195|PRS8_HUMAN 26S protease regulatory subunit 8 OS=Homo sapiens GN=PSMC5 PE=1 SV=1 211 363 9.0E-10
sp|P62194|PRS8_BOVIN 26S protease regulatory subunit 8 OS=Bos taurus GN=PSMC5 PE=2 SV=1 211 363 9.0E-10
sp|O42587|PR6AA_XENLA 26S protease regulatory subunit 6A-A OS=Xenopus laevis GN=psmc3-a PE=2 SV=1 211 395 1.0E-09
sp|O60058|AFG2_SCHPO ATPase family gene 2 protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=afg2 PE=3 SV=1 213 390 1.0E-09
sp|Q63569|PRS6A_RAT 26S protease regulatory subunit 6A OS=Rattus norvegicus GN=Psmc3 PE=2 SV=1 211 395 1.0E-09
sp|P17980|PRS6A_HUMAN 26S protease regulatory subunit 6A OS=Homo sapiens GN=PSMC3 PE=1 SV=3 211 395 1.0E-09
sp|O88685|PRS6A_MOUSE 26S protease regulatory subunit 6A OS=Mus musculus GN=Psmc3 PE=1 SV=2 211 395 1.0E-09
sp|Q9CD58|FTSH_MYCLE ATP-dependent zinc metalloprotease FtsH OS=Mycobacterium leprae (strain TN) GN=ftsH PE=3 SV=1 211 368 1.0E-09
sp|P9WQN3|FTSH_MYCTU ATP-dependent zinc metalloprotease FtsH OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ftsH PE=1 SV=1 211 368 1.0E-09
sp|P9WQN2|FTSH_MYCTO ATP-dependent zinc metalloprotease FtsH OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ftsH PE=3 SV=1 211 368 1.0E-09
sp|A5U8T5|FTSH_MYCTA ATP-dependent zinc metalloprotease FtsH OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=ftsH PE=3 SV=1 211 368 1.0E-09
sp|P0A4V9|FTSH_MYCBO ATP-dependent zinc metalloprotease FtsH OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ftsH PE=3 SV=1 211 368 1.0E-09
sp|Q8SR13|PRS6A_ENCCU 26S protease regulatory subunit 6A OS=Encephalitozoon cuniculi (strain GB-M1) GN=RPT5 PE=1 SV=1 242 363 1.0E-09
sp|Q3UMC0|SPAT5_MOUSE Spermatogenesis-associated protein 5 OS=Mus musculus GN=Spata5 PE=1 SV=2 227 369 1.0E-09
sp|Q83FV7|FTSH_TROWT ATP-dependent zinc metalloprotease FtsH OS=Tropheryma whipplei (strain Twist) GN=ftsH PE=3 SV=1 212 368 1.0E-09
sp|D3FFN2|FTSH_MYCGH ATP-dependent zinc metalloprotease FtsH OS=Mycoplasma gallisepticum (strain R(high / passage 156)) GN=ftsH PE=3 SV=1 214 368 1.0E-09
sp|C7MC16|FTSH_BRAFD ATP-dependent zinc metalloprotease FtsH OS=Brachybacterium faecium (strain ATCC 43885 / DSM 4810 / NCIB 9860) GN=ftsH PE=3 SV=1 212 368 1.0E-09
sp|O59824|YME1_SCHPO ATP-dependent zinc metalloprotease YME1 homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC965.04c PE=3 SV=1 199 368 1.0E-09
sp|Q8SRH0|PRS4_ENCCU 26S protease regulatory subunit 4 homolog OS=Encephalitozoon cuniculi (strain GB-M1) GN=RPT2 PE=1 SV=1 213 381 1.0E-09
sp|B0K5A3|FTSH1_THEPX ATP-dependent zinc metalloprotease FtsH 1 OS=Thermoanaerobacter sp. (strain X514) GN=ftsH1 PE=3 SV=1 220 369 2.0E-09
sp|Q39102|FTSH1_ARATH ATP-dependent zinc metalloprotease FTSH 1, chloroplastic OS=Arabidopsis thaliana GN=FTSH1 PE=1 SV=2 222 458 2.0E-09
sp|B2A3Q4|FTSH_NATTJ ATP-dependent zinc metalloprotease FtsH OS=Natranaerobius thermophilus (strain ATCC BAA-1301 / DSM 18059 / JW/NM-WN-LF) GN=ftsH PE=3 SV=1 225 368 2.0E-09
sp|A9KIG5|FTSH_CLOPH ATP-dependent zinc metalloprotease FtsH OS=Clostridium phytofermentans (strain ATCC 700394 / DSM 18823 / ISDg) GN=ftsH PE=3 SV=1 217 389 2.0E-09
sp|P54776|PRS6A_SOLLC 26S protease regulatory subunit 6A homolog OS=Solanum lycopersicum GN=TBP1 PE=2 SV=1 227 395 2.0E-09
sp|Q55BV5|PRS4_DICDI 26S protease regulatory subunit 4 homolog OS=Dictyostelium discoideum GN=psmC1 PE=1 SV=1 227 363 2.0E-09
sp|Q88Z31|FTSH_LACPL ATP-dependent zinc metalloprotease FtsH OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=ftsH PE=2 SV=1 226 369 2.0E-09
sp|C6VKW6|FTSH_LACPJ ATP-dependent zinc metalloprotease FtsH OS=Lactobacillus plantarum (strain JDM1) GN=ftsH PE=3 SV=1 226 369 2.0E-09
sp|Q9DBY8|NVL_MOUSE Nuclear valosin-containing protein-like OS=Mus musculus GN=Nvl PE=1 SV=1 231 403 2.0E-09
sp|A1TZE0|FTSH_MARHV ATP-dependent zinc metalloprotease FtsH OS=Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8) GN=ftsH PE=3 SV=1 201 373 2.0E-09
sp|C1F8X6|FTSH_ACIC5 ATP-dependent zinc metalloprotease FtsH OS=Acidobacterium capsulatum (strain ATCC 51196 / DSM 11244 / JCM 7670 / NBRC 15755 / NCIMB 13165 / 161) GN=ftsH PE=3 SV=1 220 369 3.0E-09
sp|A1URA3|FTSH_BARBK ATP-dependent zinc metalloprotease FtsH OS=Bartonella bacilliformis (strain ATCC 35685 / KC583) GN=ftsH PE=3 SV=1 214 399 3.0E-09
sp|Q25544|PRS8_NAEFO 26S protease regulatory subunit 8 homolog OS=Naegleria fowleri PE=2 SV=1 211 363 3.0E-09
sp|P94304|FTSH_BACPE ATP-dependent zinc metalloprotease FtsH OS=Bacillus pseudofirmus (strain OF4) GN=ftsH PE=3 SV=2 220 369 3.0E-09
sp|Q6M2F0|FTSH_CORGL ATP-dependent zinc metalloprotease FtsH OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=ftsH PE=3 SV=1 214 368 3.0E-09
sp|Q9SL67|PRS4B_ARATH 26S proteasome regulatory subunit 4 homolog B OS=Arabidopsis thaliana GN=RPT2B PE=1 SV=1 227 366 3.0E-09
sp|Q6MDI5|FTSH_PARUW ATP-dependent zinc metalloprotease FtsH OS=Protochlamydia amoebophila (strain UWE25) GN=ftsH PE=3 SV=1 214 369 4.0E-09
sp|O15381|NVL_HUMAN Nuclear valosin-containing protein-like OS=Homo sapiens GN=NVL PE=1 SV=1 231 403 4.0E-09
sp|P75120|FTSH_MYCPN ATP-dependent zinc metalloprotease FtsH OS=Mycoplasma pneumoniae (strain ATCC 29342 / M129) GN=ftsH PE=3 SV=1 222 368 4.0E-09
sp|Q1AV13|FTSH_RUBXD ATP-dependent zinc metalloprotease FtsH OS=Rubrobacter xylanophilus (strain DSM 9941 / NBRC 16129) GN=ftsH PE=3 SV=1 212 368 4.0E-09
sp|P47695|FTSH_MYCGE ATP-dependent zinc metalloprotease FtsH OS=Mycoplasma genitalium (strain ATCC 33530 / G-37 / NCTC 10195) GN=ftsH PE=3 SV=1 222 368 4.0E-09
sp|B4SCV5|FTSH_PELPB ATP-dependent zinc metalloprotease FtsH OS=Pelodictyon phaeoclathratiforme (strain DSM 5477 / BU-1) GN=ftsH PE=3 SV=1 214 368 4.0E-09
sp|Q8NB90|SPAT5_HUMAN Spermatogenesis-associated protein 5 OS=Homo sapiens GN=SPATA5 PE=1 SV=3 227 369 4.0E-09
sp|Q9BVQ7|SPA5L_HUMAN Spermatogenesis-associated protein 5-like protein 1 OS=Homo sapiens GN=SPATA5L1 PE=1 SV=2 237 379 4.0E-09
sp|Q3B6R3|FTSH_CHLL7 ATP-dependent zinc metalloprotease FtsH OS=Chlorobium luteolum (strain DSM 273 / 2530) GN=ftsH PE=3 SV=1 211 368 5.0E-09
sp|P46465|PRS6A_ORYSJ 26S protease regulatory subunit 6A homolog OS=Oryza sativa subsp. japonica GN=TBP1 PE=2 SV=2 237 395 5.0E-09
sp|P71377|FTSH_HAEIN ATP-dependent zinc metalloprotease FtsH OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=ftsH PE=3 SV=1 220 369 5.0E-09
sp|O42586|PR6AB_XENLA 26S protease regulatory subunit 6A-B OS=Xenopus laevis GN=psmc3-b PE=2 SV=1 211 395 5.0E-09
sp|Q9SD67|FTSH7_ARATH ATP-dependent zinc metalloprotease FTSH 7, chloroplastic OS=Arabidopsis thaliana GN=FTSH7 PE=2 SV=1 211 368 5.0E-09
sp|C6V4R9|FTSH_NEORI ATP-dependent zinc metalloprotease FtsH OS=Neorickettsia risticii (strain Illinois) GN=ftsH PE=3 SV=1 211 368 5.0E-09
sp|A8MPR5|FTSI2_ARATH Probable inactive ATP-dependent zinc metalloprotease FTSHI 2, chloroplastic OS=Arabidopsis thaliana GN=FTSHI2 PE=1 SV=1 220 368 5.0E-09
sp|D4HA34|FTSH_PROAS ATP-dependent zinc metalloprotease FtsH OS=Propionibacterium acnes (strain SK137) GN=ftsH PE=3 SV=1 214 368 5.0E-09
sp|D2NQQ7|FTSH_ROTMD ATP-dependent zinc metalloprotease FtsH OS=Rothia mucilaginosa (strain DY-18) GN=ftsH PE=3 SV=1 214 368 5.0E-09
sp|A0LR74|FTSH_ACIC1 ATP-dependent zinc metalloprotease FtsH OS=Acidothermus cellulolyticus (strain ATCC 43068 / 11B) GN=ftsH PE=3 SV=1 214 394 6.0E-09
sp|Q5Z974|FTSH1_ORYSJ ATP-dependent zinc metalloprotease FTSH 1, chloroplastic OS=Oryza sativa subsp. japonica GN=FTSH1 PE=2 SV=1 222 368 6.0E-09
sp|O14126|PRS6A_SCHPO 26S protease regulatory subunit 6A OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tbp1 PE=3 SV=1 237 395 6.0E-09
sp|Q0TTK8|FTSH_CLOP1 ATP-dependent zinc metalloprotease FtsH OS=Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) GN=ftsH PE=3 SV=1 216 363 6.0E-09
sp|B1AI94|FTSH_UREP2 ATP-dependent zinc metalloprotease FtsH OS=Ureaplasma parvum serovar 3 (strain ATCC 27815 / 27 / NCTC 11736) GN=ftsH PE=3 SV=1 215 369 6.0E-09
sp|Q9BAE0|FTSH_MEDSA ATP-dependent zinc metalloprotease FTSH, chloroplastic OS=Medicago sativa GN=FTSH PE=2 SV=1 222 394 6.0E-09
sp|Q39444|FTSH_CAPAN ATP-dependent zinc metalloprotease FTSH, chloroplastic (Fragment) OS=Capsicum annuum GN=FTSH PE=2 SV=1 222 458 6.0E-09
sp|A9GRC9|FTSH1_SORC5 ATP-dependent zinc metalloprotease FtsH 1 OS=Sorangium cellulosum (strain So ce56) GN=ftsH1 PE=3 SV=1 220 366 7.0E-09
sp|P54813|YME1_CAEEL ATP-dependent zinc metalloprotease YME1 homolog OS=Caenorhabditis elegans GN=ymel-1 PE=3 SV=2 220 368 7.0E-09
sp|A9NE17|FTSH_ACHLI ATP-dependent zinc metalloprotease FtsH OS=Acholeplasma laidlawii (strain PG-8A) GN=ftsH PE=3 SV=1 220 366 7.0E-09
sp|Q04Q03|FTSH_LEPBJ ATP-dependent zinc metalloprotease FtsH OS=Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) GN=ftsH PE=3 SV=1 199 368 7.0E-09
sp|Q1LLA9|FTSH_CUPMC ATP-dependent zinc metalloprotease FtsH OS=Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34) GN=ftsH PE=3 SV=1 216 369 7.0E-09
sp|Q6H6R9|FTSH7_ORYSJ ATP-dependent zinc metalloprotease FTSH 7, chloroplastic OS=Oryza sativa subsp. japonica GN=FTSH7 PE=3 SV=1 222 374 7.0E-09
sp|B1ZMG6|FTSH_OPITP ATP-dependent zinc metalloprotease FtsH OS=Opitutus terrae (strain DSM 11246 / PB90-1) GN=ftsH PE=3 SV=1 220 369 7.0E-09
sp|P32794|AFG2_YEAST ATPase family gene 2 protein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AFG2 PE=1 SV=1 211 369 7.0E-09
sp|P40327|PRS4_YEAST 26S protease regulatory subunit 4 homolog OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPT2 PE=1 SV=3 213 363 8.0E-09
sp|P46466|PRS4_ORYSJ 26S protease regulatory subunit 4 homolog OS=Oryza sativa subsp. japonica GN=TBP2 PE=2 SV=2 227 366 8.0E-09
sp|P36966|PEX6_YARLI Peroxisomal biogenesis factor 6 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=PEX6 PE=3 SV=2 213 378 8.0E-09
sp|Q9SZD4|PRS4A_ARATH 26S proteasome regulatory subunit 4 homolog A OS=Arabidopsis thaliana GN=RPT2A PE=1 SV=1 227 366 8.0E-09
sp|O23894|PRS6A_BRACM 26S protease regulatory subunit 6A homolog OS=Brassica campestris GN=TBP1 PE=2 SV=1 227 395 8.0E-09
sp|Q9FH02|FTSH5_ARATH ATP-dependent zinc metalloprotease FTSH 5, chloroplastic OS=Arabidopsis thaliana GN=FTSH5 PE=1 SV=1 222 458 8.0E-09
sp|A6QBN8|FTSH_SULNB ATP-dependent zinc metalloprotease FtsH OS=Sulfurovum sp. (strain NBC37-1) GN=ftsH PE=3 SV=1 213 368 8.0E-09
sp|Q9HGM3|YTA12_SCHPO Mitochondrial respiratory chain complexes assembly protein rca1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=yta12 PE=3 SV=1 216 368 8.0E-09
sp|O82150|FTSH_TOBAC ATP-dependent zinc metalloprotease FTSH, chloroplastic OS=Nicotiana tabacum GN=FTSH PE=2 SV=2 222 388 9.0E-09
sp|Q01939|PRS8_YEAST 26S protease regulatory subunit 8 homolog OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPT6 PE=1 SV=4 237 363 9.0E-09
sp|B2UMY1|FTSH_AKKM8 ATP-dependent zinc metalloprotease FtsH OS=Akkermansia muciniphila (strain ATCC BAA-835 / Muc) GN=ftsH PE=3 SV=1 220 368 9.0E-09
sp|D1CDT8|FTSH_THET1 ATP-dependent zinc metalloprotease FtsH OS=Thermobaculum terrenum (strain ATCC BAA-798 / YNP1) GN=ftsH PE=3 SV=1 220 395 9.0E-09
sp|Q9SEI2|PS6AA_ARATH 26S protease regulatory subunit 6A homolog A OS=Arabidopsis thaliana GN=RPT5A PE=1 SV=1 227 395 1.0E-08
sp|P46508|YME1_SCHMA ATP-dependent zinc metalloprotease YME1 homolog OS=Schistosoma mansoni PE=2 SV=1 215 372 1.0E-08
sp|O17071|PRS10_CAEEL Probable 26S protease regulatory subunit 10B OS=Caenorhabditis elegans GN=rpt-4 PE=1 SV=2 237 391 1.0E-08
sp|Q96TA2|YMEL1_HUMAN ATP-dependent zinc metalloprotease YME1L1 OS=Homo sapiens GN=YME1L1 PE=1 SV=2 213 368 1.0E-08
sp|C5J6A7|FTSH_MYCCR ATP-dependent zinc metalloprotease FtsH OS=Mycoplasma conjunctivae (strain ATCC 25834 / HRC/581 / NCTC 10147) GN=ftsH PE=3 SV=1 215 369 1.0E-08
sp|O78516|FTSH_GUITH ATP-dependent zinc metalloprotease FtsH OS=Guillardia theta GN=ftsH PE=3 SV=1 222 368 1.0E-08
sp|P46470|PRS8_XENLA 26S protease regulatory subunit 8 OS=Xenopus laevis GN=psmc5 PE=2 SV=2 211 363 1.0E-08
sp|Q0VA52|SPA5L_XENTR Spermatogenesis-associated protein 5-like protein 1 OS=Xenopus tropicalis GN=spata5l1 PE=2 SV=1 237 390 1.0E-08
sp|Q8SQK0|PRS8_ENCCU 26S protease regulatory subunit 8 homolog OS=Encephalitozoon cuniculi (strain GB-M1) GN=RPT6 PE=1 SV=2 211 382 1.0E-08
sp|B8D065|FTSH_HALOH ATP-dependent zinc metalloprotease FtsH OS=Halothermothrix orenii (strain H 168 / OCM 544 / DSM 9562) GN=ftsH PE=3 SV=1 191 368 1.0E-08
sp|P46469|FTSH_LACLA ATP-dependent zinc metalloprotease FtsH OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=ftsH PE=3 SV=1 220 369 1.0E-08
sp|O88967|YMEL1_MOUSE ATP-dependent zinc metalloprotease YME1L1 OS=Mus musculus GN=Yme1l1 PE=1 SV=1 213 368 1.0E-08
sp|Q8X9L0|FTSH_ECO57 ATP-dependent zinc metalloprotease FtsH OS=Escherichia coli O157:H7 GN=ftsH PE=3 SV=1 220 369 1.0E-08
sp|D1C4U5|FTSH3_SPHTD ATP-dependent zinc metalloprotease FtsH 3 OS=Sphaerobacter thermophilus (strain DSM 20745 / S 6022) GN=ftsH3 PE=3 SV=1 220 391 1.0E-08
sp|B8J992|FTSH_ANAD2 ATP-dependent zinc metalloprotease FtsH OS=Anaeromyxobacter dehalogenans (strain 2CP-1 / ATCC BAA-258) GN=ftsH PE=3 SV=1 211 368 2.0E-08
sp|P63343|FTSH_SALTY ATP-dependent zinc metalloprotease FtsH OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=ftsH PE=3 SV=1 220 369 2.0E-08
sp|P63344|FTSH_SALTI ATP-dependent zinc metalloprotease FtsH OS=Salmonella typhi GN=ftsH PE=3 SV=1 220 369 2.0E-08
sp|O04019|PS6AB_ARATH 26S protease regulatory subunit 6A homolog B OS=Arabidopsis thaliana GN=RPT5B PE=1 SV=3 211 395 2.0E-08
sp|P0AAI4|FTSH_SHIFL ATP-dependent zinc metalloprotease FtsH OS=Shigella flexneri GN=ftsH PE=3 SV=1 220 369 2.0E-08
sp|P0AAI3|FTSH_ECOLI ATP-dependent zinc metalloprotease FtsH OS=Escherichia coli (strain K12) GN=ftsH PE=1 SV=1 220 369 2.0E-08
sp|Q2SF13|FTSH_HAHCH ATP-dependent zinc metalloprotease FtsH OS=Hahella chejuensis (strain KCTC 2396) GN=ftsH PE=3 SV=1 242 368 2.0E-08
sp|C8WEG0|FTSH_ZYMMN ATP-dependent zinc metalloprotease FtsH OS=Zymomonas mobilis subsp. mobilis (strain NCIMB 11163 / B70) GN=ftsH PE=3 SV=1 223 368 2.0E-08
sp|A9FDV9|FTSH2_SORC5 ATP-dependent zinc metalloprotease FtsH 2 OS=Sorangium cellulosum (strain So ce56) GN=ftsH2 PE=3 SV=1 220 368 2.0E-08
sp|Q67T82|FTSH2_SYMTH ATP-dependent zinc metalloprotease FtsH 2 OS=Symbiobacterium thermophilum (strain T / IAM 14863) GN=ftsH2 PE=3 SV=1 222 399 2.0E-08
sp|P71408|FTSH_HELPY ATP-dependent zinc metalloprotease FtsH OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=ftsH PE=1 SV=2 212 368 2.0E-08
sp|P73179|FTSH1_SYNY3 ATP-dependent zinc metalloprotease FtsH 1 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=ftsH1 PE=2 SV=1 211 368 2.0E-08
sp|Q9FIM2|FTSH9_ARATH ATP-dependent zinc metalloprotease FTSH 9, chloroplastic OS=Arabidopsis thaliana GN=FTSH9 PE=2 SV=1 211 368 2.0E-08
sp|Q9ZM66|FTSH_HELPJ ATP-dependent zinc metalloprotease FtsH OS=Helicobacter pylori (strain J99 / ATCC 700824) GN=ftsH PE=3 SV=1 212 368 2.0E-08
sp|Q2JNP0|FTSH_SYNJB ATP-dependent zinc metalloprotease FtsH OS=Synechococcus sp. (strain JA-2-3B'a(2-13)) GN=ftsH PE=3 SV=1 211 368 2.0E-08
sp|B3R057|FTSH1_PHYMT ATP-dependent zinc metalloprotease FtsH 1 OS=Phytoplasma mali (strain AT) GN=ftsH1 PE=3 SV=1 220 369 2.0E-08
sp|P34124|PRS8_DICDI 26S protease regulatory subunit 8 OS=Dictyostelium discoideum GN=psmC5 PE=1 SV=2 211 382 2.0E-08
sp|C7M0M0|FTSH_ACIFD ATP-dependent zinc metalloprotease FtsH OS=Acidimicrobium ferrooxidans (strain DSM 10331 / JCM 15462 / NBRC 103882 / ICP) GN=ftsH PE=3 SV=1 201 368 2.0E-08
sp|Q9TJ83|FTSH_CYAME ATP-dependent zinc metalloprotease FtsH OS=Cyanidioschyzon merolae GN=ftsH PE=3 SV=1 220 368 2.0E-08
sp|P78578|PRS6B_ASPNG 26S protease regulatory subunit 6B homolog OS=Aspergillus niger GN=tbpA PE=3 SV=1 216 366 3.0E-08
sp|Q8SQI9|PRS6B_ENCCU 26S protease regulatory subunit 6B homolog OS=Encephalitozoon cuniculi (strain GB-M1) GN=ECU08_1970 PE=1 SV=1 216 363 3.0E-08
sp|A6TSZ1|FTSH1_ALKMQ ATP-dependent zinc metalloprotease FtsH 1 OS=Alkaliphilus metalliredigens (strain QYMF) GN=ftsH1 PE=3 SV=1 212 394 3.0E-08
sp|Q2NIN5|FTSH_AYWBP ATP-dependent zinc metalloprotease FtsH OS=Aster yellows witches'-broom phytoplasma (strain AYWB) GN=ftsH PE=3 SV=1 220 368 3.0E-08
sp|Q8EUA6|FTSH_MYCPE ATP-dependent zinc metalloprotease FtsH OS=Mycoplasma penetrans (strain HF-2) GN=ftsH PE=3 SV=1 225 369 3.0E-08
sp|Q67LC0|FTSH1_SYMTH ATP-dependent zinc metalloprotease FtsH 1 OS=Symbiobacterium thermophilum (strain T / IAM 14863) GN=ftsH1 PE=3 SV=1 222 363 4.0E-08
sp|B3DV46|FTSH1_METI4 ATP-dependent zinc metalloprotease FtsH 1 OS=Methylacidiphilum infernorum (isolate V4) GN=ftsH1 PE=3 SV=1 220 368 4.0E-08
sp|Q98PE4|FTSH_MYCPU ATP-dependent zinc metalloprotease FtsH OS=Mycoplasma pulmonis (strain UAB CTIP) GN=ftsH PE=3 SV=1 214 369 4.0E-08
sp|Q925S8|YMEL1_RAT ATP-dependent zinc metalloprotease YME1L1 OS=Rattus norvegicus GN=Yme1l1 PE=2 SV=1 213 368 4.0E-08
sp|O28303|PAN_ARCFU Proteasome-activating nucleotidase OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=pan PE=1 SV=1 227 368 4.0E-08
sp|A7YSY2|SPA5L_BOVIN Spermatogenesis-associated protein 5-like protein 1 OS=Bos taurus GN=SPATA5L1 PE=2 SV=1 237 375 4.0E-08
sp|O22993|FTSI1_ARATH Probable inactive ATP-dependent zinc metalloprotease FTSHI 1, chloroplastic OS=Arabidopsis thaliana GN=FTSHI1 PE=1 SV=1 211 368 4.0E-08
sp|D5D8E3|FTSH_SULMD ATP-dependent zinc metalloprotease FtsH OS=Sulcia muelleri (strain DMIN) GN=ftsH PE=3 SV=1 213 368 5.0E-08
sp|B3R0R7|FTSH3_PHYMT ATP-dependent zinc metalloprotease FtsH 3 OS=Phytoplasma mali (strain AT) GN=ftsH3 PE=3 SV=1 220 369 5.0E-08
sp|O80860|FTSH2_ARATH ATP-dependent zinc metalloprotease FTSH 2, chloroplastic OS=Arabidopsis thaliana GN=FTSH2 PE=1 SV=1 222 368 5.0E-08
sp|O60058|AFG2_SCHPO ATPase family gene 2 protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=afg2 PE=3 SV=1 242 369 6.0E-08
sp|Q8RY16|PEX6_ARATH Peroxisome biogenesis protein 6 OS=Arabidopsis thaliana GN=PEX6 PE=1 SV=1 142 403 6.0E-08
sp|P46471|PRS7_MOUSE 26S protease regulatory subunit 7 OS=Mus musculus GN=Psmc2 PE=1 SV=5 231 366 6.0E-08
sp|D2QZ34|FTSH_PIRSD ATP-dependent zinc metalloprotease FtsH OS=Pirellula staleyi (strain ATCC 27377 / DSM 6068 / ICPB 4128) GN=ftsH PE=3 SV=1 225 368 6.0E-08
sp|P46472|PRS7_XENLA 26S protease regulatory subunit 7 OS=Xenopus laevis GN=psmc2 PE=2 SV=1 231 366 6.0E-08
sp|Q4R4R0|PRS7_MACFA 26S protease regulatory subunit 7 OS=Macaca fascicularis GN=PSMC2 PE=2 SV=3 231 366 6.0E-08
sp|P35998|PRS7_HUMAN 26S protease regulatory subunit 7 OS=Homo sapiens GN=PSMC2 PE=1 SV=3 231 366 6.0E-08
sp|Q5E9F9|PRS7_BOVIN 26S protease regulatory subunit 7 OS=Bos taurus GN=PSMC2 PE=2 SV=3 231 366 6.0E-08
sp|Q8LQJ8|FTSH5_ORYSJ ATP-dependent zinc metalloprotease FTSH 5, mitochondrial OS=Oryza sativa subsp. japonica GN=FTSH5 PE=3 SV=1 217 363 6.0E-08
sp|Q54PN7|PRS6A_DICDI 26S protease regulatory subunit 6A homolog OS=Dictyostelium discoideum GN=psmC3 PE=1 SV=1 211 395 6.0E-08
sp|P59652|FTSH_STRR6 ATP-dependent zinc metalloprotease FtsH OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=ftsH PE=3 SV=1 220 369 7.0E-08
sp|O69076|FTSH_STRPN ATP-dependent zinc metalloprotease FtsH OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=ftsH PE=3 SV=3 220 369 7.0E-08
sp|Q5R8D7|PRS7_PONAB 26S protease regulatory subunit 7 OS=Pongo abelii GN=PSMC2 PE=2 SV=3 231 366 7.0E-08
sp|B8H8L3|ARC_ARTCA Proteasome-associated ATPase OS=Arthrobacter chlorophenolicus (strain ATCC 700700 / DSM 12829 / JCM 12360 / NCIMB 13794 / A6) GN=arc PE=3 SV=1 232 398 7.0E-08
sp|Q1XDF9|FTSH_PYRYE ATP-dependent zinc metalloprotease FtsH OS=Pyropia yezoensis GN=ftsH PE=3 SV=1 222 368 7.0E-08
sp|Q18787|PRS7_CAEEL 26S protease regulatory subunit 7 OS=Caenorhabditis elegans GN=rpt-1 PE=1 SV=1 231 366 8.0E-08
sp|Q63347|PRS7_RAT 26S protease regulatory subunit 7 OS=Rattus norvegicus GN=Psmc2 PE=1 SV=3 231 366 8.0E-08
sp|Q86JA1|PRS7_DICDI 26S protease regulatory subunit 7 OS=Dictyostelium discoideum GN=psmC2 PE=1 SV=1 231 369 8.0E-08
sp|Q655S1|FTSH2_ORYSJ ATP-dependent zinc metalloprotease FTSH 2, chloroplastic OS=Oryza sativa subsp. japonica GN=FTSH2 PE=3 SV=1 222 368 9.0E-08
sp|C7MWW2|ARC_SACVD Proteasome-associated ATPase OS=Saccharomonospora viridis (strain ATCC 15386 / DSM 43017 / JCM 3036 / NBRC 12207 / P101) GN=arc PE=3 SV=1 220 411 9.0E-08
sp|Q8TX03|PAN_METKA Proteasome-activating nucleotidase OS=Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938) GN=pan PE=3 SV=1 211 388 9.0E-08
sp|B3PNH3|FTSH_MYCA5 ATP-dependent zinc metalloprotease FtsH OS=Mycoplasma arthritidis (strain 158L3-1) GN=ftsH PE=3 SV=1 225 369 9.0E-08
sp|Q8W585|FTSH8_ARATH ATP-dependent zinc metalloprotease FTSH 8, chloroplastic OS=Arabidopsis thaliana GN=FTSH8 PE=1 SV=1 222 368 1.0E-07
sp|Q1PDW5|FTSH6_ARATH ATP-dependent zinc metalloprotease FTSH 6, chloroplastic OS=Arabidopsis thaliana GN=FTSH6 PE=2 SV=1 222 369 1.0E-07
sp|Q9SCN8|CD48D_ARATH Cell division control protein 48 homolog D OS=Arabidopsis thaliana GN=CDC48D PE=1 SV=1 213 375 1.0E-07
sp|Q6LUJ8|FTSH_PHOPR ATP-dependent zinc metalloprotease FtsH OS=Photobacterium profundum GN=ftsH PE=3 SV=1 220 369 1.0E-07
sp|B0B970|FTSH_CHLT2 ATP-dependent zinc metalloprotease FtsH OS=Chlamydia trachomatis serovar L2 (strain 434/Bu / ATCC VR-902B) GN=ftsH PE=3 SV=1 216 369 1.0E-07
sp|Q55700|FTSH2_SYNY3 ATP-dependent zinc metalloprotease FtsH 2 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=ftsH2 PE=1 SV=1 211 368 1.0E-07
sp|O26824|PAN_METTH Proteasome-activating nucleotidase OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=pan PE=3 SV=1 227 368 1.0E-07
sp|Q4JVP5|ARC_CORJK AAA ATPase forming ring-shaped complexes OS=Corynebacterium jeikeium (strain K411) GN=arc PE=3 SV=1 146 382 1.0E-07
sp|O19922|FTSH_CYACA ATP-dependent zinc metalloprotease FtsH OS=Cyanidium caldarium GN=ftsH PE=3 SV=1 226 368 1.0E-07
sp|A5W382|FTSH_PSEP1 ATP-dependent zinc metalloprotease FtsH OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=ftsH PE=3 SV=1 220 373 1.0E-07
sp|P51327|FTSH_PORPU ATP-dependent zinc metalloprotease FtsH OS=Porphyra purpurea GN=ftsH PE=3 SV=1 222 368 1.0E-07
sp|C3NFW6|PAN_SULIN Proteasome-activating nucleotidase OS=Sulfolobus islandicus (strain Y.N.15.51 / Yellowstone #2) GN=pan PE=3 SV=1 227 368 1.0E-07
sp|C7N914|FTSH_LEPBD ATP-dependent zinc metalloprotease FtsH OS=Leptotrichia buccalis (strain ATCC 14201 / DSM 1135 / JCM 12969 / NCTC 10249 / C-1013-b) GN=ftsH PE=3 SV=1 214 368 1.0E-07
sp|B7T1V0|FTSH_VAULI ATP-dependent zinc metalloprotease FtsH OS=Vaucheria litorea GN=ftsH PE=3 SV=1 226 368 1.0E-07
sp|Q9ZPR1|CD48B_ARATH Cell division control protein 48 homolog B OS=Arabidopsis thaliana GN=CDC48B PE=2 SV=1 237 389 1.0E-07
sp|C3N7K8|PAN_SULIY Proteasome-activating nucleotidase OS=Sulfolobus islandicus (strain Y.G.57.14 / Yellowstone #1) GN=pan PE=3 SV=1 227 368 1.0E-07
sp|C3MY47|PAN_SULIM Proteasome-activating nucleotidase OS=Sulfolobus islandicus (strain M.14.25 / Kamchatka #1) GN=pan PE=3 SV=1 227 368 1.0E-07
sp|C3MRF1|PAN_SULIL Proteasome-activating nucleotidase OS=Sulfolobus islandicus (strain L.S.2.15 / Lassen #1) GN=pan PE=3 SV=1 227 368 1.0E-07
sp|C4KIR6|PAN_SULIK Proteasome-activating nucleotidase OS=Sulfolobus islandicus (strain M.16.4 / Kamchatka #3) GN=pan PE=3 SV=1 227 368 1.0E-07
sp|C3MZI6|PAN_SULIA Proteasome-activating nucleotidase OS=Sulfolobus islandicus (strain M.16.27) GN=pan PE=3 SV=1 227 368 1.0E-07
sp|Q54PJ1|PRS10_DICDI 26S protease regulatory subunit 10B OS=Dictyostelium discoideum GN=psmC6 PE=1 SV=1 231 391 1.0E-07
sp|B8H444|FTSH_CAUCN ATP-dependent zinc metalloprotease FtsH OS=Caulobacter crescentus (strain NA1000 / CB15N) GN=ftsH PE=2 SV=1 222 368 1.0E-07
sp|P49825|FTSH_ODOSI ATP-dependent zinc metalloprotease FtsH OS=Odontella sinensis GN=ftsH PE=3 SV=1 222 374 2.0E-07
sp|A7I8B8|PAN_METB6 Proteasome-activating nucleotidase OS=Methanoregula boonei (strain 6A8) GN=pan PE=3 SV=1 214 368 2.0E-07
sp|P41836|PRS8_SCHPO 26S protease regulatory subunit 8 homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=let1 PE=3 SV=1 200 363 2.0E-07
sp|O28972|Y1297_ARCFU Cell division cycle protein 48 homolog AF_1297 OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=AF_1297 PE=3 SV=1 227 369 2.0E-07
sp|A0JWY3|ARC_ARTS2 Proteasome-associated ATPase OS=Arthrobacter sp. (strain FB24) GN=arc PE=3 SV=1 232 398 2.0E-07
sp|Q1RGP0|FTSH_RICBR ATP-dependent zinc metalloprotease FtsH OS=Rickettsia bellii (strain RML369-C) GN=ftsH PE=3 SV=1 220 399 2.0E-07
sp|D1C1U7|FTSH1_SPHTD ATP-dependent zinc metalloprotease FtsH 1 OS=Sphaerobacter thermophilus (strain DSM 20745 / S 6022) GN=ftsH1 PE=3 SV=1 216 366 2.0E-07
sp|C7LYP4|ARC_ACIFD Proteasome-associated ATPase OS=Acidimicrobium ferrooxidans (strain DSM 10331 / JCM 15462 / NBRC 103882 / ICP) GN=arc PE=3 SV=1 211 383 2.0E-07
sp|Q10ZF7|FTSH_TRIEI ATP-dependent zinc metalloprotease FtsH OS=Trichodesmium erythraeum (strain IMS101) GN=ftsH PE=3 SV=1 220 368 2.0E-07
sp|O32617|FTSH_HELFC ATP-dependent zinc metalloprotease FtsH OS=Helicobacter felis (strain ATCC 49179 / NCTC 12436 / CS1) GN=ftsH PE=3 SV=1 212 368 2.0E-07
sp|Q8LQJ9|FTSH4_ORYSJ ATP-dependent zinc metalloprotease FTSH 4, mitochondrial OS=Oryza sativa subsp. japonica GN=FTSH4 PE=3 SV=1 217 368 2.0E-07
sp|Q03Z46|FTSH_LEUMM ATP-dependent zinc metalloprotease FtsH OS=Leuconostoc mesenteroides subsp. mesenteroides (strain ATCC 8293 / NCDO 523) GN=ftsH PE=3 SV=1 220 369 2.0E-07
sp|A9BFL9|FTSH1_PETMO ATP-dependent zinc metalloprotease FtsH 1 OS=Petrotoga mobilis (strain DSM 10674 / SJ95) GN=ftsH1 PE=3 SV=1 201 369 2.0E-07
sp|Q975U2|PAN_SULTO Proteasome-activating nucleotidase OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=pan PE=3 SV=2 227 368 2.0E-07
sp|Q6MLS7|FTSH1_BDEBA ATP-dependent zinc metalloprotease FtsH 1 OS=Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIB 9529 / HD100) GN=ftsH1 PE=3 SV=1 220 370 3.0E-07
sp|Q3JEE4|FTSH_NITOC ATP-dependent zinc metalloprotease FtsH OS=Nitrosococcus oceani (strain ATCC 19707 / NCIMB 11848) GN=ftsH PE=3 SV=1 222 366 3.0E-07
sp|D0MGU8|FTSH_RHOM4 ATP-dependent zinc metalloprotease FtsH OS=Rhodothermus marinus (strain ATCC 43812 / DSM 4252 / R-10) GN=ftsH PE=3 SV=1 211 380 3.0E-07
sp|Q2LUQ1|FTSH_SYNAS ATP-dependent zinc metalloprotease FtsH OS=Syntrophus aciditrophicus (strain SB) GN=ftsH PE=3 SV=1 217 368 3.0E-07
sp|Q9HG03|PEX6_PENCH Peroxisomal biogenesis factor 6 OS=Penicillium chrysogenum GN=pex6 PE=3 SV=1 215 369 3.0E-07
sp|P32795|YME1_YEAST Mitochondrial inner membrane i-AAA protease supercomplex subunit YME1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YME1 PE=1 SV=1 220 368 3.0E-07
sp|O05209|VAT_THEAC VCP-like ATPase OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=vat PE=1 SV=1 227 373 3.0E-07
sp|Q980M1|PAN_SULSO Proteasome-activating nucleotidase OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=pan PE=3 SV=1 227 368 3.0E-07
sp|B8G4Q6|FTSH_CHLAD ATP-dependent zinc metalloprotease FtsH OS=Chloroflexus aggregans (strain MD-66 / DSM 9485) GN=ftsH PE=3 SV=1 220 366 3.0E-07
sp|Q92JJ9|FTSH_RICCN ATP-dependent zinc metalloprotease FtsH OS=Rickettsia conorii (strain ATCC VR-613 / Malish 7) GN=ftsH PE=3 SV=1 211 399 3.0E-07
sp|Q9MAK9|PS10B_ARATH 26S protease regulatory subunit S10B homolog B OS=Arabidopsis thaliana GN=RPT4B PE=1 SV=1 231 379 3.0E-07
sp|Q4UN68|FTSH_RICFE ATP-dependent zinc metalloprotease FtsH OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=ftsH PE=3 SV=1 211 399 4.0E-07
sp|P72991|FTSH3_SYNY3 ATP-dependent zinc metalloprotease FtsH 3 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=ftsH3 PE=1 SV=1 220 368 4.0E-07
sp|A8ZNZ4|FTSH_ACAM1 ATP-dependent zinc metalloprotease FtsH OS=Acaryochloris marina (strain MBIC 11017) GN=ftsH PE=3 SV=1 214 368 4.0E-07
sp|Q9V287|PAN_PYRAB Proteasome-activating nucleotidase OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=pan PE=3 SV=2 227 368 4.0E-07
sp|Q68XR9|FTSH_RICTY ATP-dependent zinc metalloprotease FtsH OS=Rickettsia typhi (strain ATCC VR-144 / Wilmington) GN=ftsH PE=3 SV=1 211 399 4.0E-07
sp|Q9ZEA2|FTSH_RICPR ATP-dependent zinc metalloprotease FtsH OS=Rickettsia prowazekii (strain Madrid E) GN=ftsH PE=3 SV=1 211 399 4.0E-07
sp|B9KXV3|FTSH1_THERP ATP-dependent zinc metalloprotease FtsH 1 OS=Thermomicrobium roseum (strain ATCC 27502 / DSM 5159 / P-2) GN=ftsH1 PE=3 SV=1 211 366 4.0E-07
sp|Q9HPF0|CDCH_HALSA Protein CdcH OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=cdcH PE=3 SV=1 155 369 4.0E-07
sp|A9WSI4|ARC_RENSM Proteasome-associated ATPase OS=Renibacterium salmoninarum (strain ATCC 33209 / DSM 20767 / JCM 11484 / NBRC 15589 / NCIMB 2235) GN=arc PE=3 SV=1 232 383 4.0E-07
sp|B2UE66|FTSH_RALPJ ATP-dependent zinc metalloprotease FtsH OS=Ralstonia pickettii (strain 12J) GN=ftsH PE=3 SV=1 211 366 4.0E-07
sp|O57940|PAN_PYRHO Proteasome-activating nucleotidase OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=pan PE=3 SV=1 227 368 4.0E-07
sp|P34123|PRS6B_DICDI 26S protease regulatory subunit 6B homolog OS=Dictyostelium discoideum GN=psmC4 PE=1 SV=1 227 405 5.0E-07
sp|Q9C1E9|PEX6_COLOR Peroxisomal biogenesis factor 6 OS=Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422) GN=PEX6 PE=3 SV=2 215 369 5.0E-07
sp|P54812|TERA2_CAEEL Transitional endoplasmic reticulum ATPase homolog 2 OS=Caenorhabditis elegans GN=cdc-48.2 PE=1 SV=2 213 375 5.0E-07
sp|Q8YMZ8|FTSH_NOSS1 ATP-dependent zinc metalloprotease FtsH OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=ftsH PE=3 SV=1 220 392 5.0E-07
sp|D0LWB8|FTSH_HALO1 ATP-dependent zinc metalloprotease FtsH OS=Haliangium ochraceum (strain DSM 14365 / JCM 11303 / SMP-2) GN=ftsH PE=3 SV=1 214 366 5.0E-07
sp|A0L4S0|FTSH_MAGMM ATP-dependent zinc metalloprotease FtsH OS=Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1) GN=ftsH PE=3 SV=1 220 368 5.0E-07
sp|B2XTF7|FTSH_HETA2 ATP-dependent zinc metalloprotease FtsH OS=Heterosigma akashiwo (strain NIES-293) GN=ftsH PE=3 SV=1 226 373 5.0E-07
sp|Q8FTE3|ARC_COREF AAA ATPase forming ring-shaped complexes OS=Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395) GN=arc PE=3 SV=1 242 392 5.0E-07
sp|Q9HPF0|CDCH_HALSA Protein CdcH OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=cdcH PE=3 SV=1 227 370 6.0E-07
sp|O64982|PRS7_PRUPE 26S protease regulatory subunit 7 OS=Prunus persica GN=RPT1 PE=2 SV=1 231 369 6.0E-07
sp|Q9FXT9|PRS7_ORYSJ 26S protease regulatory subunit 7 OS=Oryza sativa subsp. japonica GN=RPT1A PE=2 SV=1 231 369 6.0E-07
sp|Q8SSJ5|CDC48_ENCCU Cell division control protein 48 OS=Encephalitozoon cuniculi (strain GB-M1) GN=CDC48 PE=1 SV=1 227 369 6.0E-07
sp|B6YXR2|PAN_THEON Proteasome-activating nucleotidase OS=Thermococcus onnurineus (strain NA1) GN=pan PE=3 SV=1 227 368 6.0E-07
sp|Q41365|PRS7_SPIOL 26S protease regulatory subunit 7 OS=Spinacia oleracea GN=RPT1 PE=2 SV=1 231 369 6.0E-07
sp|P33298|PRS6B_YEAST 26S protease regulatory subunit 6B homolog OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPT3 PE=1 SV=2 216 363 6.0E-07
sp|Q83XX3|FTSH_OENOE ATP-dependent zinc metalloprotease FtsH OS=Oenococcus oeni GN=ftsH PE=2 SV=1 226 369 6.0E-07
sp|O13764|PEX6_SCHPO Peroxisomal ATPase pex6 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pex6 PE=3 SV=1 236 369 6.0E-07
sp|P54774|CDC48_SOYBN Cell division cycle protein 48 homolog OS=Glycine max GN=CDC48 PE=2 SV=1 213 375 6.0E-07
sp|Q9WZ49|FTSH_THEMA ATP-dependent zinc metalloprotease FtsH OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=ftsH PE=1 SV=1 214 368 6.0E-07
sp|Q9SEI3|PS10A_ARATH 26S protease regulatory subunit 10B homolog A OS=Arabidopsis thaliana GN=RPT4A PE=1 SV=1 231 368 6.0E-07
sp|Q9SSB5|PRS7A_ARATH 26S protease regulatory subunit 7 homolog A OS=Arabidopsis thaliana GN=RPT1A PE=1 SV=1 231 369 7.0E-07
sp|Q9SEI4|PRS6B_ARATH 26S protease regulatory subunit 6B homolog OS=Arabidopsis thaliana GN=RPT3 PE=1 SV=1 207 363 7.0E-07
sp|Q8U4H3|PAN_PYRFU Proteasome-activating nucleotidase OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=pan PE=1 SV=1 227 368 8.0E-07
sp|A9EXK6|FTSH4_SORC5 ATP-dependent zinc metalloprotease FtsH 4 OS=Sorangium cellulosum (strain So ce56) GN=ftsH4 PE=3 SV=1 217 363 8.0E-07
sp|A6LD25|FTSH_PARD8 ATP-dependent zinc metalloprotease FtsH OS=Parabacteroides distasonis (strain ATCC 8503 / DSM 20701 / NCTC 11152) GN=ftsH PE=3 SV=1 220 368 9.0E-07
sp|C8XAR0|ARC_NAKMY Proteasome-associated ATPase OS=Nakamurella multipartita (strain ATCC 700099 / DSM 44233 / JCM 9543 / Y-104) GN=arc PE=3 SV=1 242 368 9.0E-07
sp|P54778|PRS6B_SOLTU 26S protease regulatory subunit 6B homolog OS=Solanum tuberosum PE=2 SV=1 207 375 9.0E-07
sp|P85200|PRS6B_HELAN 26S protease regulatory subunit 6B homolog OS=Helianthus annuus PE=1 SV=1 207 363 9.0E-07
sp|Q2KIW6|PRS10_BOVIN 26S protease regulatory subunit 10B OS=Bos taurus GN=PSMC6 PE=2 SV=1 227 368 9.0E-07
sp|O80983|FTSH4_ARATH ATP-dependent zinc metalloprotease FTSH 4, mitochondrial OS=Arabidopsis thaliana GN=FTSH4 PE=1 SV=2 217 363 9.0E-07
sp|Q7TT47|SPG7_RAT Paraplegin OS=Rattus norvegicus GN=Spg7 PE=2 SV=1 220 382 1.0E-06
sp|P62334|PRS10_MOUSE 26S protease regulatory subunit 10B OS=Mus musculus GN=Psmc6 PE=1 SV=1 227 368 1.0E-06
sp|P62335|PRS10_ICTTR 26S protease regulatory subunit 10B OS=Ictidomys tridecemlineatus GN=PSMC6 PE=2 SV=1 227 368 1.0E-06
sp|P62333|PRS10_HUMAN 26S protease regulatory subunit 10B OS=Homo sapiens GN=PSMC6 PE=1 SV=1 227 368 1.0E-06
sp|Q96372|CDC48_CAPAN Cell division cycle protein 48 homolog OS=Capsicum annuum GN=CAFP PE=2 SV=1 237 375 1.0E-06
sp|D1J722|FTSH_ECTSI ATP-dependent zinc metalloprotease FtsH OS=Ectocarpus siliculosus GN=ftsH PE=3 SV=1 186 368 1.0E-06
sp|A1R6Q4|ARC_ARTAT Proteasome-associated ATPase OS=Arthrobacter aurescens (strain TC1) GN=arc PE=3 SV=1 232 383 1.0E-06
sp|Q3ULF4|SPG7_MOUSE Paraplegin OS=Mus musculus GN=Spg7 PE=1 SV=1 220 382 1.0E-06
sp|Q5AWS6|CDC48_EMENI Cell division control protein 48 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=cdc48 PE=1 SV=2 213 368 1.0E-06
sp|C8W731|FTSH_ATOPD ATP-dependent zinc metalloprotease FtsH OS=Atopobium parvulum (strain ATCC 33793 / DSM 20469 / JCM 10300 / VPI 0546) GN=ftsH PE=3 SV=1 216 363 1.0E-06
sp|Q9YAC7|PAN_AERPE Proteasome-activating nucleotidase OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=pan PE=3 SV=1 231 368 1.0E-06
sp|P46468|CDAT_PLAF7 Putative cell division cycle ATPase OS=Plasmodium falciparum (isolate 3D7) GN=PF07_0047 PE=3 SV=2 227 395 1.0E-06
sp|P36612|PRS4_SCHPO 26S protease regulatory subunit 4 homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mts2 PE=2 SV=1 212 363 1.0E-06
sp|Q8VZI8|FTSHA_ARATH ATP-dependent zinc metalloprotease FTSH 10, mitochondrial OS=Arabidopsis thaliana GN=FTSH10 PE=1 SV=1 226 368 1.0E-06
sp|Q07590|SAV_SULAC Protein SAV OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=sav PE=3 SV=2 237 368 1.0E-06
sp|B1GZK7|FTSH_UNCTG ATP-dependent zinc metalloprotease FtsH OS=Uncultured termite group 1 bacterium phylotype Rs-D17 GN=ftsH PE=3 SV=1 225 368 1.0E-06
sp|C5CES8|FTSH_KOSOT ATP-dependent zinc metalloprotease FtsH OS=Kosmotoga olearia (strain TBF 19.5.1) GN=ftsH PE=3 SV=1 214 368 1.0E-06
sp|P32794|AFG2_YEAST ATPase family gene 2 protein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AFG2 PE=1 SV=1 227 369 2.0E-06
sp|O83746|FTSH_TREPA ATP-dependent zinc metalloprotease FtsH OS=Treponema pallidum (strain Nichols) GN=ftsH PE=3 SV=1 216 368 2.0E-06
sp|Q5JHS5|PAN_THEKO Proteasome-activating nucleotidase OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=pan PE=3 SV=1 227 368 2.0E-06
sp|D5HA94|FTSH2_SALRM ATP-dependent zinc metalloprotease FtsH 2 OS=Salinibacter ruber (strain M8) GN=ftsH2 PE=3 SV=1 222 373 2.0E-06
sp|A3CV35|PAN_METMJ Proteasome-activating nucleotidase OS=Methanoculleus marisnigri (strain ATCC 35101 / DSM 1498 / JR1) GN=pan PE=3 SV=1 227 368 2.0E-06
sp|A9BHD3|FTSH2_PETMO ATP-dependent zinc metalloprotease FtsH 2 OS=Petrotoga mobilis (strain DSM 10674 / SJ95) GN=ftsH2 PE=3 SV=1 215 366 2.0E-06
sp|Q58556|Y1156_METJA Cell division cycle protein 48 homolog MJ1156 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ1156 PE=3 SV=1 227 368 2.0E-06
sp|Q58556|Y1156_METJA Cell division cycle protein 48 homolog MJ1156 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ1156 PE=3 SV=1 214 369 2.0E-06
sp|P57462|FTSH_BUCAI ATP-dependent zinc metalloprotease FtsH OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=ftsH PE=3 SV=2 220 366 2.0E-06
sp|Q58576|PAN_METJA Proteasome-activating nucleotidase OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=pan PE=1 SV=1 227 382 2.0E-06
sp|C5CBU4|ARC_MICLC AAA ATPase forming ring-shaped complexes OS=Micrococcus luteus (strain ATCC 4698 / DSM 20030 / JCM 1464 / NBRC 3333 / NCIMB 9278 / NCTC 2665 / VKM Ac-2230) GN=arc PE=3 SV=1 231 387 2.0E-06
sp|P39925|AFG3_YEAST Mitochondrial respiratory chain complexes assembly protein AFG3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AFG3 PE=1 SV=1 216 368 2.0E-06
sp|A6UQT3|PAN_METVS Proteasome-activating nucleotidase OS=Methanococcus vannielii (strain SB / ATCC 35089 / DSM 1224) GN=pan PE=3 SV=1 227 369 2.0E-06
sp|D4GUJ7|PAN1_HALVD Proteasome-activating nucleotidase 1 OS=Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2) GN=pan1 PE=1 SV=2 227 368 2.0E-06
sp|Q9UQ90|SPG7_HUMAN Paraplegin OS=Homo sapiens GN=SPG7 PE=1 SV=2 220 368 2.0E-06
sp|P46507|PRS6B_MANSE 26S protease regulatory subunit 6B OS=Manduca sexta PE=2 SV=1 216 405 2.0E-06
sp|Q8K9G8|FTSH_BUCAP ATP-dependent zinc metalloprotease FtsH OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=ftsH PE=3 SV=1 220 366 2.0E-06
sp|Q0DHL4|FTSH8_ORYSJ ATP-dependent zinc metalloprotease FTSH 8, mitochondrial OS=Oryza sativa subsp. japonica GN=FTSH8 PE=3 SV=1 226 368 3.0E-06
sp|Q0W257|PAN_METAR Proteasome-activating nucleotidase OS=Methanocella arvoryzae (strain DSM 22066 / NBRC 105507 / MRE50) GN=pan PE=3 SV=1 227 368 3.0E-06
sp|Q4R7L3|PRS6B_MACFA 26S protease regulatory subunit 6B OS=Macaca fascicularis GN=PSMC4 PE=2 SV=1 207 363 3.0E-06
sp|P43686|PRS6B_HUMAN 26S protease regulatory subunit 6B OS=Homo sapiens GN=PSMC4 PE=1 SV=2 207 363 3.0E-06
sp|Q3T030|PRS6B_BOVIN 26S protease regulatory subunit 6B OS=Bos taurus GN=PSMC4 PE=2 SV=1 207 363 3.0E-06
sp|Q63570|PRS6B_RAT 26S protease regulatory subunit 6B OS=Rattus norvegicus GN=Psmc4 PE=1 SV=1 207 363 3.0E-06
sp|P54775|PRS6B_MOUSE 26S protease regulatory subunit 6B OS=Mus musculus GN=Psmc4 PE=1 SV=2 207 363 3.0E-06
sp|A0LU46|ARC_ACIC1 Proteasome-associated ATPase OS=Acidothermus cellulolyticus (strain ATCC 43068 / 11B) GN=arc PE=3 SV=1 242 390 3.0E-06
sp|C5A6P8|PAN_THEGJ Proteasome-activating nucleotidase OS=Thermococcus gammatolerans (strain DSM 15229 / JCM 11827 / EJ3) GN=pan PE=3 SV=1 227 368 3.0E-06
sp|Q9P3A7|CDC48_SCHPO Cell division cycle protein 48 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cdc48 PE=1 SV=2 212 378 3.0E-06
sp|O74894|PRS6B_SCHPO 26S protease regulatory subunit 6B homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rpt3 PE=3 SV=1 227 363 4.0E-06
sp|Q6LWR0|PAN_METMP Proteasome-activating nucleotidase OS=Methanococcus maripaludis (strain S2 / LL) GN=pan PE=3 SV=1 227 369 4.0E-06
sp|A9A916|PAN_METM6 Proteasome-activating nucleotidase OS=Methanococcus maripaludis (strain C6 / ATCC BAA-1332) GN=pan PE=3 SV=1 227 369 4.0E-06
sp|A6VHR1|PAN_METM7 Proteasome-activating nucleotidase OS=Methanococcus maripaludis (strain C7 / ATCC BAA-1331) GN=pan PE=3 SV=1 227 369 4.0E-06
sp|A4G0S4|PAN_METM5 Proteasome-activating nucleotidase OS=Methanococcus maripaludis (strain C5 / ATCC BAA-1333) GN=pan PE=3 SV=1 227 369 4.0E-06
sp|Q89AF2|FTSH_BUCBP ATP-dependent zinc metalloprotease FtsH OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=ftsH PE=3 SV=1 220 366 4.0E-06
sp|O74445|PRS10_SCHPO Probable 26S protease subunit rpt4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rpt4 PE=3 SV=2 227 368 4.0E-06
sp|O28972|Y1297_ARCFU Cell division cycle protein 48 homolog AF_1297 OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=AF_1297 PE=3 SV=1 242 368 5.0E-06
sp|Q5SI82|FTSH_THET8 ATP-dependent zinc metalloprotease FtsH OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=ftsH PE=1 SV=1 223 368 5.0E-06
sp|Q7KN62|TERA_DROME Transitional endoplasmic reticulum ATPase TER94 OS=Drosophila melanogaster GN=TER94 PE=1 SV=1 237 388 5.0E-06
sp|B8GGN4|PAN_METPE Proteasome-activating nucleotidase OS=Methanosphaerula palustris (strain ATCC BAA-1556 / DSM 19958 / E1-9c) GN=pan PE=3 SV=1 227 368 5.0E-06
sp|P33299|PRS7_YEAST 26S protease regulatory subunit 7 homolog OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPT1 PE=1 SV=1 237 366 5.0E-06
sp|Q8NB90|SPAT5_HUMAN Spermatogenesis-associated protein 5 OS=Homo sapiens GN=SPATA5 PE=1 SV=3 227 368 6.0E-06
sp|Q8SSJ5|CDC48_ENCCU Cell division control protein 48 OS=Encephalitozoon cuniculi (strain GB-M1) GN=CDC48 PE=1 SV=1 213 368 6.0E-06
sp|Q3UMC0|SPAT5_MOUSE Spermatogenesis-associated protein 5 OS=Mus musculus GN=Spata5 PE=1 SV=2 237 368 7.0E-06
sp|O15381|NVL_HUMAN Nuclear valosin-containing protein-like OS=Homo sapiens GN=NVL PE=1 SV=1 243 369 7.0E-06
sp|Q5AWS6|CDC48_EMENI Cell division control protein 48 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=cdc48 PE=1 SV=2 227 369 7.0E-06
sp|Q84WU8|FTSH3_ARATH ATP-dependent zinc metalloprotease FTSH 3, mitochondrial OS=Arabidopsis thaliana GN=FTSH3 PE=1 SV=1 226 368 7.0E-06
sp|Q8S2A7|FTSH3_ORYSJ ATP-dependent zinc metalloprotease FTSH 3, mitochondrial OS=Oryza sativa subsp. japonica GN=FTSH3 PE=3 SV=1 226 368 7.0E-06
sp|P25694|CDC48_YEAST Cell division control protein 48 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CDC48 PE=1 SV=3 211 368 7.0E-06
sp|C7PVU9|ARC_CATAD Proteasome-associated ATPase OS=Catenulispora acidiphila (strain DSM 44928 / NRRL B-24433 / NBRC 102108 / JCM 14897) GN=arc PE=3 SV=1 242 368 8.0E-06
sp|Q1D491|FTSH_MYXXD ATP-dependent zinc metalloprotease FtsH OS=Myxococcus xanthus (strain DK 1622) GN=ftsH PE=3 SV=1 217 363 8.0E-06
sp|Q9LET7|CI111_ARATH Calmodulin-interacting protein 111 OS=Arabidopsis thaliana GN=CIP111 PE=1 SV=1 243 369 8.0E-06
sp|Q54CS8|PEX6_DICDI Peroxisomal biogenesis factor 6 OS=Dictyostelium discoideum GN=pex6 PE=3 SV=1 237 388 8.0E-06
sp|B7J0N5|FTSH_BORBZ ATP-dependent zinc metalloprotease FtsH OS=Borrelia burgdorferi (strain ZS7) GN=ftsH PE=3 SV=1 222 368 8.0E-06
sp|Q9HNP9|PAN2_HALSA Proteasome-activating nucleotidase 2 OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=pan2 PE=3 SV=1 211 368 9.0E-06
sp|Q6NH92|ARC_CORDI AAA ATPase forming ring-shaped complexes OS=Corynebacterium diphtheriae (strain ATCC 700971 / NCTC 13129 / Biotype gravis) GN=arc PE=3 SV=1 242 392 1.0E-05
sp|B4U7U4|FTSH_HYDS0 ATP-dependent zinc metalloprotease FtsH OS=Hydrogenobaculum sp. (strain Y04AAS1) GN=ftsH PE=3 SV=1 215 368 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0034551 mitochondrial respiratory chain complex III assembly Yes
GO:0005524 ATP binding Yes
GO:0030554 adenyl nucleotide binding No
GO:0017062 respiratory chain complex III assembly No
GO:0003674 molecular_function No
GO:0008144 drug binding No
GO:0036094 small molecule binding No
GO:0008150 biological_process No
GO:0033108 mitochondrial respiratory chain complex assembly No
GO:1901265 nucleoside phosphate binding No
GO:0005488 binding No
GO:0065003 protein-containing complex assembly No
GO:0034622 cellular protein-containing complex assembly No
GO:0097159 organic cyclic compound binding No
GO:0032559 adenyl ribonucleotide binding No
GO:0017004 cytochrome complex assembly No
GO:0017076 purine nucleotide binding No
GO:0032553 ribonucleotide binding No
GO:0022607 cellular component assembly No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0032555 purine ribonucleotide binding No
GO:0071840 cellular component organization or biogenesis No
GO:0016043 cellular component organization No
GO:0097367 carbohydrate derivative binding No
GO:0043168 anion binding No
GO:0043933 protein-containing complex subunit organization No
GO:0043167 ion binding No
GO:0000166 nucleotide binding No
GO:1901363 heterocyclic compound binding No
GO:0009987 cellular process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.5

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|9098
MSTANAPGSFFGLDALFGNPLFAGGIGLASLGAAAALARKGALVALGAARRRLLVNVEISKQDPAYPWILAWLSQ
PRETPGFFASRLTRIHNLSVSTTTGSSAPGVGRAANAHFFLQPGYGRHIVKFGSAYIAVNREKHSTANMNTGEPH
EIVQLTTLWAHRHAFEAIFGQAHRLAAKANEGKTVVFSARGLEWAPLGDPRKKRPLGSVILDQGVKESIVADVRD
FLSRQQWYVDRGVPYRRGYLLFGPPGSGKSSFIQALAGDLDFSVAMINLSETGMTDDKLAYLLTKLPKRSLLLLE
DADAAFVNRRQRDADGYSGASVTFSGLLNALDGVAAGEERIAFLTTNHVERMDPALVRPGRVDMMVRIGEATRFQ
AAQMWDRFYGDVDPDASWRERFLQRLDRLGVFGGERGDGKPSRRHTSTAAIQGLFLFNKNDMQGAIGMADMLVPR
ELEADSMSPTVATKAPT*
Coding >Hirsu2|9098
ATGTCGACCGCAAACGCTCCGGGCTCGTTCTTCGGCCTCGATGCCCTGTTCGGCAACCCGCTGTTCGCCGGAGGC
ATCGGCCTGGCCTCGCTCGGGGCCGCCGCCGCCTTGGCCCGCAAGGGCGCCCTCGTCGCCCTCGGCGCCGCCCGC
CGCCGCCTGCTCGTCAACGTCGAGATCAGCAAGCAGGATCCCGCGTACCCTTGGATCCTGGCTTGGCTATCGCAG
CCGCGCGAGACGCCCGGCTTCTTCGCCTCGCGCCTGACGCGCATCCACAACTTGTCCGTGTCGACGACGACGGGC
TCGAGCGCCCCCGGCGTCGGGAGGGCCGCCAACGCCCACTTCTTCCTGCAGCCCGGCTACGGGCGGCACATCGTC
AAGTTCGGCAGCGCCTACATTGCCGTCAACCGGGAGAAGCACAGCACTGCCAACATGAACACGGGCGAGCCGCAC
GAGATCGTCCAGCTGACGACGCTCTGGGCTCACCGTCACGCCTTCGAGGCCATCTTCGGCCAAGCCCATCGGCTG
GCTGCCAAGGCGAACGAGGGCAAGACGGTCGTCTTCTCCGCCCGCGGCTTGGAGTGGGCGCCCCTCGGCGACCCG
AGAAAGAAACGGCCGCTTGGCTCCGTCATACTCGACCAGGGCGTCAAGGAGAGCATCGTGGCCGACGTCAGGGAC
TTCCTGTCGAGGCAGCAGTGGTATGTCGACAGGGGCGTTCCCTACCGCAGGGGCTACCTCTTGTTCGGCCCCCCG
GGCAGCGGCAAGAGCTCCTTCATCCAGGCCCTGGCCGGAGACCTCGACTTCAGCGTGGCCATGATCAACCTCAGC
GAGACGGGCATGACGGACGACAAGCTGGCCTACCTCCTGACGAAGCTGCCCAAGCGCAGCTTGTTGTTGCTCGAA
GACGCCGACGCCGCCTTCGTCAACCGGCGCCAGCGCGACGCCGACGGCTACTCGGGCGCCAGCGTCACCTTCTCC
GGCCTCCTCAACGCCTTGGACGGCGTGGCCGCCGGCGAGGAACGCATAGCCTTCCTGACCACCAACCACGTCGAG
CGCATGGACCCGGCACTGGTCAGGCCCGGCCGCGTCGACATGATGGTTCGCATAGGCGAGGCGACGAGATTCCAG
GCAGCGCAGATGTGGGATCGCTTCTACGGCGACGTCGACCCGGATGCGTCCTGGAGAGAGCGCTTCCTGCAGCGG
CTCGACCGGCTGGGCGTCTTTGGTGGCGAACGCGGAGACGGCAAGCCCTCCCGCCGACACACCAGCACGGCTGCC
ATCCAGGGCTTGTTCTTGTTCAACAAGAACGACATGCAGGGGGCGATTGGCATGGCTGACATGCTGGTGCCGCGG
GAGCTCGAGGCCGACAGCATGAGCCCGACCGTTGCCACCAAGGCGCCCACGTAG
Transcript >Hirsu2|9098
ATGTCGACCGCAAACGCTCCGGGCTCGTTCTTCGGCCTCGATGCCCTGTTCGGCAACCCGCTGTTCGCCGGAGGC
ATCGGCCTGGCCTCGCTCGGGGCCGCCGCCGCCTTGGCCCGCAAGGGCGCCCTCGTCGCCCTCGGCGCCGCCCGC
CGCCGCCTGCTCGTCAACGTCGAGATCAGCAAGCAGGATCCCGCGTACCCTTGGATCCTGGCTTGGCTATCGCAG
CCGCGCGAGACGCCCGGCTTCTTCGCCTCGCGCCTGACGCGCATCCACAACTTGTCCGTGTCGACGACGACGGGC
TCGAGCGCCCCCGGCGTCGGGAGGGCCGCCAACGCCCACTTCTTCCTGCAGCCCGGCTACGGGCGGCACATCGTC
AAGTTCGGCAGCGCCTACATTGCCGTCAACCGGGAGAAGCACAGCACTGCCAACATGAACACGGGCGAGCCGCAC
GAGATCGTCCAGCTGACGACGCTCTGGGCTCACCGTCACGCCTTCGAGGCCATCTTCGGCCAAGCCCATCGGCTG
GCTGCCAAGGCGAACGAGGGCAAGACGGTCGTCTTCTCCGCCCGCGGCTTGGAGTGGGCGCCCCTCGGCGACCCG
AGAAAGAAACGGCCGCTTGGCTCCGTCATACTCGACCAGGGCGTCAAGGAGAGCATCGTGGCCGACGTCAGGGAC
TTCCTGTCGAGGCAGCAGTGGTATGTCGACAGGGGCGTTCCCTACCGCAGGGGCTACCTCTTGTTCGGCCCCCCG
GGCAGCGGCAAGAGCTCCTTCATCCAGGCCCTGGCCGGAGACCTCGACTTCAGCGTGGCCATGATCAACCTCAGC
GAGACGGGCATGACGGACGACAAGCTGGCCTACCTCCTGACGAAGCTGCCCAAGCGCAGCTTGTTGTTGCTCGAA
GACGCCGACGCCGCCTTCGTCAACCGGCGCCAGCGCGACGCCGACGGCTACTCGGGCGCCAGCGTCACCTTCTCC
GGCCTCCTCAACGCCTTGGACGGCGTGGCCGCCGGCGAGGAACGCATAGCCTTCCTGACCACCAACCACGTCGAG
CGCATGGACCCGGCACTGGTCAGGCCCGGCCGCGTCGACATGATGGTTCGCATAGGCGAGGCGACGAGATTCCAG
GCAGCGCAGATGTGGGATCGCTTCTACGGCGACGTCGACCCGGATGCGTCCTGGAGAGAGCGCTTCCTGCAGCGG
CTCGACCGGCTGGGCGTCTTTGGTGGCGAACGCGGAGACGGCAAGCCCTCCCGCCGACACACCAGCACGGCTGCC
ATCCAGGGCTTGTTCTTGTTCAACAAGAACGACATGCAGGGGGCGATTGGCATGGCTGACATGCTGGTGCCGCGG
GAGCTCGAGGCCGACAGCATGAGCCCGACCGTTGCCACCAAGGCGCCCACGTAG
Gene >Hirsu2|9098
ATGTCGACCGCAAACGCTCCGGGCTCGTTCTTCGGCCTCGATGCCCTGTTCGGCAACCCGCTGTTCGCCGGAGGC
ATCGGCCTGGCCTCGCTCGGGGCCGCCGCCGCCTTGGCCCGCAAGGGCGCCCTCGTCGCCCTCGGCGCCGCCCGC
CGCCGCCTGCTCGTCAACGTCGAGATCAGCAAGCAGGATCCCGCGTACCCTTGGATCCTGGCTTGGCTATCGCAG
CCGCGCGAGACGCCCGGCTTCTTCGCCTCGCGCCTGACGCGCATCCACAACTTGTCCGTGTCGACGACGACGGGC
TCGAGCGCCCCCGGCGTCGGGAGGGCCGCCAACGCCCACTTCTTCCTGCAGCCCGGCTACGGGCGGCACATCGTC
AAGTTCGGCAGCGCCTACATTGCCGTCAACCGGGAGAAGCACAGCACTGCCAACATGAACACGGGCGAGCCGCAC
GAGATCGTCCAGCTGACGACGCTCTGGGCTCACCGTCACGCCTTCGAGGCCATCTTCGGCCAAGCCCATCGGCTG
GCTGCCAAGGCGAACGAGGGCAAGACGGTCGTCTTCTCCGCCCGCGGCTTGGAGTGGGCGCCCCTCGGCGACCCG
AGAAAGAAACGGCCGCTTGGCTCCGTCATACTCGACCAGGGCGTCAAGGAGAGCATCGTGGCCGACGTCAGGGAC
TTCCTGTCGAGGCAGCAGTGGTATGTCGACAGGGGCGTTCCCTACCGCAGGGGCTACCTCTTGTTCGGCCCCCCG
GGCAGCGGCAAGAGCTCCTTCATCCAGGCCCTGGCCGGAGACCTCGACTTCAGCGTGGCCATGATCAACCTCAGC
GAGACGGGCATGACGGACGACAAGCTGGCCTACCTCCTGACGAAGCTGCCCAAGCGCAGCTTGTTGTTGCTCGAA
GACGCCGACGCCGCCTTCGTCAACCGGCGCCAGCGCGACGCCGACGGCTACTCGGGCGCCAGCGTCACCTTCTCC
GGCCTCCTCAACGCCTTGGACGGCGTGGCCGCCGGCGAGGAACGCATAGCCTTCCTGACCACCAACCACGTCGAG
CGCATGGACCCGGCACTGGTCAGGCCCGGCCGCGTCGACATGATGGTTCGCATAGGCGAGGCGACGAGATTCCAG
GCAGCGCAGATGTGGGATCGCTTCTACGGCGACGTCGACCCGGATGCGTCCTGGAGAGAGCGCTTCCTGCAGCGG
CTCGACCGGCTGGGCGTCTTTGGTGGCGAACGCGGAGACGGCAAGCCCTCCCGCCGACACACCAGCACGGCTGCC
ATCCAGGGCTTGTTCTTGTTCAACAAGAACGACATGCAGGGGGCGATTGGCATGGCTGACATGCTGGTGCCGCGG
GAGCTCGAGGCCGACAGCATGAGCCCGACCGTTGCCACCAAGGCGCCCACGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail