Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|9090
Gene name
LocationContig_638:6360..10821
Strand+
Gene length (bp)4461
Transcript length (bp)4185
Coding sequence length (bp)4185
Protein length (aa) 1395

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07989 Cnn_1N Centrosomin N-terminal motif 1 8.7E-26 228 299
PF10495 PACT_coil_coil Pericentrin-AKAP-450 domain of centrosomal targeting protein 1.9E-20 1267 1355

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q92351|PCP1_SCHPO Spindle pole body protein pcp1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pcp1 PE=1 SV=1 70 588 3.0E-13
sp|O60039|APSB_EMENI Anucleate primary sterigmata protein B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=apsB PE=4 SV=2 227 301 5.0E-08
sp|Q19UN5|CK5P2_PANTR CDK5 regulatory subunit-associated protein 2 OS=Pan troglodytes GN=CDK5RAP2 PE=2 SV=1 183 302 7.0E-07
sp|Q96SN8|CK5P2_HUMAN CDK5 regulatory subunit-associated protein 2 OS=Homo sapiens GN=CDK5RAP2 PE=1 SV=5 183 302 1.0E-06
sp|Q5VU43|MYOME_HUMAN Myomegalin OS=Homo sapiens GN=PDE4DIP PE=1 SV=1 236 686 2.0E-06
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q92351|PCP1_SCHPO Spindle pole body protein pcp1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pcp1 PE=1 SV=1 70 588 3.0E-13
sp|O60039|APSB_EMENI Anucleate primary sterigmata protein B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=apsB PE=4 SV=2 227 301 5.0E-08
sp|Q19UN5|CK5P2_PANTR CDK5 regulatory subunit-associated protein 2 OS=Pan troglodytes GN=CDK5RAP2 PE=2 SV=1 183 302 7.0E-07
sp|Q96SN8|CK5P2_HUMAN CDK5 regulatory subunit-associated protein 2 OS=Homo sapiens GN=CDK5RAP2 PE=1 SV=5 183 302 1.0E-06
sp|Q5VU43|MYOME_HUMAN Myomegalin OS=Homo sapiens GN=PDE4DIP PE=1 SV=1 236 686 2.0E-06
sp|Q9BE52|CK5P2_MACFA CDK5 regulatory subunit-associated protein 2 OS=Macaca fascicularis GN=CDK5RAP2 PE=2 SV=1 136 665 3.0E-06
sp|Q8K389|CK5P2_MOUSE CDK5 regulatory subunit-associated protein 2 OS=Mus musculus GN=Cdk5rap2 PE=1 SV=3 188 302 3.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005815 microtubule organizing center Yes
GO:0044446 intracellular organelle part No
GO:0044430 cytoskeletal part No
GO:0044464 cell part No
GO:0044424 intracellular part No
GO:0044422 organelle part No
GO:0005575 cellular_component No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 41 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|9090
MIRHHESTPLLCSFARDGRQQLPKAPTCFAFLLLRATPDALKPPRPPAMVQPGLGGALDTPRTNIGDATFLSRPP
NFADVSREASFQSPGKDGDLLHQLRNGRCNGLNLRTPRQRGPLADRRNLPPSVGGAEFTPLLKSATRNSVRRYGK
ENGAAVQNTPALNKIDEDDVTPIPRVDTSVYLGSHNQSYLDNHTLPQVDSSSVASTPMALKPRRSRDKGPLQDGN
QLSLREQENVIDRIEKENFGLKLKIHFLEDALRKAGPGFSEAALKENTELKVDKVTMQRELHRYKKHLTLAERDL
ESYRQQMLEFQDKTKRKNLDGGNRAELEQLQKTLQEREADVDQLQRQVDKGRRDDGELEKLKDNIEDLEADLRER
DRIITEREDALEDLRDKLEDAEDRARDPQQLAAETEKARVNEEELEEARETIQELERNVRRLEAQVEELKGRTEE
ALAQKDQAEQDLQELHEELANKSVVTKGLSRQLDDKVARLQGELERSSKEYATLEKQLASANEENGRLQTAVKGL
RQESKNFEHRRESDSIRMQELEAELLAVGDERDLLQARHDALSKESAALQEDVQRLGKDVKELEEGMSREREYAL
EIEKDLRSQYGDEIQRLNDEISDLQAEIREKDNLYDNDSEKWENQKQTLECERDRAEEKAIGLQRTIDRLPEAEG
NLSDKEYKLKEAIESETERHKSEEATMARQIEDLQDALETRQTLLASLRNELSLVREELRQTQIDYQTQVNKVVA
LEDEVEVLQTSSATSGRQEVEAAGRECESLRRQLKELQQQLKESSAGDSPVADRSGLQPAESMARLRNQFSDATA
QLERATKEKKSLQDRFAALNAELHSTWTSLAEAKAERDELDEQLRRASAHDNDTLRIDQERLDLRTAKMKLDNEV
RRLRDENKALSEQRAAVEKTLEDELDKAAVEEERLGQEVLQLQAQLRQSSTSESQDLATARRTVHKLERRVQDYQ
MQLASAQAPEGEDHSSSEMSMVRKDLSTSRQKEMEFLQREAAQRDVIKGLRKQIAALERQLHDHEVLRLIASPAA
PSDQGETASGLREQLSAAQQSAHEWKSKIREAEQRAAQAAQDQQRQLGDLEDQKLVLEEVLEEARLQAEEAAARH
DKAARRMQHRLDRVERERDAAAAAQTASSKQDRHLRRSRAEVDNLEHDVRQQQELIDGLVAAEACLRRKLERARS
ERAAYRMSAEKLQHDIGRLQRAAAADKPPEGDETAVGGVPGGGADAGERHAKELRGMVKQVVWMQARWEREASLR
SDTAYAKRFLQLQLDLANACNKAQLAELEQIRTRLLHSRKPLIAAPPRPAASPARRVPALRPLLLAALFIARARI
AARRWAAHEAVRRDLAAAVQDQRRRRRSRRLQVAPVVVDDAHGA*
Coding >Hirsu2|9090
ATGATAAGGCATCACGAATCCACGCCTCTGCTCTGCAGTTTCGCCCGCGACGGACGCCAGCAGCTGCCTAAAGCC
CCGACATGCTTCGCGTTTCTGCTATTGCGCGCGACTCCCGACGCGTTGAAACCCCCACGGCCCCCCGCCATGGTC
CAGCCAGGCTTGGGCGGCGCGCTCGATACCCCGCGAACAAACATTGGCGATGCGACCTTCCTCAGCCGCCCTCCC
AACTTTGCCGACGTCTCGCGAGAAGCCTCCTTCCAGTCGCCTGGAAAAGACGGCGATCTTTTGCACCAACTTCGA
AATGGCCGTTGTAACGGTCTCAACCTCCGAACCCCTCGCCAGAGAGGCCCGCTCGCCGACCGACGAAATCTTCCG
CCAAGCGTCGGCGGTGCTGAGTTCACACCCCTACTCAAGTCAGCCACGAGGAACAGTGTGCGCCGGTACGGAAAG
GAGAACGGTGCGGCCGTTCAGAATACACCCGCCCTCAATAAAATCGACGAGGACGACGTAACGCCAATCCCTCGC
GTGGACACGTCCGTCTATCTGGGCTCGCATAACCAATCGTACTTGGACAACCACACGCTGCCCCAGGTCGATAGC
AGTAGTGTGGCCTCGACTCCTATGGCGTTGAAGCCTCGCCGTAGCAGGGATAAGGGCCCTTTGCAGGACGGGAAC
CAACTGTCGCTACGCGAGCAGGAGAATGTCATTGACCGGATCGAGAAGGAGAACTTTGGCCTCAAACTTAAGATC
CACTTTCTCGAGGATGCATTGCGCAAAGCCGGTCCGGGATTCAGCGAGGCAGCGCTCAAAGAAAACACTGAACTC
AAGGTGGACAAAGTCACGATGCAGAGGGAGCTCCATCGATACAAGAAGCATCTGACCTTGGCCGAGCGCGACCTC
GAGAGCTATCGCCAGCAAATGCTGGAGTTTCAGGACAAGACAAAGCGCAAGAACTTGGACGGAGGTAATCGCGCC
GAACTGGAACAGCTCCAAAAGACCCTTCAGGAACGCGAAGCCGACGTGGATCAACTACAACGCCAGGTCGACAAA
GGCCGGCGTGATGACGGCGAGTTGGAAAAGCTAAAAGACAACATTGAGGATTTGGAGGCCGATCTGCGGGAAAGA
GATCGGATTATAACAGAGCGCGAAGACGCGCTCGAAGACTTAAGGGACAAGCTGGAGGATGCGGAGGACAGGGCC
AGGGACCCTCAACAACTGGCTGCCGAGACGGAGAAAGCTCGTGTCAATGAGGAGGAGCTTGAGGAGGCCAGAGAA
ACGATCCAGGAACTCGAGCGAAATGTTCGTCGGCTCGAGGCACAGGTCGAGGAGTTGAAGGGCCGGACGGAAGAG
GCCCTGGCTCAAAAAGACCAGGCTGAGCAGGATTTGCAGGAGCTCCATGAAGAATTGGCCAATAAATCGGTCGTC
ACCAAGGGCCTGTCGCGCCAGCTCGATGACAAAGTCGCCCGTCTGCAAGGCGAGCTGGAAAGGTCGAGCAAGGAG
TATGCAACACTGGAGAAGCAGCTTGCCAGTGCCAATGAAGAGAACGGCCGGCTCCAAACTGCAGTTAAGGGCCTG
CGACAAGAGAGCAAGAATTTTGAGCACCGCAGAGAGTCCGACTCGATCCGGATGCAAGAGCTGGAGGCCGAGCTT
CTCGCCGTGGGCGACGAGAGAGATTTGTTGCAGGCCCGTCACGATGCCCTCAGCAAAGAGTCCGCTGCGTTACAA
GAAGACGTGCAGCGGCTGGGAAAAGACGTCAAGGAGCTGGAAGAAGGAATGTCACGAGAACGAGAATACGCCTTG
GAGATTGAGAAGGACCTCCGCAGCCAGTATGGCGACGAGATTCAGCGACTAAACGATGAGATTTCCGACTTGCAG
GCCGAAATACGGGAGAAGGACAACCTATACGACAACGACAGCGAAAAGTGGGAAAACCAGAAGCAGACGTTGGAG
TGTGAGCGCGACCGAGCCGAGGAGAAGGCTATCGGGCTCCAGCGAACCATCGACCGCCTGCCTGAGGCGGAAGGG
AATCTGTCAGACAAGGAGTACAAGCTGAAGGAGGCCATCGAAAGCGAAACGGAGCGCCATAAAAGCGAGGAGGCC
ACCATGGCCCGACAGATCGAGGACCTGCAGGATGCGTTGGAGACGCGCCAGACGCTCCTTGCCAGCCTCCGCAAC
GAGCTTTCGCTGGTGCGCGAAGAGCTTCGACAGACCCAGATTGACTACCAGACGCAGGTCAACAAGGTTGTGGCC
CTGGAAGACGAGGTGGAAGTCCTGCAGACAAGCTCGGCCACGAGCGGGAGACAGGAGGTCGAGGCAGCCGGGCGA
GAGTGCGAGAGTCTGCGGAGACAACTGAAGGAGCTTCAGCAGCAATTGAAGGAGTCATCCGCCGGCGACAGCCCT
GTCGCAGATCGCAGTGGGCTGCAGCCGGCAGAGTCGATGGCGCGGCTTCGAAATCAGTTCTCAGACGCAACCGCT
CAACTGGAGAGGGCAACCAAGGAGAAGAAGTCTCTGCAGGACAGGTTTGCCGCCCTCAACGCAGAGCTCCATTCC
ACCTGGACTAGCCTGGCCGAGGCCAAAGCGGAGCGAGACGAGCTCGACGAGCAGCTCCGTCGAGCCAGCGCGCAC
GATAACGATACGCTTCGGATCGACCAAGAGCGGCTGGATCTTCGGACCGCCAAGATGAAGCTCGATAACGAGGTC
CGGCGCCTGAGGGACGAGAACAAGGCCTTGTCGGAGCAGCGCGCCGCGGTGGAAAAGACTCTCGAGGACGAACTA
GACAAGGCAGCGGTGGAGGAGGAGCGACTGGGACAAGAGGTTCTTCAGCTCCAAGCTCAGCTGCGGCAGTCGTCG
ACATCAGAGTCTCAGGACCTGGCCACGGCCCGGCGGACGGTTCACAAGCTAGAGCGCCGTGTCCAAGATTACCAG
ATGCAGCTCGCGAGCGCCCAGGCACCGGAGGGCGAAGACCACAGCAGCAGCGAGATGTCCATGGTCCGGAAGGAT
CTCTCCACGTCGCGTCAGAAGGAGATGGAGTTCCTGCAGCGGGAGGCGGCCCAGCGAGACGTCATCAAGGGCCTC
AGGAAGCAGATTGCGGCGCTGGAGCGGCAACTACACGATCACGAGGTGTTGCGGCTGATAGCGTCGCCCGCGGCC
CCGTCGGACCAGGGCGAGACAGCCTCGGGCCTGCGAGAACAGCTCTCAGCCGCACAGCAGTCGGCCCACGAGTGG
AAGTCGAAGATACGCGAGGCGGAACAGAGGGCGGCGCAGGCGGCACAGGACCAGCAGCGGCAGCTCGGCGACCTC
GAGGACCAGAAGCTGGTGCTGGAGGAGGTGCTGGAGGAGGCTCGGCTTCAGGCCGAGGAGGCGGCGGCGCGGCAC
GACAAGGCGGCGCGGCGCATGCAGCACAGGCTCGACAGGGTGGAGCGGGAGCGCGACGCCGCGGCGGCGGCCCAG
ACGGCGAGCAGCAAGCAGGACCGCCACCTGCGTCGGAGCCGGGCCGAGGTCGACAACCTGGAGCACGACGTGCGG
CAGCAGCAGGAGCTCATCGACGGCCTCGTTGCGGCCGAGGCCTGCCTGAGGCGCAAGCTCGAGCGGGCGCGCAGC
GAGCGCGCCGCCTACCGCATGAGCGCCGAGAAGCTGCAGCACGACATCGGGCGTCTTCAGCGGGCGGCGGCGGCG
GACAAACCGCCCGAAGGCGACGAGACGGCCGTCGGCGGCGTCCCAGGCGGCGGCGCCGACGCCGGCGAGCGTCAT
GCCAAGGAGCTGCGCGGCATGGTCAAGCAGGTGGTGTGGATGCAGGCCCGCTGGGAGCGCGAGGCCTCGCTGCGC
TCCGACACGGCCTATGCCAAGAGGTTTTTGCAGCTGCAGCTTGACCTAGCCAACGCCTGCAACAAAGCCCAGCTG
GCCGAGCTCGAGCAGATCCGGACCAGGCTCCTGCACAGCCGCAAGCCCCTCATCGCCGCCCCACCGCGCCCGGCC
GCCAGCCCCGCGCGCCGGGTTCCCGCGCTGCGGCCCCTCCTCCTCGCCGCTCTCTTCATCGCCCGCGCCCGCATC
GCGGCCCGCCGCTGGGCCGCGCACGAGGCTGTCCGCCGCGACCTCGCCGCCGCCGTCCAGGACCAGCGCCGCCGC
AGACGATCCCGCCGCCTGCAGGTTGCCCCTGTCGTCGTGGACGACGCGCACGGCGCTTGA
Transcript >Hirsu2|9090
ATGATAAGGCATCACGAATCCACGCCTCTGCTCTGCAGTTTCGCCCGCGACGGACGCCAGCAGCTGCCTAAAGCC
CCGACATGCTTCGCGTTTCTGCTATTGCGCGCGACTCCCGACGCGTTGAAACCCCCACGGCCCCCCGCCATGGTC
CAGCCAGGCTTGGGCGGCGCGCTCGATACCCCGCGAACAAACATTGGCGATGCGACCTTCCTCAGCCGCCCTCCC
AACTTTGCCGACGTCTCGCGAGAAGCCTCCTTCCAGTCGCCTGGAAAAGACGGCGATCTTTTGCACCAACTTCGA
AATGGCCGTTGTAACGGTCTCAACCTCCGAACCCCTCGCCAGAGAGGCCCGCTCGCCGACCGACGAAATCTTCCG
CCAAGCGTCGGCGGTGCTGAGTTCACACCCCTACTCAAGTCAGCCACGAGGAACAGTGTGCGCCGGTACGGAAAG
GAGAACGGTGCGGCCGTTCAGAATACACCCGCCCTCAATAAAATCGACGAGGACGACGTAACGCCAATCCCTCGC
GTGGACACGTCCGTCTATCTGGGCTCGCATAACCAATCGTACTTGGACAACCACACGCTGCCCCAGGTCGATAGC
AGTAGTGTGGCCTCGACTCCTATGGCGTTGAAGCCTCGCCGTAGCAGGGATAAGGGCCCTTTGCAGGACGGGAAC
CAACTGTCGCTACGCGAGCAGGAGAATGTCATTGACCGGATCGAGAAGGAGAACTTTGGCCTCAAACTTAAGATC
CACTTTCTCGAGGATGCATTGCGCAAAGCCGGTCCGGGATTCAGCGAGGCAGCGCTCAAAGAAAACACTGAACTC
AAGGTGGACAAAGTCACGATGCAGAGGGAGCTCCATCGATACAAGAAGCATCTGACCTTGGCCGAGCGCGACCTC
GAGAGCTATCGCCAGCAAATGCTGGAGTTTCAGGACAAGACAAAGCGCAAGAACTTGGACGGAGGTAATCGCGCC
GAACTGGAACAGCTCCAAAAGACCCTTCAGGAACGCGAAGCCGACGTGGATCAACTACAACGCCAGGTCGACAAA
GGCCGGCGTGATGACGGCGAGTTGGAAAAGCTAAAAGACAACATTGAGGATTTGGAGGCCGATCTGCGGGAAAGA
GATCGGATTATAACAGAGCGCGAAGACGCGCTCGAAGACTTAAGGGACAAGCTGGAGGATGCGGAGGACAGGGCC
AGGGACCCTCAACAACTGGCTGCCGAGACGGAGAAAGCTCGTGTCAATGAGGAGGAGCTTGAGGAGGCCAGAGAA
ACGATCCAGGAACTCGAGCGAAATGTTCGTCGGCTCGAGGCACAGGTCGAGGAGTTGAAGGGCCGGACGGAAGAG
GCCCTGGCTCAAAAAGACCAGGCTGAGCAGGATTTGCAGGAGCTCCATGAAGAATTGGCCAATAAATCGGTCGTC
ACCAAGGGCCTGTCGCGCCAGCTCGATGACAAAGTCGCCCGTCTGCAAGGCGAGCTGGAAAGGTCGAGCAAGGAG
TATGCAACACTGGAGAAGCAGCTTGCCAGTGCCAATGAAGAGAACGGCCGGCTCCAAACTGCAGTTAAGGGCCTG
CGACAAGAGAGCAAGAATTTTGAGCACCGCAGAGAGTCCGACTCGATCCGGATGCAAGAGCTGGAGGCCGAGCTT
CTCGCCGTGGGCGACGAGAGAGATTTGTTGCAGGCCCGTCACGATGCCCTCAGCAAAGAGTCCGCTGCGTTACAA
GAAGACGTGCAGCGGCTGGGAAAAGACGTCAAGGAGCTGGAAGAAGGAATGTCACGAGAACGAGAATACGCCTTG
GAGATTGAGAAGGACCTCCGCAGCCAGTATGGCGACGAGATTCAGCGACTAAACGATGAGATTTCCGACTTGCAG
GCCGAAATACGGGAGAAGGACAACCTATACGACAACGACAGCGAAAAGTGGGAAAACCAGAAGCAGACGTTGGAG
TGTGAGCGCGACCGAGCCGAGGAGAAGGCTATCGGGCTCCAGCGAACCATCGACCGCCTGCCTGAGGCGGAAGGG
AATCTGTCAGACAAGGAGTACAAGCTGAAGGAGGCCATCGAAAGCGAAACGGAGCGCCATAAAAGCGAGGAGGCC
ACCATGGCCCGACAGATCGAGGACCTGCAGGATGCGTTGGAGACGCGCCAGACGCTCCTTGCCAGCCTCCGCAAC
GAGCTTTCGCTGGTGCGCGAAGAGCTTCGACAGACCCAGATTGACTACCAGACGCAGGTCAACAAGGTTGTGGCC
CTGGAAGACGAGGTGGAAGTCCTGCAGACAAGCTCGGCCACGAGCGGGAGACAGGAGGTCGAGGCAGCCGGGCGA
GAGTGCGAGAGTCTGCGGAGACAACTGAAGGAGCTTCAGCAGCAATTGAAGGAGTCATCCGCCGGCGACAGCCCT
GTCGCAGATCGCAGTGGGCTGCAGCCGGCAGAGTCGATGGCGCGGCTTCGAAATCAGTTCTCAGACGCAACCGCT
CAACTGGAGAGGGCAACCAAGGAGAAGAAGTCTCTGCAGGACAGGTTTGCCGCCCTCAACGCAGAGCTCCATTCC
ACCTGGACTAGCCTGGCCGAGGCCAAAGCGGAGCGAGACGAGCTCGACGAGCAGCTCCGTCGAGCCAGCGCGCAC
GATAACGATACGCTTCGGATCGACCAAGAGCGGCTGGATCTTCGGACCGCCAAGATGAAGCTCGATAACGAGGTC
CGGCGCCTGAGGGACGAGAACAAGGCCTTGTCGGAGCAGCGCGCCGCGGTGGAAAAGACTCTCGAGGACGAACTA
GACAAGGCAGCGGTGGAGGAGGAGCGACTGGGACAAGAGGTTCTTCAGCTCCAAGCTCAGCTGCGGCAGTCGTCG
ACATCAGAGTCTCAGGACCTGGCCACGGCCCGGCGGACGGTTCACAAGCTAGAGCGCCGTGTCCAAGATTACCAG
ATGCAGCTCGCGAGCGCCCAGGCACCGGAGGGCGAAGACCACAGCAGCAGCGAGATGTCCATGGTCCGGAAGGAT
CTCTCCACGTCGCGTCAGAAGGAGATGGAGTTCCTGCAGCGGGAGGCGGCCCAGCGAGACGTCATCAAGGGCCTC
AGGAAGCAGATTGCGGCGCTGGAGCGGCAACTACACGATCACGAGGTGTTGCGGCTGATAGCGTCGCCCGCGGCC
CCGTCGGACCAGGGCGAGACAGCCTCGGGCCTGCGAGAACAGCTCTCAGCCGCACAGCAGTCGGCCCACGAGTGG
AAGTCGAAGATACGCGAGGCGGAACAGAGGGCGGCGCAGGCGGCACAGGACCAGCAGCGGCAGCTCGGCGACCTC
GAGGACCAGAAGCTGGTGCTGGAGGAGGTGCTGGAGGAGGCTCGGCTTCAGGCCGAGGAGGCGGCGGCGCGGCAC
GACAAGGCGGCGCGGCGCATGCAGCACAGGCTCGACAGGGTGGAGCGGGAGCGCGACGCCGCGGCGGCGGCCCAG
ACGGCGAGCAGCAAGCAGGACCGCCACCTGCGTCGGAGCCGGGCCGAGGTCGACAACCTGGAGCACGACGTGCGG
CAGCAGCAGGAGCTCATCGACGGCCTCGTTGCGGCCGAGGCCTGCCTGAGGCGCAAGCTCGAGCGGGCGCGCAGC
GAGCGCGCCGCCTACCGCATGAGCGCCGAGAAGCTGCAGCACGACATCGGGCGTCTTCAGCGGGCGGCGGCGGCG
GACAAACCGCCCGAAGGCGACGAGACGGCCGTCGGCGGCGTCCCAGGCGGCGGCGCCGACGCCGGCGAGCGTCAT
GCCAAGGAGCTGCGCGGCATGGTCAAGCAGGTGGTGTGGATGCAGGCCCGCTGGGAGCGCGAGGCCTCGCTGCGC
TCCGACACGGCCTATGCCAAGAGGTTTTTGCAGCTGCAGCTTGACCTAGCCAACGCCTGCAACAAAGCCCAGCTG
GCCGAGCTCGAGCAGATCCGGACCAGGCTCCTGCACAGCCGCAAGCCCCTCATCGCCGCCCCACCGCGCCCGGCC
GCCAGCCCCGCGCGCCGGGTTCCCGCGCTGCGGCCCCTCCTCCTCGCCGCTCTCTTCATCGCCCGCGCCCGCATC
GCGGCCCGCCGCTGGGCCGCGCACGAGGCTGTCCGCCGCGACCTCGCCGCCGCCGTCCAGGACCAGCGCCGCCGC
AGACGATCCCGCCGCCTGCAGGTTGCCCCTGTCGTCGTGGACGACGCGCACGGCGCTTGA
Gene >Hirsu2|9090
ATGATAAGGCATCACGAATCCACGCCTCTGCTCTGCAGTTTCGCCCGCGACGGACGCCAGCAGCTGCCTAAAGCC
CCGACATGTGAGCCGTGGATTATGCACGTATAGCCCTCAAGGCAAGCTGAATATCATCTATCAATTCGCCACCGC
CCCTGCGCGCCCATCTAGAGCTCCCTCTCGGACGCGACACGAAGCCCGGCGCCCAGGCTTCGCGTTTCTGCTATT
GCGCGCGACTCCCGACGTACGCCTTCCAACTTGAACTCGCTGCAGGGCATGCATCGTCAAGGCTATCTCTGACAA
TCTTGCTGTACCTAAAACAGGCGTTGAAACCCCCACGGCCCCCCGCCATGGTCCAGCCAGGCTTGGGCGGCGCGC
TCGATACCCCGCGAACAAACATTGGCGATGCGACCTTCCTCAGCCGCCCTCCCAACTTTGCCGACGTCTCGCGAG
AAGCCTCCTTCCAGTCGCCTGGAAAAGACGGCGATCTTTTGCACCAACTTCGAAATGGCCGTTGTAACGGTCTCA
ACCTCCGAACCCCTCGCCAGAGAGGCCCGCTCGCCGACCGACGAAATCTTCCGCCAAGCGTCGGCGGTGCTGAGT
TCACACCCCTACTCAAGTCAGCCACGAGGAACAGTGTGCGCCGGTACGGAAAGGAGAACGGTGCGGCCGTTCAGA
ATACACCCGCCCTCAATAAAATCGACGAGGACGACGTAACGCCAATCCCTCGCGTGGACACGTCCGTCTATCTGG
GCTCGCATAACCAATCGTACTTGGACAACCACACGCTGCCCCAGGTCGATAGCAGTAGTGTGGCCTCGACTCCTA
TGGCGTTGAAGCCTCGCCGTAGCAGGGATAAGGGCCCTTTGCAGGACGGGAACCAACTGTCGCTACGCGAGCAGG
AGAATGTCATTGACCGGATCGAGAAGGAGAACTTTGGCCTCAAACTTAAGATCCACTTTCTCGAGGATGCATTGC
GCAAAGCCGGTCCGGGATTCAGCGAGGCAGCGCTCAAAGAAAACACTGAACTCAAGGTGGACAAAGTCACGATGC
AGAGGGAGCTCCATCGATACAAGAAGCATCTGACCTTGGCCGAGCGCGACCTCGAGAGCTATCGCCAGCAAATGC
TGGAGTTTCAGGACAAGACAAAGCGCAAGAACTTGGACGGAGGTAATCGCGCCGAACTGGAACAGCTCCAAAAGA
CCCTTCAGGAACGCGAAGCCGACGTGGATCAACTACAACGCCAGGTCGACAAAGGCCGGCGTGATGACGGCGAGT
TGGAAAAGCTAAAAGACAACATTGAGGATTTGGAGGCCGATCTGCGGGAAAGAGATCGGATTATAACAGAGCGCG
AAGACGCGCTCGAAGACTTAAGGGACAAGCTGGAGGATGCGGAGGACAGGGCCAGGGACCCTCAACAACTGGCTG
CCGAGACGGAGAAAGCTCGTGTCAATGAGGAGGAGCTTGAGGAGGCCAGAGAAACGATCCAGGAACTCGAGCGAA
ATGTTCGTCGGCTCGAGGCACAGGTCGAGGAGTTGAAGGGCCGGACGGAAGAGGCCCTGGCTCAAAAAGACCAGG
CTGAGCAGGATTTGCAGGAGCTCCATGAAGAATTGGCCAATAAATCGGTCGTCACCAAGGGCCTGTCGCGCCAGC
TCGATGACAAAGTCGCCCGTCTGCAAGGCGAGCTGGAAAGGTCGAGCAAGGAGTATGCAACACTGGAGAAGCAGC
TTGCCAGTGCCAATGAAGAGAACGGCCGGCTCCAAACTGCAGTTAAGGGCCTGCGACAAGAGAGCAAGAATTTTG
AGCACCGCAGAGAGTCCGACTCGATCCGGATGCAAGAGCTGGAGGCCGAGCTTCTCGCCGTGGGCGACGAGAGAG
ATTTGTTGCAGGCCCGTCACGATGCCCTCAGCAAAGAGTCCGCTGCGTTACAAGAAGACGTGCAGCGGCTGGGAA
AAGACGTCAAGGAGCTGGAAGAAGGAATGTCACGAGAACGAGAATACGCCTTGGAGATTGAGAAGGACCTCCGCA
GCCAGTATGGCGACGAGATTCAGCGACTAAACGATGAGATTTCCGACTTGCAGGCCGAAATACGGGAGAAGGACA
ACCTATACGACAACGACAGCGAAAAGTGGGAAAACCAGAAGCAGACGTTGGAGTGTGAGCGCGACCGAGCCGAGG
AGAAGGCTATCGGGCTCCAGCGAACCATCGACCGCCTGCCTGAGGCGGAAGGGAATCTGTCAGACAAGGAGTACA
AGCTGAAGGAGGCCATCGAAAGCGAAACGGAGCGCCATAAAAGCGAGGAGGCCACCATGGCCCGACAGATCGAGG
ACCTGCAGGATGCGTTGGAGACGCGCCAGACGCTCCTTGCCAGCCTCCGCAACGAGCTTTCGCTGGTGCGCGAAG
AGCTTCGACAGACCCAGATTGACTACCAGACGCAGGTCAACAAGGTTGTGGCCCTGGAAGACGAGGTGGAAGTCC
TGCAGACAAGCTCGGCCACGAGCGGGAGACAGGAGGTCGAGGCAGCCGGGCGAGAGTGCGAGAGTCTGCGGAGAC
AACTGAAGGAGCTTCAGCAGCAATTGAAGGAGTCATCCGCCGGCGACAGCCCTGTCGCAGATCGCAGTGGGCTGC
AGCCGGCAGAGTCGATGGCGCGGCTTCGAAATCAGTTCTCAGACGCAACCGCTCAACTGGAGAGGGCAACCAAGG
AGAAGAAGTCTCTGCAGGACAGGTTTGCCGCCCTCAACGCAGAGCTCCATTCCACCTGGACTAGCCTGGCCGAGG
CCAAAGCGGAGCGAGACGAGCTCGACGAGCAGCTCCGTCGAGCCAGCGCGCACGATAACGATACGCTTCGGATCG
ACCAAGAGCGGCTGGATCTTCGGACCGCCAAGATGAAGCTCGATAACGAGGTCCGGCGCCTGAGGGACGAGAACA
AGGCCTTGTCGGAGCAGCGCGCCGCGGTGGAAAAGACTCTCGAGGACGAACTAGACAAGGCAGCGGTGGAGGAGG
AGCGACTGGGACAAGAGGTTCTTCAGCTCCAAGCTCAGCTGCGGCAGTCGTCGACATCAGAGTCTCAGGACCTGG
CCACGGCCCGGCGGACGGTTCACAAGCTAGAGCGCCGTGTCCAAGATTACCAGATGCAGCTCGCGAGCGCCCAGG
CACCGGAGGGCGAAGACCACAGCAGCAGCGAGATGTCCATGGTCCGGAAGGATCTCTCCACGTCGCGTCAGAAGG
AGATGGAGTTCCTGCAGCGGGAGGCGGCCCAGCGAGACGTCATCAAGGGCCTCAGGAAGCAGATTGCGGCGCTGG
AGCGGCAACTACACGATCACGAGGTGTTGCGGCTGATAGCGTCGCCCGCGGCCCCGTCGGACCAGGGCGAGACAG
CCTCGGGCCTGCGAGAACAGCTCTCAGCCGCACAGCAGTCGGCCCACGAGTGGAAGTCGAAGATACGCGAGGCGG
AACAGAGGGCGGCGCAGGCGGCACAGGACCAGCAGCGGCAGCTCGGCGACCTCGAGGACCAGAAGCTGGTGCTGG
AGGAGGTGCTGGAGGAGGCTCGGCTTCAGGCCGAGGAGGCGGCGGCGCGGCACGACAAGGCGGCGCGGCGCATGC
AGCACAGGCTCGACAGGGTGGAGCGGGAGCGCGACGCCGCGGCGGCGGCCCAGACGGCGAGCAGCAAGCAGGACC
GCCACCTGCGTCGGAGCCGGGCCGAGGTCGACAACCTGGAGCACGACGTGCGGCAGCAGCAGGAGCTCATCGACG
GCCTCGTTGCGGCCGAGGCCTGCCTGAGGCGCAAGCTCGAGCGGGCGCGCAGCGAGCGCGCCGCCTACCGCATGA
GCGCCGAGAAGCTGCAGCACGACATCGGGCGTCTTCAGCGGGCGGCGGCGGCGGACAAACCGCCCGAAGGCGACG
AGACGGCCGTCGGCGGCGTCCCAGGCGGCGGCGCCGACGCCGGCGAGCGTCATGCCAAGGAGCTGCGCGGCATGG
TCAAGCAGGTGGTGTGGATGCAGGCCCGCTGGGAGCGCGAGGCCTCGCTGCGCTCCGACACGGCCTATGCCAAGA
GGTTTTTGCAGCTGCAGCTTGACCTAGCCAACGCCTGGCAAGTTCCCGTCATCCTTTCCTTCTCCCCCCTTCCTC
GACAAGGAAGGACCGCTAACAGACGGCGACAACAGCAACAAAGCCCAGCTGGCCGAGCTCGAGCAGATCCGGACC
AGGCTCCTGCACAGCCGCAAGCCCCTCATCGCCGCCCCACCGCGCCCGGCCGCCAGCCCCGCGCGCCGGGTTCCC
GCGCTGCGGCCCCTCCTCCTCGCCGCTCTCTTCATCGCCCGCGCCCGCATCGCGGCCCGCCGCTGGGCCGCGCAC
GAGGCTGTCCGCCGCGACCTCGCCGCCGCCGTCCAGGACCAGCGCCGCCGCAGACGATCCCGCCGCCTGCAGGTT
GCCCCTGTCGTCGTGGACGACGCGCACGGCGCTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail