Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|909
Gene name
LocationContig_119:29713..30301
Strand-
Gene length (bp)588
Transcript length (bp)525
Coding sequence length (bp)525
Protein length (aa) 175

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family 2.3E-11 65 155
PF13508 Acetyltransf_7 Acetyltransferase (GNAT) domain 2.0E-08 71 157
PF13673 Acetyltransf_10 Acetyltransferase (GNAT) domain 3.1E-08 58 159

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O93806|GNA1_CANAX Glucosamine 6-phosphate N-acetyltransferase OS=Candida albicans GN=GNA1 PE=3 SV=1 21 163 2.0E-44
sp|Q54WR8|GNA1_DICDI Glucosamine 6-phosphate N-acetyltransferase 1 OS=Dictyostelium discoideum GN=gna1 PE=3 SV=1 24 165 6.0E-33
sp|Q9LFU9|GNA1_ARATH Glucosamine 6-phosphate N-acetyltransferase OS=Arabidopsis thaliana GN=GNA1 PE=1 SV=1 21 167 7.0E-30
sp|P43577|GNA1_YEAST Glucosamine 6-phosphate N-acetyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GNA1 PE=1 SV=1 20 162 1.0E-29
sp|C7IZ16|GNA2_ORYSJ Probable glucosamine 6-phosphate N-acetyltransferase 2 OS=Oryza sativa subsp. japonica GN=Os02g0717700 PE=2 SV=2 9 166 6.0E-29
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O93806|GNA1_CANAX Glucosamine 6-phosphate N-acetyltransferase OS=Candida albicans GN=GNA1 PE=3 SV=1 21 163 2.0E-44
sp|Q54WR8|GNA1_DICDI Glucosamine 6-phosphate N-acetyltransferase 1 OS=Dictyostelium discoideum GN=gna1 PE=3 SV=1 24 165 6.0E-33
sp|Q9LFU9|GNA1_ARATH Glucosamine 6-phosphate N-acetyltransferase OS=Arabidopsis thaliana GN=GNA1 PE=1 SV=1 21 167 7.0E-30
sp|P43577|GNA1_YEAST Glucosamine 6-phosphate N-acetyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GNA1 PE=1 SV=1 20 162 1.0E-29
sp|C7IZ16|GNA2_ORYSJ Probable glucosamine 6-phosphate N-acetyltransferase 2 OS=Oryza sativa subsp. japonica GN=Os02g0717700 PE=2 SV=2 9 166 6.0E-29
sp|Q5U9F2|GNA1_ORYSJ Glucosamine 6-phosphate N-acetyltransferase 1 OS=Oryza sativa subsp. japonica GN=GNA1 PE=1 SV=1 25 166 8.0E-27
sp|Q17427|GNA1_CAEEL Glucosamine 6-phosphate N-acetyltransferase OS=Caenorhabditis elegans GN=gna-1 PE=1 SV=1 7 156 2.0E-26
sp|Q9VAI0|GNA1_DROME Probable glucosamine 6-phosphate N-acetyltransferase OS=Drosophila melanogaster GN=CG1969 PE=2 SV=1 17 155 2.0E-26
sp|Q5RAL9|GNA1_PONAB Glucosamine 6-phosphate N-acetyltransferase OS=Pongo abelii GN=GNPNAT1 PE=2 SV=2 9 155 2.0E-22
sp|Q96EK6|GNA1_HUMAN Glucosamine 6-phosphate N-acetyltransferase OS=Homo sapiens GN=GNPNAT1 PE=1 SV=1 9 155 2.0E-22
sp|Q9JK38|GNA1_MOUSE Glucosamine 6-phosphate N-acetyltransferase OS=Mus musculus GN=Gnpnat1 PE=1 SV=1 9 152 6.0E-22
sp|O13738|GNA1_SCHPO Glucosamine 6-phosphate N-acetyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gna1 PE=3 SV=1 66 165 2.0E-21
sp|Q5UPZ9|GNA1_MIMIV Probable glucosamine 6-phosphate N-acetyltransferase OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L316 PE=3 SV=1 27 168 5.0E-17
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|909
MAADEGLFSSELISAEVVAALPKGYKLRALRKSDYDSGFLDCLRVLTTVGDISKDGFNDQCDRMGLQGGYYIVVV
EDDRGAVVATGALIVERKFIHNLGAVGHIEDIAVSKDQQGKKLGLRLIQALDHIAERIGCYKSILDCSVANEGFY
VKCGFRRAGLQMAHYYEGGKSKAQ*
Coding >Hirsu2|909
ATGGCAGCCGACGAGGGCCTCTTCTCGTCCGAACTCATCTCCGCGGAGGTCGTTGCCGCCCTCCCCAAGGGCTAC
AAGCTCCGCGCCCTGCGAAAGTCGGACTACGACAGCGGCTTTCTCGACTGCCTGCGCGTCCTGACCACGGTCGGC
GACATCAGCAAGGACGGCTTCAACGACCAGTGCGACCGCATGGGACTGCAGGGCGGATACTACATCGTCGTCGTC
GAGGATGACCGGGGCGCCGTCGTCGCCACGGGTGCCCTGATTGTCGAGCGCAAGTTCATCCACAATCTCGGCGCC
GTCGGCCACATCGAGGACATTGCCGTCTCCAAGGACCAGCAGGGCAAGAAGCTGGGCCTCCGGCTCATCCAGGCG
CTCGACCACATCGCCGAGCGCATCGGCTGCTACAAGAGCATCCTCGACTGCAGCGTCGCCAACGAGGGCTTCTAC
GTCAAGTGCGGCTTCCGACGCGCAGGCCTCCAGATGGCCCACTACTATGAGGGCGGCAAAAGTAAAGCTCAATAA
Transcript >Hirsu2|909
ATGGCAGCCGACGAGGGCCTCTTCTCGTCCGAACTCATCTCCGCGGAGGTCGTTGCCGCCCTCCCCAAGGGCTAC
AAGCTCCGCGCCCTGCGAAAGTCGGACTACGACAGCGGCTTTCTCGACTGCCTGCGCGTCCTGACCACGGTCGGC
GACATCAGCAAGGACGGCTTCAACGACCAGTGCGACCGCATGGGACTGCAGGGCGGATACTACATCGTCGTCGTC
GAGGATGACCGGGGCGCCGTCGTCGCCACGGGTGCCCTGATTGTCGAGCGCAAGTTCATCCACAATCTCGGCGCC
GTCGGCCACATCGAGGACATTGCCGTCTCCAAGGACCAGCAGGGCAAGAAGCTGGGCCTCCGGCTCATCCAGGCG
CTCGACCACATCGCCGAGCGCATCGGCTGCTACAAGAGCATCCTCGACTGCAGCGTCGCCAACGAGGGCTTCTAC
GTCAAGTGCGGCTTCCGACGCGCAGGCCTCCAGATGGCCCACTACTATGAGGGCGGCAAAAGTAAAGCTCAATAA
Gene >Hirsu2|909
ATGGCAGCCGACGAGGGCCTCTTCTCGTCCGAACTCATCTCCGCGGAGGTCGTTGCCGCCCTCCCCAAGGGCTAC
AAGCTCCGCGCCCTGCGAAAGTCGGACTACGACAGCGGCTTTCTCGACTGCCTGCGCGTCCTGACCACGGTCGGC
GACATCAGCAAGGACGGCTTCAACGACCAGTGCGACCGCATGGGACTGCAGGGCGGATACTACATCGTCGTCGTC
GAGGATGACCGGGGCGCCGTCGTCGCCACGGGTGCCCTGATTGTCGAGCGCAAGTTGTATGCTTGACCTCCCTCC
TCCGCCCTTGTCCGGTCTTCGCTGACGGCCTTGCTCCCCTGCAGCATCCACAATCTCGGCGCCGTCGGCCACATC
GAGGACATTGCCGTCTCCAAGGACCAGCAGGGCAAGAAGCTGGGCCTCCGGCTCATCCAGGCGCTCGACCACATC
GCCGAGCGCATCGGCTGCTACAAGAGCATCCTCGACTGCAGCGTCGCCAACGAGGGCTTCTACGTCAAGTGCGGC
TTCCGACGCGCAGGCCTCCAGATGGCCCACTACTATGAGGGCGGCAAAAGTAAAGCTCAATAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail