Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|9094
Gene name
LocationContig_639:7346..9909
Strand+
Gene length (bp)2563
Transcript length (bp)1845
Coding sequence length (bp)1845
Protein length (aa) 615

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00860 Xan_ur_permease Permease family 2.5E-23 114 491

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O94300|YOOH_SCHPO Putative xanthine/uracil permease C887.17 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC887.17 PE=3 SV=1 29 604 0.0E+00
sp|Q9SRK7|AZG1_ARATH Adenine/guanine permease AZG1 OS=Arabidopsis thaliana GN=AZG1 PE=2 SV=1 17 516 2.0E-130
sp|Q84MA8|AZG2_ARATH Adenine/guanine permease AZG2 OS=Arabidopsis thaliana GN=AZG2 PE=2 SV=1 28 516 2.0E-100
sp|Q57772|Y326_METJA Putative permease MJ0326 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ0326 PE=3 SV=1 58 520 1.0E-59
sp|O34978|PBUO_BACSU Guanine/hypoxanthine permease PbuO OS=Bacillus subtilis (strain 168) GN=pbuO PE=1 SV=1 55 516 4.0E-52
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O94300|YOOH_SCHPO Putative xanthine/uracil permease C887.17 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC887.17 PE=3 SV=1 29 604 0.0E+00
sp|Q9SRK7|AZG1_ARATH Adenine/guanine permease AZG1 OS=Arabidopsis thaliana GN=AZG1 PE=2 SV=1 17 516 2.0E-130
sp|Q84MA8|AZG2_ARATH Adenine/guanine permease AZG2 OS=Arabidopsis thaliana GN=AZG2 PE=2 SV=1 28 516 2.0E-100
sp|Q57772|Y326_METJA Putative permease MJ0326 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ0326 PE=3 SV=1 58 520 1.0E-59
sp|O34978|PBUO_BACSU Guanine/hypoxanthine permease PbuO OS=Bacillus subtilis (strain 168) GN=pbuO PE=1 SV=1 55 516 4.0E-52
sp|O34987|PBUG_BACSU Guanine/hypoxanthine permease PbuG OS=Bacillus subtilis (strain 168) GN=pbuG PE=1 SV=1 57 514 1.0E-51
sp|P31440|ADEQ_ECOLI Adenine permease AdeQ OS=Escherichia coli (strain K12) GN=adeQ PE=1 SV=3 29 516 2.0E-51
sp|P31466|ADEP_ECOLI Adenine permease AdeP OS=Escherichia coli (strain K12) GN=adeP PE=1 SV=2 60 516 2.0E-44
sp|P0AF52|GHXP_ECOLI Guanine/hypoxanthine permease GhxP OS=Escherichia coli (strain K12) GN=ghxP PE=1 SV=1 60 508 9.0E-32
sp|P0AF53|GHXP_ECO57 Guanine/hypoxanthine permease GhxP OS=Escherichia coli O157:H7 GN=ghxP PE=3 SV=1 60 508 9.0E-32
sp|P44530|Y125_HAEIN Putative permease HI_0125 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=HI_0125 PE=3 SV=1 60 508 3.0E-28
sp|Q46817|GHXQ_ECOLI Guanine/hypoxanthine permease GhxQ OS=Escherichia coli (strain K12) GN=ghxQ PE=1 SV=2 365 536 3.0E-13
sp|Q46817|GHXQ_ECOLI Guanine/hypoxanthine permease GhxQ OS=Escherichia coli (strain K12) GN=ghxQ PE=1 SV=2 60 222 5.0E-13
[Show less]

GO

GO Term Description Terminal node
GO:0055085 transmembrane transport Yes
GO:0022857 transmembrane transporter activity Yes
GO:0016020 membrane Yes
GO:0008150 biological_process No
GO:0006810 transport No
GO:0051234 establishment of localization No
GO:0003674 molecular_function No
GO:0051179 localization No
GO:0005575 cellular_component No
GO:0005215 transporter activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 38 0.45

Transmembrane Domains

Domain # Start End Length
1 129 151 22
2 171 193 22
3 213 235 22
4 269 286 17
5 291 310 19
6 344 366 22
7 402 424 22
8 434 456 22
9 477 499 22
10 503 525 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|9094
MERPSDQQSSAASLASPEPSLRSRFFGFRDFFDYVDGRITTSRFGRLFRLSGTGHPDEIQGATFLREFRAGLTTF
TTMAYIVAVNASLLAQTGGTCACNLTPKELCDTVPEFAACKEEVRRDLITATAALAGMASIVFGALTNLPVALAP
GMGLNAYFAFQVVGVNGSGNISYRTALTAVFFEGIIFIVLALTGLRQWLVRLIPATIKTATGVGIGFFLTEIGLS
YSVGIGAITGGGRSTPLALGGCPLELVDKQSGVCSAGQMTNPKMWVGIFCGGIVTSFLMAFRVKYAFVIGIALVS
VLSWPRHTAISYFPDTDEGNARFDFFQKVIAWHPMGKMANQLDWAFSTGGSHFALALFTFLYVDIIDATATLYSM
VRFCGVVNREDGDFPRSTVAYCTDAAFISIGALLGSSPVTVFIESGAGIAEGGRTGLTAIVAGLCFIASVFFSPV
FASIPPWATGCTLVMVGCMMIRQITQINWQYIGDVLPSFVVMAFIPFSYSVAYGLIAGLFVYAVLNGLVGLVVCL
SGGRIEPREYELKEYWTWKGAGRPPWFVKAIQTRRRQREAKEMTSGQGVEVDDGQGSSEQPDPRADSSAKECAVA
AKDSVSSAYNHVGC*
Coding >Hirsu2|9094
ATGGAGCGACCCAGCGACCAGCAGTCCAGCGCCGCCTCTCTCGCTTCGCCCGAGCCCAGCCTGCGGTCGCGCTTC
TTTGGCTTCCGCGATTTCTTCGACTACGTCGACGGGCGCATTACCACCTCCCGCTTCGGCCGCCTCTTCCGCCTC
TCCGGGACCGGCCACCCGGACGAAATACAAGGCGCCACCTTCCTCCGCGAGTTCCGAGCCGGCCTGACGACCTTC
ACCACCATGGCATATATCGTGGCCGTAAACGCGTCGCTGCTGGCCCAGACAGGCGGCACATGCGCCTGCAATCTC
ACCCCCAAGGAGCTGTGTGATACGGTTCCCGAGTTCGCGGCCTGCAAAGAAGAGGTGCGAAGGGACTTGATCACG
GCGACGGCCGCGCTGGCCGGCATGGCCTCGATCGTCTTCGGCGCCTTGACGAATCTCCCTGTGGCTCTAGCTCCA
GGGATGGGCCTCAACGCCTACTTCGCATTTCAGGTCGTCGGCGTTAACGGCAGCGGCAACATCTCGTACCGCACC
GCCCTCACCGCCGTTTTCTTTGAGGGCATCATCTTCATCGTCCTTGCCCTCACCGGCCTGCGCCAGTGGCTCGTC
CGGCTGATCCCCGCCACCATCAAGACGGCCACCGGCGTCGGCATCGGCTTCTTCCTGACCGAGATTGGACTGTCG
TACTCGGTCGGCATCGGCGCCATCACGGGTGGGGGCCGGTCCACGCCCCTCGCCCTGGGAGGCTGTCCGCTCGAG
CTGGTCGACAAGCAGTCGGGCGTCTGCTCGGCCGGCCAGATGACGAATCCCAAGATGTGGGTGGGCATCTTTTGC
GGCGGCATCGTCACCTCCTTTCTCATGGCTTTCCGCGTCAAGTACGCCTTCGTGATCGGCATAGCCCTCGTTTCC
GTCCTATCCTGGCCCCGCCACACGGCCATCTCTTACTTTCCCGACACCGACGAGGGCAACGCTCGCTTCGATTTC
TTCCAAAAGGTCATCGCCTGGCACCCCATGGGCAAGATGGCTAACCAGCTGGACTGGGCGTTCAGTACCGGCGGC
TCCCACTTTGCCCTGGCCCTCTTCACATTCCTGTACGTCGACATCATCGACGCCACCGCCACGCTCTACTCCATG
GTCCGCTTCTGCGGCGTCGTGAACCGTGAGGACGGCGACTTCCCCCGCTCGACCGTCGCCTACTGCACCGACGCC
GCCTTCATCTCCATCGGCGCCTTGCTGGGGTCATCGCCCGTGACCGTCTTCATCGAGAGCGGCGCCGGCATCGCC
GAGGGCGGGCGCACAGGGCTCACTGCCATCGTCGCCGGCCTGTGTTTTATCGCCTCCGTCTTCTTCTCTCCCGTG
TTTGCATCCATTCCTCCGTGGGCGACGGGCTGCACTCTTGTCATGGTCGGCTGCATGATGATTCGGCAAATCACC
CAAATCAACTGGCAGTATATCGGAGACGTCCTCCCGTCCTTTGTCGTCATGGCCTTCATCCCTTTCAGCTACAGC
GTAGCCTATGGCCTAATCGCCGGCCTCTTCGTGTACGCTGTCCTCAACGGCCTGGTGGGCCTCGTCGTCTGCCTG
AGCGGCGGCCGCATCGAGCCCCGCGAGTACGAGCTGAAGGAGTATTGGACCTGGAAAGGCGCAGGCCGTCCCCCC
TGGTTCGTGAAGGCGATCCAGACTCGTCGCAGACAAAGGGAGGCCAAGGAAATGACGAGCGGGCAGGGCGTCGAG
GTTGACGACGGCCAGGGCTCCTCGGAGCAGCCGGATCCACGCGCTGATTCCTCTGCCAAGGAGTGTGCCGTGGCC
GCCAAAGACTCTGTGTCGTCAGCCTACAACCATGTCGGCTGCTGA
Transcript >Hirsu2|9094
ATGGAGCGACCCAGCGACCAGCAGTCCAGCGCCGCCTCTCTCGCTTCGCCCGAGCCCAGCCTGCGGTCGCGCTTC
TTTGGCTTCCGCGATTTCTTCGACTACGTCGACGGGCGCATTACCACCTCCCGCTTCGGCCGCCTCTTCCGCCTC
TCCGGGACCGGCCACCCGGACGAAATACAAGGCGCCACCTTCCTCCGCGAGTTCCGAGCCGGCCTGACGACCTTC
ACCACCATGGCATATATCGTGGCCGTAAACGCGTCGCTGCTGGCCCAGACAGGCGGCACATGCGCCTGCAATCTC
ACCCCCAAGGAGCTGTGTGATACGGTTCCCGAGTTCGCGGCCTGCAAAGAAGAGGTGCGAAGGGACTTGATCACG
GCGACGGCCGCGCTGGCCGGCATGGCCTCGATCGTCTTCGGCGCCTTGACGAATCTCCCTGTGGCTCTAGCTCCA
GGGATGGGCCTCAACGCCTACTTCGCATTTCAGGTCGTCGGCGTTAACGGCAGCGGCAACATCTCGTACCGCACC
GCCCTCACCGCCGTTTTCTTTGAGGGCATCATCTTCATCGTCCTTGCCCTCACCGGCCTGCGCCAGTGGCTCGTC
CGGCTGATCCCCGCCACCATCAAGACGGCCACCGGCGTCGGCATCGGCTTCTTCCTGACCGAGATTGGACTGTCG
TACTCGGTCGGCATCGGCGCCATCACGGGTGGGGGCCGGTCCACGCCCCTCGCCCTGGGAGGCTGTCCGCTCGAG
CTGGTCGACAAGCAGTCGGGCGTCTGCTCGGCCGGCCAGATGACGAATCCCAAGATGTGGGTGGGCATCTTTTGC
GGCGGCATCGTCACCTCCTTTCTCATGGCTTTCCGCGTCAAGTACGCCTTCGTGATCGGCATAGCCCTCGTTTCC
GTCCTATCCTGGCCCCGCCACACGGCCATCTCTTACTTTCCCGACACCGACGAGGGCAACGCTCGCTTCGATTTC
TTCCAAAAGGTCATCGCCTGGCACCCCATGGGCAAGATGGCTAACCAGCTGGACTGGGCGTTCAGTACCGGCGGC
TCCCACTTTGCCCTGGCCCTCTTCACATTCCTGTACGTCGACATCATCGACGCCACCGCCACGCTCTACTCCATG
GTCCGCTTCTGCGGCGTCGTGAACCGTGAGGACGGCGACTTCCCCCGCTCGACCGTCGCCTACTGCACCGACGCC
GCCTTCATCTCCATCGGCGCCTTGCTGGGGTCATCGCCCGTGACCGTCTTCATCGAGAGCGGCGCCGGCATCGCC
GAGGGCGGGCGCACAGGGCTCACTGCCATCGTCGCCGGCCTGTGTTTTATCGCCTCCGTCTTCTTCTCTCCCGTG
TTTGCATCCATTCCTCCGTGGGCGACGGGCTGCACTCTTGTCATGGTCGGCTGCATGATGATTCGGCAAATCACC
CAAATCAACTGGCAGTATATCGGAGACGTCCTCCCGTCCTTTGTCGTCATGGCCTTCATCCCTTTCAGCTACAGC
GTAGCCTATGGCCTAATCGCCGGCCTCTTCGTGTACGCTGTCCTCAACGGCCTGGTGGGCCTCGTCGTCTGCCTG
AGCGGCGGCCGCATCGAGCCCCGCGAGTACGAGCTGAAGGAGTATTGGACCTGGAAAGGCGCAGGCCGTCCCCCC
TGGTTCGTGAAGGCGATCCAGACTCGTCGCAGACAAAGGGAGGCCAAGGAAATGACGAGCGGGCAGGGCGTCGAG
GTTGACGACGGCCAGGGCTCCTCGGAGCAGCCGGATCCACGCGCTGATTCCTCTGCCAAGGAGTGTGCCGTGGCC
GCCAAAGACTCTGTGTCGTCAGCCTACAACCATGTCGGCTGCTGA
Gene >Hirsu2|9094
ATGGAGCGACCCAGCGACCAGCAGTCCAGCGCCGCCTCTCTCGCTTCGCCCGAGCCCAGCCTGCGGTCGCGCTTC
TTTGGCTTCCGCGATTTCTTCGACTACGTCGACGGGCGCATTACCACCTCCCGCTTCGGCCGCCTCTTCCGCCTC
TCCGGGACCGGCCACGTAAGTTGTTTGGGTCGAGGCGCGAGAAGGCCGCGTCGAGTTCTGTCGACGAGATGGGTG
CGAGACTGACGCCCCCGACCAGCCGGACGAAATACAAGGCGCCACCTTCCTCCGCGAGTTCCGAGCCGGCCTGAC
GACCTTCACCACCATGGCATATATCGTGGCCGTAAACGTTGGTCGTCTCCGCCCCCCTCCCTGAGTCTCCCTCTC
CCCAGCAACGGCCTTCGAGTGTCGGTTCGCCAGTAGCCTGACTCGGCGCAGGCGTCGCTGCTGGCCCAGACAGGC
GGCACATGCGCCTGCAATCTCACCCCCAAGGAGCTGTGTGATACGGTTCCCGAGTTCGCGGCCTGCAAAGAAGGT
GGGCGCTCCGCCATCTCCCCCCTCGCCTTTACATCTTGCGCGGACGCGCTGGCCGCCGGCTCTCGACTGACGCCT
CGAGCAGAGGTGCGAAGGGACTTGATCACGGCGACGGCCGCGCTGGCCGGCATGGCCTCGATCGTCTTCGGCGCC
TTGACGAATCTCCCTGTGGCTCTAGCGTACGCCGTCCCTCTCCCCCTCTTGGAACACTCCACTGTTCTTTTCTCT
CATGACTTTCACCGCGGAAAAAAAAAAAGTGACTCCAGGGTCTAACCGCCTCCTCCAGTCCAGGGATGGGCCTCA
ACGCCTACTTCGCATTTCAGGTAGAGTGAAGCCTCGCCGGATCAGGAGTCGTGGCCTGGCGTGACGCCGTTTGCC
CTCTGACATCTTCTGGGCAGGTCGTCGGCGTTAACGGCAGCGGCAACATCTCGTACCGCACCGCCCTCACCGCCG
TTTTCTTTGAGGGCATCATCTTCATCGTCCTTGCCCTCACCGGCCTGCGCCAGTGGCTCGTCCGGCTGATCCCCG
CCACCATCAAGACGGCCACCGGCGTCGGCATCGGCTTCTTCCTGACCGAGATTGGACTGTCGTACTCGGTCGGCA
TCGGCGCCATCACGGGTGGGGGCCGGTCCACGCCCCTCGCCCTGGGAGGCTGTCCGCTCGAGCTGGTCGACAAGC
AGTCGGGCGTCTGCTCGGCCGGCCAGATGACGAATCCCAAGGTATGCACCATGGGCCCCTTCGCCCGGTCGTGGC
CGACTGTCTGACGAGTGACGTCTGGTTGGAGATGTGGGTGGGCATCTTTTGCGGCGGCATCGTCACCTCCTTTCT
CATGGCTTTCCGCGTCAAGTACGCCTTCGTGATCGGCATAGCCCTCGTTTCCGTCCTATCCTGGCCGTAAGTCGC
CGCCGTTTGGTACCCCTTCCCCGGTGGTCCTGACGCCCCCAGCAGCCGCCACACGGCCATCTCTTACTTTCCCGA
CACCGACGAGGGCAACGCTCGCTTCGATTTCTTCCAAAAGGTCATCGCCTGGCACCCCATGGGCAAGATGGCTAA
CCAGCTGGACTGGGCGTTCAGTACCGGCGGCTCCCACTTTGCCCTGGCCCTCTTCACATTCCTGTACGTCGACAT
CATCGACGCCACCGCCACGCTCTACTCCATGGTCCGCTTCTGCGGCGTCGTGAACCGTGAGGACGGCGACTTCCC
CCGCTCGACCGTCGCCTACTGCACCGACGCCGCCTTCATCTCCATCGGCGCCTTGCTGGGGTCATCGCCCGTGAC
CGTCTTCATCGAGAGCGGCGCCGGCATCGCCGAGGGCGGGCGCACAGGGCTCACTGCCATCGTCGCCGGCCTGTG
TTTTATCGCCTCCGTCTTCTTCTCTCCCGTGTTTGCATCCATTCCTCCGTGGGCGACGGGCTGCACTCTTGTCAT
GGTATGTCTCATCTTCTCTCTCTCTTGCCACGTGACGGAAAGAGAAAGGAGTTTGGGGGCCCGGACCGTTGACGC
CTTAGCGTCTCCCTCTCAAGGTCGGCTGCATGATGATTCGGCAAATCACCCAAATCAACTGGCAGTATATCGGAG
ACGTCCTCCCGTCCTTTGTCGTCATGGCCTTCATCCCTTTCAGCTACAGCGTAGCCTATGGCCTAATCGCGTAAG
CAGACCAAGGCCCCCTCAGGTGGGGAAGAGAACCAAGACAACTGATGAACGACCGAATCGCAGCGGCCTCTTCGT
GTACGCTGTCCTCAACGGCCTGGTGGGCCTCGTCGTCTGCCTGAGCGGCGGCCGCATCGAGCCCCGCGAGTACGA
GCTGAAGGAGTATTGGACCTGGAAAGGCGCAGGCCGTCCCCCCTGGTTCGTGAAGGCGATCCAGACTCGTCGCAG
ACAAAGGGAGGCCAAGGAAATGACGAGCGGGCAGGGCGTCGAGGTTGACGACGGCCAGGGCTCCTCGGAGCAGCC
GGATCCACGCGCTGATTCCTCTGCCAAGGAGTGTGCCGTGGCCGCCAAAGACTCTGTGTCGTCAGCCTACAACCA
TGTCGGCTGCTGA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail