Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|9088
Gene name
LocationContig_638:2048..3389
Strand+
Gene length (bp)1341
Transcript length (bp)1140
Coding sequence length (bp)1140
Protein length (aa) 380

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01088 Peptidase_C12 Ubiquitin carboxyl-terminal hydrolase, family 1 2.0E-42 2 210

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9XSJ0|UCHL5_BOVIN Ubiquitin carboxyl-terminal hydrolase isozyme L5 OS=Bos taurus GN=UCHL5 PE=2 SV=1 6 225 1.0E-26
sp|Q54N38|UCHL5_DICDI Ubiquitin carboxyl-terminal hydrolase isozyme L5 OS=Dictyostelium discoideum GN=uch2 PE=3 SV=1 6 239 2.0E-26
sp|Q06AT3|UCHL5_PIG Ubiquitin carboxyl-terminal hydrolase isozyme L5 OS=Sus scrofa GN=UCHL5 PE=2 SV=1 6 225 3.0E-26
sp|Q9Y5K5|UCHL5_HUMAN Ubiquitin carboxyl-terminal hydrolase isozyme L5 OS=Homo sapiens GN=UCHL5 PE=1 SV=3 6 225 4.0E-26
sp|Q9WUP7|UCHL5_MOUSE Ubiquitin carboxyl-terminal hydrolase isozyme L5 OS=Mus musculus GN=Uchl5 PE=1 SV=2 6 225 4.0E-26
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9XSJ0|UCHL5_BOVIN Ubiquitin carboxyl-terminal hydrolase isozyme L5 OS=Bos taurus GN=UCHL5 PE=2 SV=1 6 225 1.0E-26
sp|Q54N38|UCHL5_DICDI Ubiquitin carboxyl-terminal hydrolase isozyme L5 OS=Dictyostelium discoideum GN=uch2 PE=3 SV=1 6 239 2.0E-26
sp|Q06AT3|UCHL5_PIG Ubiquitin carboxyl-terminal hydrolase isozyme L5 OS=Sus scrofa GN=UCHL5 PE=2 SV=1 6 225 3.0E-26
sp|Q9Y5K5|UCHL5_HUMAN Ubiquitin carboxyl-terminal hydrolase isozyme L5 OS=Homo sapiens GN=UCHL5 PE=1 SV=3 6 225 4.0E-26
sp|Q9WUP7|UCHL5_MOUSE Ubiquitin carboxyl-terminal hydrolase isozyme L5 OS=Mus musculus GN=Uchl5 PE=1 SV=2 6 225 4.0E-26
sp|Q09444|UBH4_CAEEL Probable ubiquitin carboxyl-terminal hydrolase ubh-4 OS=Caenorhabditis elegans GN=ubh-4 PE=3 SV=2 4 226 8.0E-26
sp|Q9UUB6|UBLH2_SCHPO Ubiquitin carboxyl-terminal hydrolase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=uch2 PE=1 SV=1 8 227 1.0E-20
sp|D3ZHS6|BAP1_RAT Ubiquitin carboxyl-terminal hydrolase BAP1 OS=Rattus norvegicus GN=Bap1 PE=1 SV=2 7 210 6.0E-17
sp|Q99PU7|BAP1_MOUSE Ubiquitin carboxyl-terminal hydrolase BAP1 OS=Mus musculus GN=Bap1 PE=1 SV=1 7 210 1.0E-16
sp|A2VDM8|BAP1_BOVIN Ubiquitin carboxyl-terminal hydrolase BAP1 OS=Bos taurus GN=BAP1 PE=2 SV=1 7 210 1.0E-16
sp|Q66JB6|BAP1_XENTR Ubiquitin carboxyl-terminal hydrolase BAP1 OS=Xenopus tropicalis GN=bap1 PE=2 SV=1 5 210 1.0E-16
sp|Q5F3N6|BAP1_CHICK Ubiquitin carboxyl-terminal hydrolase BAP1 OS=Gallus gallus GN=BAP1 PE=2 SV=1 7 210 2.0E-16
sp|Q92560|BAP1_HUMAN Ubiquitin carboxyl-terminal hydrolase BAP1 OS=Homo sapiens GN=BAP1 PE=1 SV=2 7 210 2.0E-16
sp|Q52L14|BAP1_XENLA Ubiquitin carboxyl-terminal hydrolase BAP1 OS=Xenopus laevis GN=bap1 PE=2 SV=1 5 210 3.0E-16
sp|A1L2G3|BAP1_DANRE Ubiquitin carboxyl-terminal hydrolase BAP1 OS=Danio rerio GN=bap1 PE=2 SV=2 7 210 1.0E-15
sp|Q17N72|CALYP_AEDAE Ubiquitin carboxyl-terminal hydrolase calypso OS=Aedes aegypti GN=calypso PE=3 SV=1 7 249 2.0E-15
sp|Q7K5N4|CALYP_DROME Ubiquitin carboxyl-terminal hydrolase calypso OS=Drosophila melanogaster GN=calypso PE=1 SV=1 4 368 1.0E-14
sp|B4QHH0|CALYP_DROSI Ubiquitin carboxyl-terminal hydrolase calypso OS=Drosophila simulans GN=calypso PE=3 SV=1 4 368 1.0E-14
sp|B4P6P6|CALYP_DROYA Ubiquitin carboxyl-terminal hydrolase calypso OS=Drosophila yakuba GN=calypso PE=3 SV=1 4 368 1.0E-14
sp|B0W2R4|CALYP_CULQU Ubiquitin carboxyl-terminal hydrolase calypso OS=Culex quinquefasciatus GN=calypso PE=3 SV=1 7 200 2.0E-14
sp|B3NPV7|CALYP_DROER Ubiquitin carboxyl-terminal hydrolase calypso OS=Drosophila erecta GN=calypso PE=3 SV=1 4 368 2.0E-14
sp|B3MIV9|CALYP_DROAN Ubiquitin carboxyl-terminal hydrolase calypso OS=Drosophila ananassae GN=calypso PE=3 SV=1 4 368 2.0E-14
sp|C4A0D9|BAP1_BRAFL Ubiquitin carboxyl-terminal hydrolase BAP1 OS=Branchiostoma floridae GN=BAP1 PE=3 SV=1 7 250 3.0E-14
sp|B4HST0|CALYP_DROSE Ubiquitin carboxyl-terminal hydrolase calypso OS=Drosophila sechellia GN=calypso PE=3 SV=1 4 368 3.0E-14
sp|Q291J4|CALYP_DROPS Ubiquitin carboxyl-terminal hydrolase calypso OS=Drosophila pseudoobscura pseudoobscura GN=calypso PE=3 SV=1 4 246 9.0E-14
sp|B4GAM2|CALYP_DROPE Ubiquitin carboxyl-terminal hydrolase calypso OS=Drosophila persimilis GN=calypso PE=3 SV=1 4 246 9.0E-14
[Show less]

GO

GO Term Description Terminal node
GO:0006511 ubiquitin-dependent protein catabolic process Yes
GO:0004843 cysteine-type deubiquitinase activity Yes
GO:0006807 nitrogen compound metabolic process No
GO:0016787 hydrolase activity No
GO:0008150 biological_process No
GO:0019538 protein metabolic process No
GO:0006508 proteolysis No
GO:0003824 catalytic activity No
GO:0071704 organic substance metabolic process No
GO:0009056 catabolic process No
GO:0044260 cellular macromolecule metabolic process No
GO:0009987 cellular process No
GO:0008152 metabolic process No
GO:0044248 cellular catabolic process No
GO:0019941 modification-dependent protein catabolic process No
GO:1901575 organic substance catabolic process No
GO:0044265 cellular macromolecule catabolic process No
GO:0101005 deubiquitinase activity No
GO:0044238 primary metabolic process No
GO:0008233 peptidase activity No
GO:0009057 macromolecule catabolic process No
GO:1901564 organonitrogen compound metabolic process No
GO:0019783 ubiquitin-like protein peptidase activity No
GO:0051603 proteolysis involved in protein catabolic process No
GO:0140096 catalytic activity, acting on a protein No
GO:0003674 molecular_function No
GO:0044237 cellular metabolic process No
GO:0043632 modification-dependent macromolecule catabolic process No
GO:0043170 macromolecule metabolic process No
GO:0008234 cysteine-type peptidase activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 25 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|9088
LNFLPQPVFGLIFLFHYAPQLVDEEEEDGEEAPVWFANQTTNNSCASVALVNIVMNAEDVELGDELQNFKDLTKD
LNSALRGYQIGANDFIRAAHNSFARRIDLLNADLCLANEVEAAQIEPPQKRLIKRRGATSRSGDKQKTAGPRTAA
ARAKKKQPHVEYGFHFIAYVPAGGFVWELDGMRTKPRNIGGELTEKSWTDIVLPRIQHRIKEYGDSENGFSLLAL
CRSPLDTHRSLIASRLSGLRSLNTKMMGDSSFTDLVAASPDACASVVEGLDEFGLSPPIVYATGIPPFVTEHMAR
ADFDHHEAYSLRQQLATDVATSMTKYREEVLAVAEEERRVQERRKDYMPALHCWMSKLASKGVLEEVMDTLRSGP
ADSP*
Coding >Hirsu2|9088
CTGAACTTCTTGCCCCAGCCAGTCTTCGGATTGATATTCCTCTTTCACTATGCCCCCCAGCTAGTTGATGAGGAG
GAGGAAGACGGCGAGGAGGCTCCGGTTTGGTTTGCCAACCAGACAACCAACAATTCGTGCGCGTCGGTCGCCCTG
GTCAACATTGTCATGAATGCCGAGGACGTGGAGCTCGGCGACGAGCTTCAGAACTTCAAAGACTTGACCAAGGAC
CTGAACTCGGCCCTTCGTGGCTATCAGATCGGAGCCAACGACTTCATCAGAGCAGCGCACAACTCATTCGCGCGG
CGAATCGACCTGCTGAATGCTGACCTGTGCTTGGCCAACGAGGTGGAGGCGGCCCAGATTGAACCGCCCCAGAAG
CGTTTGATCAAGCGCAGAGGGGCGACGAGCAGGTCCGGCGACAAGCAGAAGACGGCAGGACCGAGGACCGCGGCG
GCGAGAGCAAAGAAGAAGCAGCCCCATGTCGAATACGGATTTCACTTCATCGCGTATGTTCCTGCCGGTGGCTTC
GTCTGGGAGCTTGACGGCATGAGAACGAAGCCTCGGAACATAGGAGGCGAGCTGACCGAGAAAAGTTGGACGGAC
ATCGTGTTACCCCGGATCCAGCACCGCATCAAAGAGTATGGTGACAGCGAGAACGGCTTCAGCCTTCTGGCACTG
TGCCGCAGCCCTCTCGACACGCACCGGAGTTTGATTGCCTCGAGACTGAGCGGACTCCGCTCCCTAAATACCAAA
ATGATGGGCGACTCCTCGTTCACGGATCTCGTCGCCGCCAGCCCTGACGCTTGCGCCAGCGTAGTAGAAGGTCTT
GACGAGTTTGGCCTCTCGCCGCCCATTGTGTACGCCACAGGAATCCCTCCCTTCGTCACGGAGCACATGGCGCGC
GCCGACTTCGACCATCACGAAGCCTATAGCCTGCGCCAGCAACTTGCTACCGACGTCGCAACCTCCATGACTAAG
TACCGCGAGGAGGTCCTGGCTGTAGCGGAGGAGGAACGGCGCGTACAGGAGCGAAGGAAGGATTACATGCCGGCG
CTCCACTGCTGGATGTCCAAGCTGGCCAGTAAGGGAGTATTAGAGGAAGTGATGGACACATTGCGGTCAGGTCCT
GCCGACTCGCCCTAG
Transcript >Hirsu2|9088
CTGAACTTCTTGCCCCAGCCAGTCTTCGGATTGATATTCCTCTTTCACTATGCCCCCCAGCTAGTTGATGAGGAG
GAGGAAGACGGCGAGGAGGCTCCGGTTTGGTTTGCCAACCAGACAACCAACAATTCGTGCGCGTCGGTCGCCCTG
GTCAACATTGTCATGAATGCCGAGGACGTGGAGCTCGGCGACGAGCTTCAGAACTTCAAAGACTTGACCAAGGAC
CTGAACTCGGCCCTTCGTGGCTATCAGATCGGAGCCAACGACTTCATCAGAGCAGCGCACAACTCATTCGCGCGG
CGAATCGACCTGCTGAATGCTGACCTGTGCTTGGCCAACGAGGTGGAGGCGGCCCAGATTGAACCGCCCCAGAAG
CGTTTGATCAAGCGCAGAGGGGCGACGAGCAGGTCCGGCGACAAGCAGAAGACGGCAGGACCGAGGACCGCGGCG
GCGAGAGCAAAGAAGAAGCAGCCCCATGTCGAATACGGATTTCACTTCATCGCGTATGTTCCTGCCGGTGGCTTC
GTCTGGGAGCTTGACGGCATGAGAACGAAGCCTCGGAACATAGGAGGCGAGCTGACCGAGAAAAGTTGGACGGAC
ATCGTGTTACCCCGGATCCAGCACCGCATCAAAGAGTATGGTGACAGCGAGAACGGCTTCAGCCTTCTGGCACTG
TGCCGCAGCCCTCTCGACACGCACCGGAGTTTGATTGCCTCGAGACTGAGCGGACTCCGCTCCCTAAATACCAAA
ATGATGGGCGACTCCTCGTTCACGGATCTCGTCGCCGCCAGCCCTGACGCTTGCGCCAGCGTAGTAGAAGGTCTT
GACGAGTTTGGCCTCTCGCCGCCCATTGTGTACGCCACAGGAATCCCTCCCTTCGTCACGGAGCACATGGCGCGC
GCCGACTTCGACCATCACGAAGCCTATAGCCTGCGCCAGCAACTTGCTACCGACGTCGCAACCTCCATGACTAAG
TACCGCGAGGAGGTCCTGGCTGTAGCGGAGGAGGAACGGCGCGTACAGGAGCGAAGGAAGGATTACATGCCGGCG
CTCCACTGCTGGATGTCCAAGCTGGCCAGTAAGGGAGTATTAGAGGAAGTGATGGACACATTGCGGTCAGGTCCT
GCCGACTCGCCCTAG
Gene >Hirsu2|9088
CTGAACTTCTTGCCGTGAGTCTACCTTCAAGCTTCACTGAACCGTGTGCTGACAACTCTTCTCAACGTCTTTTGC
AGCCAGCCAGTCTTCGGATTGATATTCCTCTTTCACTATGCCCCCCAGCTAGTTGATGAGGAGGAGGAAGACGGC
GAGGAGGCTCCGGTTTGGTTTGCCAACCAGGTTGTAATCACCACCCAGCAAAGTCCCCGCCTCGCTGACCGTAAC
TCGCTGATCGATGGCCTTGTTTAGACAACCAACAATTCGTGCGCGTCGGTCGCCCTGGTCAACATTGTCATGAAT
GCCGAGGACGTGGAGCTCGGCGACGAGCTTCAGAACTTCAAAGACTTGACCAAGGACCTGAACTCGGCCCTTCGT
GGCTATCAGATCGGAGCCAACGACTTCATCAGAGCAGCGCACAACTCATTCGCGCGGCGAATCGACCTGCTGAAT
GCTGACCTGTGCTTGGCCAACGAGGTGGAGGCGGCCCAGATTGAACCGCCCCAGAAGCGTTTGATCAAGCGCAGA
GGGGCGACGAGCAGGTCCGGCGACAAGCAGAAGACGGCAGGACCGAGGACCGCGGCGGCGAGAGCAAAGAAGAAG
CAGCCCCATGTCGAATACGGATTTCACTTCATCGCGTATGTTCCTGCCGGTGGCTTCGTCTGGGAGCTTGACGGC
ATGAGAACGAAGCCTCGGAACATAGGTGAGAAATCCACATCGTCTGCACAGAAAATAAAAATTGACCGTTGTGGT
CGCTGACCTCCATCAGCAGGAGGCGAGCTGACCGAGAAAAGTTGGACGGACATCGTGTTACCCCGGATCCAGCAC
CGCATCAAAGAGTATGGTGACAGCGAGAACGGCTTCAGCCTTCTGGCACTGTGCCGCAGCCCTCTCGACACGCAC
CGGAGTTTGATTGCCTCGAGACTGAGCGGACTCCGCTCCCTAAATACCAAAATGATGGGCGACTCCTCGTTCACG
GATCTCGTCGCCGCCAGCCCTGACGCTTGCGCCAGCGTAGTAGAAGGTCTTGACGAGTTTGGCCTCTCGCCGCCC
ATTGTGTACGCCACAGGAATCCCTCCCTTCGTCACGGAGCACATGGCGCGCGCCGACTTCGACCATCACGAAGCC
TATAGCCTGCGCCAGCAACTTGCTACCGACGTCGCAACCTCCATGACTAAGTACCGCGAGGAGGTCCTGGCTGTA
GCGGAGGAGGAACGGCGCGTACAGGAGCGAAGGAAGGATTACATGCCGGCGCTCCACTGCTGGATGTCCAAGCTG
GCCAGTAAGGGAGTATTAGAGGAAGTGATGGACACATTGCGGTCAGGTCCTGCCGACTCGCCCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail