Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|9080
Gene name
LocationContig_636:10234..14237
Strand+
Gene length (bp)4003
Transcript length (bp)3306
Coding sequence length (bp)3306
Protein length (aa) 1102

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00069 Pkinase Protein kinase domain 6.5E-72 48 301
PF07714 Pkinase_Tyr Protein tyrosine kinase 3.8E-50 50 297

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|A2QHV0|SEPH_ASPNC Cytokinesis protein sepH OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=sepH PE=3 SV=1 13 1101 0.0E+00
sp|Q5B4Z3|SEPH_EMENI Cytokinesis protein sepH OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=sepH PE=3 SV=2 3 1101 0.0E+00
sp|Q0CL79|SEPH_ASPTN Cytokinesis protein sepH OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=sepH PE=3 SV=2 14 1101 0.0E+00
sp|P41892|CDC7_SCHPO Cell division control protein 7 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cdc7 PE=1 SV=1 50 470 1.0E-108
sp|Q8T2I8|SEPA_DICDI Serine/threonine-protein kinase sepA OS=Dictyostelium discoideum GN=sepA PE=2 SV=1 47 436 1.0E-106
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|A2QHV0|SEPH_ASPNC Cytokinesis protein sepH OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=sepH PE=3 SV=1 13 1101 0.0E+00
sp|Q5B4Z3|SEPH_EMENI Cytokinesis protein sepH OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=sepH PE=3 SV=2 3 1101 0.0E+00
sp|Q0CL79|SEPH_ASPTN Cytokinesis protein sepH OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=sepH PE=3 SV=2 14 1101 0.0E+00
sp|P41892|CDC7_SCHPO Cell division control protein 7 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cdc7 PE=1 SV=1 50 470 1.0E-108
sp|Q8T2I8|SEPA_DICDI Serine/threonine-protein kinase sepA OS=Dictyostelium discoideum GN=sepA PE=2 SV=1 47 436 1.0E-106
sp|Q9LJD8|M3KE1_ARATH MAP3K epsilon protein kinase 1 OS=Arabidopsis thaliana GN=M3KE1 PE=1 SV=1 33 392 4.0E-91
sp|A0A078CGE6|M3KE1_BRANA MAP3K epsilon protein kinase 1 OS=Brassica napus GN=M3KE1 PE=1 SV=1 33 307 1.0E-89
sp|Q9SFB6|M3KE2_ARATH MAP3K epsilon protein kinase 2 OS=Arabidopsis thaliana GN=MAP3KE2 PE=2 SV=1 33 307 5.0E-88
sp|Q8T2I8|SEPA_DICDI Serine/threonine-protein kinase sepA OS=Dictyostelium discoideum GN=sepA PE=2 SV=1 696 1093 3.0E-83
sp|Q54PX0|Y4251_DICDI Probable serine/threonine-protein kinase DDB_G0284251 OS=Dictyostelium discoideum GN=DDB_G0284251 PE=3 SV=1 47 345 9.0E-82
sp|Q54XJ4|Y8901_DICDI Probable serine/threonine-protein kinase DDB_G0278901 OS=Dictyostelium discoideum GN=DDB_G0278901 PE=3 SV=1 47 351 3.0E-77
sp|O22042|M3K3_ARATH Mitogen-activated protein kinase kinase kinase 3 OS=Arabidopsis thaliana GN=ANP3 PE=1 SV=1 25 313 1.0E-73
sp|Q9FZ36|M3K2_ARATH Mitogen-activated protein kinase kinase kinase 2 OS=Arabidopsis thaliana GN=ANP2 PE=2 SV=1 48 309 3.0E-73
sp|Q40541|NPK1_TOBAC Mitogen-activated protein kinase kinase kinase NPK1 OS=Nicotiana tabacum GN=NPK1 PE=1 SV=1 24 314 6.0E-73
sp|O22040|ANP1_ARATH Mitogen-activated protein kinase kinase kinase ANP1 OS=Arabidopsis thaliana GN=ANP1 PE=1 SV=2 48 309 3.0E-72
sp|Q55CA6|Y0146_DICDI Probable serine/threonine-protein kinase DDB_G0270146 OS=Dictyostelium discoideum GN=DDB_G0270146 PE=3 SV=1 20 305 7.0E-72
sp|Q54QI2|Y9877_DICDI Serine/threonine-protein kinase DDB_G0283821 OS=Dictyostelium discoideum GN=DDB_G0283821 PE=3 SV=1 48 317 1.0E-68
sp|P41892|CDC7_SCHPO Cell division control protein 7 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cdc7 PE=1 SV=1 656 1101 7.0E-66
sp|P27636|CDC15_YEAST Cell division control protein 15 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CDC15 PE=1 SV=3 48 309 1.0E-62
sp|Q9Y2U5|M3K2_HUMAN Mitogen-activated protein kinase kinase kinase 2 OS=Homo sapiens GN=MAP3K2 PE=1 SV=2 47 301 2.0E-61
sp|Q9CAD5|YODA_ARATH Mitogen-activated protein kinase kinase kinase YODA OS=Arabidopsis thaliana GN=YDA PE=1 SV=1 21 311 7.0E-60
sp|Q61083|M3K2_MOUSE Mitogen-activated protein kinase kinase kinase 2 OS=Mus musculus GN=Map3k2 PE=1 SV=2 47 301 8.0E-60
sp|P28829|BYR2_SCHPO Protein kinase byr2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=byr2 PE=1 SV=1 51 302 2.0E-59
sp|Q54R82|MKKA_DICDI Mitogen-activated protein kinase kinase kinase A OS=Dictyostelium discoideum GN=mkkA PE=1 SV=2 48 301 3.0E-59
sp|Q99759|M3K3_HUMAN Mitogen-activated protein kinase kinase kinase 3 OS=Homo sapiens GN=MAP3K3 PE=1 SV=2 47 300 1.0E-56
sp|Q61084|M3K3_MOUSE Mitogen-activated protein kinase kinase kinase 3 OS=Mus musculus GN=Map3k3 PE=1 SV=1 47 300 2.0E-56
sp|O61122|SVKA_DICDI Serine/threonine-protein kinase svkA OS=Dictyostelium discoideum GN=svkA PE=1 SV=1 48 309 4.0E-56
sp|E9Q3S4|M3K19_MOUSE Mitogen-activated protein kinase kinase kinase 19 OS=Mus musculus GN=Map3k19 PE=3 SV=1 51 305 3.0E-55
sp|Q56UN5|M3K19_HUMAN Mitogen-activated protein kinase kinase kinase 19 OS=Homo sapiens GN=MAP3K19 PE=2 SV=1 51 305 3.0E-55
sp|P23561|STE11_YEAST Serine/threonine-protein kinase STE11 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=STE11 PE=1 SV=3 46 301 4.0E-55
sp|A7A1P0|STE11_YEAS7 Serine/threonine-protein kinase STE11 OS=Saccharomyces cerevisiae (strain YJM789) GN=STE11 PE=3 SV=1 46 301 4.0E-55
sp|Q01389|BCK1_YEAST Serine/threonine-protein kinase BCK1/SLK1/SSP31 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=BCK1 PE=1 SV=1 51 300 1.0E-54
sp|B5VNQ3|STE11_YEAS6 Serine/threonine-protein kinase STE11 OS=Saccharomyces cerevisiae (strain AWRI1631) GN=STE11 PE=3 SV=2 46 301 1.0E-54
sp|O14047|PPK11_SCHPO Serine/threonine-protein kinase ppk11 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ppk11 PE=3 SV=1 48 301 4.0E-53
sp|Q5E9L6|STK4_BOVIN Serine/threonine-protein kinase 4 OS=Bos taurus GN=STK4 PE=2 SV=1 52 305 2.0E-52
sp|O61125|STK4_DICDI Serine/threonine-protein kinase 4 homolog A OS=Dictyostelium discoideum GN=krsA PE=1 SV=1 35 305 2.0E-52
sp|A4K2S1|STK4_LEMCA Serine/threonine-protein kinase 4 OS=Lemur catta GN=STK4 PE=3 SV=1 52 305 3.0E-52
sp|A4K2M3|STK4_PAPAN Serine/threonine-protein kinase 4 OS=Papio anubis GN=STK4 PE=3 SV=1 52 305 3.0E-52
sp|A4K2Q5|STK4_OTOGA Serine/threonine-protein kinase 4 OS=Otolemur garnettii GN=STK4 PE=3 SV=1 52 305 3.0E-52
sp|A4K2W5|STK4_AOTNA Serine/threonine-protein kinase 4 OS=Aotus nancymaae GN=STK4 PE=3 SV=1 52 305 3.0E-52
sp|A4K2Y1|STK4_CHLAE Serine/threonine-protein kinase 4 OS=Chlorocebus aethiops GN=STK4 PE=3 SV=1 52 305 4.0E-52
sp|A4K2P5|STK4_COLGU Serine/threonine-protein kinase 4 OS=Colobus guereza GN=STK4 PE=3 SV=1 52 305 4.0E-52
sp|A4K2T0|STK4_MACMU Serine/threonine-protein kinase 4 OS=Macaca mulatta GN=STK4 PE=3 SV=1 52 305 4.0E-52
sp|Q13043|STK4_HUMAN Serine/threonine-protein kinase 4 OS=Homo sapiens GN=STK4 PE=1 SV=2 52 305 5.0E-52
sp|Q9JI11|STK4_MOUSE Serine/threonine-protein kinase 4 OS=Mus musculus GN=Stk4 PE=1 SV=1 52 305 5.0E-52
sp|Q7ZUQ3|STK3_DANRE Serine/threonine-protein kinase 3 OS=Danio rerio GN=stk3 PE=2 SV=1 52 305 2.0E-51
sp|Q9JI10|STK3_MOUSE Serine/threonine-protein kinase 3 OS=Mus musculus GN=Stk3 PE=1 SV=1 25 305 3.0E-51
sp|Q39008|M3K1_ARATH Mitogen-activated protein kinase kinase kinase 1 OS=Arabidopsis thaliana GN=MEKK1 PE=1 SV=2 45 301 5.0E-51
sp|Q13188|STK3_HUMAN Serine/threonine-protein kinase 3 OS=Homo sapiens GN=STK3 PE=1 SV=2 25 305 5.0E-51
sp|Q5ZJK4|STK4_CHICK Serine/threonine-protein kinase 4 OS=Gallus gallus GN=STK4 PE=2 SV=1 52 307 6.0E-51
sp|Q6IP06|STK3_XENLA Serine/threonine-protein kinase 3 OS=Xenopus laevis GN=stk3 PE=2 SV=1 25 305 7.0E-51
sp|Q802A6|STK4_SQUAC Serine/threonine-protein kinase 3/4 OS=Squalus acanthias GN=STK4 PE=2 SV=1 52 305 8.0E-51
sp|O14305|SID1_SCHPO Serine/threonine-protein kinase sid1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sid1 PE=1 SV=1 48 311 9.0E-51
sp|Q86IX1|DST1_DICDI Serine/threonine-protein kinase dst1 OS=Dictyostelium discoideum GN=dst1 PE=3 SV=1 48 305 1.0E-50
sp|Q6PA14|STK4_XENLA Serine/threonine-protein kinase 4 OS=Xenopus laevis GN=stk4 PE=2 SV=1 52 305 1.0E-50
sp|P35465|PAK1_RAT Serine/threonine-protein kinase PAK 1 OS=Rattus norvegicus GN=Pak1 PE=1 SV=3 32 301 2.0E-50
sp|Q13153|PAK1_HUMAN Serine/threonine-protein kinase PAK 1 OS=Homo sapiens GN=PAK1 PE=1 SV=2 32 301 2.0E-50
sp|O54748|STK3_RAT Serine/threonine-protein kinase 3 OS=Rattus norvegicus GN=Stk3 PE=1 SV=1 25 305 2.0E-50
sp|Q08E52|PAK1_BOVIN Serine/threonine-protein kinase PAK 1 OS=Bos taurus GN=PAK1 PE=1 SV=1 32 301 2.0E-50
sp|Q62829|PAK3_RAT Serine/threonine-protein kinase PAK 3 OS=Rattus norvegicus GN=Pak3 PE=1 SV=1 32 301 2.0E-50
sp|Q7YQL3|PAK3_PONPY Serine/threonine-protein kinase PAK 3 OS=Pongo pygmaeus GN=PAK3 PE=2 SV=1 32 301 4.0E-50
sp|Q7YQL4|PAK3_PANTR Serine/threonine-protein kinase PAK 3 OS=Pan troglodytes GN=PAK3 PE=2 SV=1 32 301 4.0E-50
sp|O75914|PAK3_HUMAN Serine/threonine-protein kinase PAK 3 OS=Homo sapiens GN=PAK3 PE=1 SV=2 32 301 4.0E-50
sp|Q61036|PAK3_MOUSE Serine/threonine-protein kinase PAK 3 OS=Mus musculus GN=Pak3 PE=1 SV=2 32 301 5.0E-50
sp|Q6P3Q4|STK4_XENTR Serine/threonine-protein kinase 4 OS=Xenopus tropicalis GN=stk4 PE=2 SV=1 52 305 5.0E-50
sp|O88643|PAK1_MOUSE Serine/threonine-protein kinase PAK 1 OS=Mus musculus GN=Pak1 PE=1 SV=1 32 301 5.0E-50
sp|Q9P289|STK26_HUMAN Serine/threonine-protein kinase 26 OS=Homo sapiens GN=STK26 PE=1 SV=2 39 328 6.0E-50
sp|Q8AXB4|PAK3_XENLA Serine/threonine-protein kinase PAK 3 OS=Xenopus laevis GN=pak3 PE=2 SV=1 32 301 7.0E-50
sp|Q9NB31|CST1_CAEEL Serine/threonine-protein kinase cst-1 OS=Caenorhabditis elegans GN=cst-1 PE=1 SV=1 36 301 7.0E-50
sp|Q99JT2|STK26_MOUSE Serine/threonine-protein kinase 26 OS=Mus musculus GN=Stk26 PE=1 SV=1 39 328 8.0E-50
sp|A8XJW8|CST1_CAEBR Serine/threonine-protein kinase cst-1 OS=Caenorhabditis briggsae GN=cst-1 PE=3 SV=2 36 301 2.0E-49
sp|Q10407|MKH1_SCHPO MAP kinase kinase kinase mkh1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mkh1 PE=3 SV=1 51 301 2.0E-48
sp|Q9Y4K4|M4K5_HUMAN Mitogen-activated protein kinase kinase kinase kinase 5 OS=Homo sapiens GN=MAP4K5 PE=1 SV=1 46 309 3.0E-48
sp|Q64303|PAK2_RAT Serine/threonine-protein kinase PAK 2 OS=Rattus norvegicus GN=Pak2 PE=1 SV=1 32 301 4.0E-48
sp|Q8CIN4|PAK2_MOUSE Serine/threonine-protein kinase PAK 2 OS=Mus musculus GN=Pak2 PE=1 SV=1 32 301 4.0E-48
sp|Q29502|PAK2_RABIT Serine/threonine-protein kinase PAK 2 OS=Oryctolagus cuniculus GN=PAK2 PE=2 SV=1 32 301 5.0E-48
sp|Q13177|PAK2_HUMAN Serine/threonine-protein kinase PAK 2 OS=Homo sapiens GN=PAK2 PE=1 SV=3 32 301 7.0E-48
sp|Q924I2|M4K3_RAT Mitogen-activated protein kinase kinase kinase kinase 3 OS=Rattus norvegicus GN=Map4k3 PE=1 SV=2 46 302 8.0E-48
sp|Q8BPM2|M4K5_MOUSE Mitogen-activated protein kinase kinase kinase kinase 5 OS=Mus musculus GN=Map4k5 PE=1 SV=2 47 309 8.0E-48
sp|Q8IVH8|M4K3_HUMAN Mitogen-activated protein kinase kinase kinase kinase 3 OS=Homo sapiens GN=MAP4K3 PE=1 SV=1 46 302 9.0E-48
sp|Q9Z2W1|STK25_MOUSE Serine/threonine-protein kinase 25 OS=Mus musculus GN=Stk25 PE=1 SV=2 54 338 1.0E-47
sp|Q99JP0|M4K3_MOUSE Mitogen-activated protein kinase kinase kinase kinase 3 OS=Mus musculus GN=Map4k3 PE=1 SV=4 46 302 1.0E-47
sp|O00506|STK25_HUMAN Serine/threonine-protein kinase 25 OS=Homo sapiens GN=STK25 PE=1 SV=1 54 338 2.0E-47
sp|Q3SWY6|STK25_BOVIN Serine/threonine-protein kinase 25 OS=Bos taurus GN=STK25 PE=2 SV=1 54 383 2.0E-47
sp|F1NBT0|STK10_CHICK Serine/threonine-protein kinase 10 OS=Gallus gallus GN=STK10 PE=3 SV=2 31 351 2.0E-47
sp|Q2VWQ3|STE20_TALMA Serine/threonine-protein kinase pakA OS=Talaromyces marneffei GN=pakA PE=3 SV=1 18 327 4.0E-47
sp|Q55GC2|DST2_DICDI Serine/threonine-protein kinase dst2 OS=Dictyostelium discoideum GN=dst2 PE=3 SV=1 48 305 5.0E-47
sp|Q9Y6E0|STK24_HUMAN Serine/threonine-protein kinase 24 OS=Homo sapiens GN=STK24 PE=1 SV=1 52 328 6.0E-47
sp|O81472|MP3K2_ARATH Mitogen-activated protein kinase kinase kinase 9 OS=Arabidopsis thaliana GN=MEKK2 PE=1 SV=1 48 301 8.0E-47
sp|H2L099|GCK1_CAEEL Germinal center kinase 1 OS=Caenorhabditis elegans GN=gck-1 PE=1 SV=1 52 306 1.0E-46
sp|Q99KH8|STK24_MOUSE Serine/threonine-protein kinase 24 OS=Mus musculus GN=Stk24 PE=1 SV=1 52 329 2.0E-46
sp|B0LT89|STK24_RAT Serine/threonine-protein kinase 24 OS=Rattus norvegicus GN=Stk24 PE=2 SV=1 52 329 2.0E-46
sp|Q54RV3|PAKG_DICDI Serine/threonine-protein kinase pakG OS=Dictyostelium discoideum GN=pakG PE=3 SV=1 38 302 2.0E-46
sp|Q4WHP3|STE20_ASPFU Serine/threonine-protein kinase ste20 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=ste20 PE=3 SV=2 31 302 2.0E-46
sp|Q869T7|PAKF_DICDI Serine/threonine-protein kinase pakF OS=Dictyostelium discoideum GN=pakF PE=3 SV=1 44 305 2.0E-46
sp|O14299|WIS4_SCHPO MAP kinase kinase kinase wis4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=wis4 PE=3 SV=1 48 306 2.0E-46
sp|Q8T0S6|HIPPO_DROME Serine/threonine-protein kinase hippo OS=Drosophila melanogaster GN=hpo PE=1 SV=1 36 412 4.0E-46
sp|Q55FS2|STK4L_DICDI Serine/threonine-protein kinase 4 homolog B OS=Dictyostelium discoideum GN=krsB PE=3 SV=1 39 301 1.0E-45
sp|Q2ULU3|STE20_ASPOR Serine/threonine-protein kinase ste20 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=ste20 PE=3 SV=1 31 327 1.0E-45
sp|Q75DK7|STE20_ASHGO Serine/threonine-protein kinase STE20 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=STE20 PE=3 SV=2 42 312 2.0E-45
sp|Q6FN53|STE20_CANGA Serine/threonine-protein kinase STE20 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=STE20 PE=3 SV=1 42 302 3.0E-45
sp|O95382|M3K6_HUMAN Mitogen-activated protein kinase kinase kinase 6 OS=Homo sapiens GN=MAP3K6 PE=1 SV=3 54 310 3.0E-45
sp|Q03497|STE20_YEAST Serine/threonine-protein kinase STE20 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=STE20 PE=1 SV=1 42 315 5.0E-45
sp|A2AQW0|M3K15_MOUSE Mitogen-activated protein kinase kinase kinase 15 OS=Mus musculus GN=Map3k15 PE=1 SV=1 54 301 6.0E-45
sp|Q9WTR2|M3K6_MOUSE Mitogen-activated protein kinase kinase kinase 6 OS=Mus musculus GN=Map3k6 PE=1 SV=4 54 310 6.0E-45
sp|Q7SY52|STK10_DANRE Serine/threonine-protein kinase 10 OS=Danio rerio GN=stk10 PE=2 SV=1 50 362 6.0E-45
sp|Q7RZD3|STE20_NEUCR Serine/threonine-protein kinase ste20 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=stk-4 PE=3 SV=1 48 301 9.0E-45
sp|Q6ZN16|M3K15_HUMAN Mitogen-activated protein kinase kinase kinase 15 OS=Homo sapiens GN=MAP3K15 PE=1 SV=2 54 301 1.0E-44
sp|Q9Y6R4|M3K4_HUMAN Mitogen-activated protein kinase kinase kinase 4 OS=Homo sapiens GN=MAP3K4 PE=1 SV=2 48 301 1.0E-44
sp|Q9SZ67|WRK19_ARATH Probable WRKY transcription factor 19 OS=Arabidopsis thaliana GN=WRKY19 PE=2 SV=1 48 301 2.0E-44
sp|P38692|KIC1_YEAST Serine/threonine-protein kinase KIC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KIC1 PE=1 SV=1 48 313 2.0E-44
sp|Q17850|PK1_CAEEL Serine/threonine-protein kinase pak-1 OS=Caenorhabditis elegans GN=pak-1 PE=1 SV=2 46 312 2.0E-44
sp|Q5BBL3|STE20_EMENI Serine/threonine-protein kinase ste20 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=ste20 PE=3 SV=1 42 301 3.0E-44
sp|E9PTG8|STK10_RAT Serine/threonine-protein kinase 10 OS=Rattus norvegicus GN=Stk10 PE=1 SV=1 50 327 3.0E-44
sp|O54988|SLK_MOUSE STE20-like serine/threonine-protein kinase OS=Mus musculus GN=Slk PE=1 SV=2 50 302 3.0E-44
sp|O08648|M3K4_MOUSE Mitogen-activated protein kinase kinase kinase 4 OS=Mus musculus GN=Map3k4 PE=1 SV=2 48 301 3.0E-44
sp|O55092|SLK_CAVPO STE20-like serine/threonine-protein kinase OS=Cavia porcellus GN=SLK PE=1 SV=1 50 302 4.0E-44
sp|Q7Z8E9|STE20_MAGO7 Serine/threonine-protein kinase MST20 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=MST20 PE=3 SV=3 48 301 4.0E-44
sp|Q12469|SKM1_YEAST Serine/threonine-protein kinase SKM1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SKM1 PE=1 SV=1 48 302 5.0E-44
sp|Q6C3D7|STE20_YARLI Serine/threonine-protein kinase STE20 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=STE20 PE=3 SV=1 42 301 5.0E-44
sp|O08815|SLK_RAT STE20-like serine/threonine-protein kinase OS=Rattus norvegicus GN=Slk PE=1 SV=1 50 302 6.0E-44
sp|Q99683|M3K5_HUMAN Mitogen-activated protein kinase kinase kinase 5 OS=Homo sapiens GN=MAP3K5 PE=1 SV=1 54 316 8.0E-44
sp|E1BK52|STK10_BOVIN Serine/threonine-protein kinase 10 OS=Bos taurus GN=STK10 PE=3 SV=3 50 324 8.0E-44
sp|Q9H2G2|SLK_HUMAN STE20-like serine/threonine-protein kinase OS=Homo sapiens GN=SLK PE=1 SV=1 50 302 9.0E-44
sp|Q6CVA2|STE20_KLULA Serine/threonine-protein kinase STE20 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=STE20 PE=3 SV=1 54 313 1.0E-43
sp|O35099|M3K5_MOUSE Mitogen-activated protein kinase kinase kinase 5 OS=Mus musculus GN=Map3k5 PE=1 SV=3 54 316 1.0E-43
sp|Q556S2|PAKH_DICDI Serine/threonine-protein kinase pakH OS=Dictyostelium discoideum GN=pakH-1 PE=3 SV=1 44 305 1.0E-43
sp|P25390|SSK22_YEAST Serine/threonine-protein kinase SSK22 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SSK22 PE=1 SV=2 54 305 1.0E-43
sp|P08458|SPS1_YEAST Sporulation-specific protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SPS1 PE=1 SV=2 43 301 2.0E-43
sp|O94804|STK10_HUMAN Serine/threonine-protein kinase 10 OS=Homo sapiens GN=STK10 PE=1 SV=1 50 411 2.0E-43
sp|P0CY24|STE20_CANAL Serine/threonine-protein kinase CST20 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CST20 PE=3 SV=1 54 302 2.0E-43
sp|Q54JG7|DST4_DICDI Serine/threonine-protein kinase dst4 OS=Dictyostelium discoideum GN=dst4 PE=3 SV=1 48 310 2.0E-43
sp|O55098|STK10_MOUSE Serine/threonine-protein kinase 10 OS=Mus musculus GN=Stk10 PE=1 SV=2 50 302 2.0E-43
sp|C4YRB7|STE20_CANAW Serine/threonine-protein kinase CST20 OS=Candida albicans (strain WO-1) GN=CST20 PE=3 SV=2 54 302 2.0E-43
sp|P0CY23|STE20_CANAX Serine/threonine-protein kinase CST20 OS=Candida albicans GN=CST20 PE=3 SV=1 54 302 2.0E-43
sp|Q6BNF3|STE20_DEBHA Serine/threonine-protein kinase STE20 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=STE20 PE=3 SV=2 54 301 3.0E-43
sp|Q4P5N0|STE20_USTMA Serine/threonine-protein kinase SMU1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=SMU1 PE=3 SV=1 42 314 4.0E-43
sp|Q5R495|OXSR1_PONAB Serine/threonine-protein kinase OSR1 OS=Pongo abelii GN=OXSR1 PE=2 SV=1 47 308 9.0E-43
sp|Q12851|M4K2_HUMAN Mitogen-activated protein kinase kinase kinase kinase 2 OS=Homo sapiens GN=MAP4K2 PE=1 SV=2 39 300 9.0E-43
sp|Q0IHQ8|STK10_XENTR Serine/threonine-protein kinase 10 OS=Xenopus tropicalis GN=stk10 PE=2 SV=1 31 316 1.0E-42
sp|O95747|OXSR1_HUMAN Serine/threonine-protein kinase OSR1 OS=Homo sapiens GN=OXSR1 PE=1 SV=1 47 308 1.0E-42
sp|Q55D99|PAKA_DICDI Serine/threonine-protein kinase pakA OS=Dictyostelium discoideum GN=pakA PE=1 SV=1 39 301 2.0E-42
sp|Q61161|M4K2_MOUSE Mitogen-activated protein kinase kinase kinase kinase 2 OS=Mus musculus GN=Map4k2 PE=1 SV=1 39 298 2.0E-42
sp|Q863I2|OXSR1_PIG Serine/threonine-protein kinase OSR1 OS=Sus scrofa GN=OXSR1 PE=2 SV=1 47 308 2.0E-42
sp|Q92918|M4K1_HUMAN Mitogen-activated protein kinase kinase kinase kinase 1 OS=Homo sapiens GN=MAP4K1 PE=1 SV=1 48 302 2.0E-42
sp|Q6P9R2|OXSR1_MOUSE Serine/threonine-protein kinase OSR1 OS=Mus musculus GN=Oxsr1 PE=1 SV=1 47 308 2.0E-42
sp|Q9HFW2|CLA4_ASHGO Serine/threonine-protein kinase CLA4 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=CLA4 PE=3 SV=1 48 308 3.0E-42
sp|Q8NEV4|MYO3A_HUMAN Myosin-IIIa OS=Homo sapiens GN=MYO3A PE=2 SV=2 48 302 5.0E-42
sp|Q54C77|Y3184_DICDI Probable inactive serine/threonine-protein kinase DDB_G0293184 OS=Dictyostelium discoideum GN=DDB_G0293184 PE=3 SV=1 74 302 6.0E-42
sp|P50527|STE20_SCHPO Serine/threonine-protein kinase shk1/pak1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=shk1 PE=1 SV=2 48 301 6.0E-42
sp|Q54B33|PAKE_DICDI Serine/threonine-protein kinase pakE OS=Dictyostelium discoideum GN=pakE PE=3 SV=1 48 309 1.0E-41
sp|O75011|NAK1_SCHPO Serine/threonine-protein kinase nak1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=nak1 PE=1 SV=1 48 306 2.0E-41
sp|B7ZR30|STK10_XENLA Serine/threonine-protein kinase 10-A OS=Xenopus laevis GN=stk10-a PE=1 SV=1 31 316 5.0E-41
sp|Q9I9E0|TAOK3_CHICK Serine/threonine-protein kinase TAO3 OS=Gallus gallus GN=TAOK3 PE=2 SV=2 54 305 8.0E-41
sp|B4KYX8|PLK4_DROMO Serine/threonine-protein kinase PLK4 OS=Drosophila mojavensis GN=SAK PE=3 SV=1 45 356 1.0E-40
sp|O14427|CLA4_CANAX Serine/threonine-protein kinase CLA4 OS=Candida albicans GN=CLA4 PE=3 SV=1 48 301 1.0E-40
sp|Q8K3H5|MYO3A_MOUSE Myosin-IIIa OS=Mus musculus GN=Myo3a PE=2 SV=1 48 302 2.0E-40
sp|Q8BYC6|TAOK3_MOUSE Serine/threonine-protein kinase TAO3 OS=Mus musculus GN=Taok3 PE=1 SV=2 54 305 2.0E-40
sp|Q9H2K8|TAOK3_HUMAN Serine/threonine-protein kinase TAO3 OS=Homo sapiens GN=TAOK3 PE=1 SV=2 54 305 2.0E-40
sp|Q5APR8|CLA4_CANAL Serine/threonine-protein kinase CLA4 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CLA4 PE=1 SV=1 48 301 2.0E-40
sp|Q13233|M3K1_HUMAN Mitogen-activated protein kinase kinase kinase 1 OS=Homo sapiens GN=MAP3K1 PE=1 SV=4 18 298 2.0E-40
sp|O59790|ARK1_SCHPO Serine/threonine-protein kinase ark1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ark1 PE=1 SV=2 48 302 2.0E-40
sp|Q53UA7|TAOK3_RAT Serine/threonine-protein kinase TAO3 OS=Rattus norvegicus GN=Taok3 PE=1 SV=1 54 305 2.0E-40
sp|Q6DD27|TAOK3_XENLA Serine/threonine-protein kinase TAO3 OS=Xenopus laevis GN=taok3 PE=2 SV=1 54 305 4.0E-40
sp|P53349|M3K1_MOUSE Mitogen-activated protein kinase kinase kinase 1 OS=Mus musculus GN=Map3k1 PE=1 SV=3 18 298 4.0E-40
sp|P53599|SSK2_YEAST MAP kinase kinase kinase SSK2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SSK2 PE=1 SV=1 54 305 6.0E-40
sp|Q55GV3|PAKC_DICDI Serine/threonine-protein kinase pakC OS=Dictyostelium discoideum GN=pakC PE=1 SV=2 41 301 7.0E-40
sp|Q9H4B4|PLK3_HUMAN Serine/threonine-protein kinase PLK3 OS=Homo sapiens GN=PLK3 PE=1 SV=2 46 298 9.0E-40
sp|P48562|CLA4_YEAST Serine/threonine-protein kinase CLA4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CLA4 PE=1 SV=1 48 301 1.0E-39
sp|Q62925|M3K1_RAT Mitogen-activated protein kinase kinase kinase 1 OS=Rattus norvegicus GN=Map3k1 PE=1 SV=1 18 298 1.0E-39
sp|A2VDZ4|PLK4_BOVIN Serine/threonine-protein kinase PLK4 OS=Bos taurus GN=PLK4 PE=2 SV=1 45 302 1.0E-39
sp|Q21029|NSY1_CAEEL Mitogen-activated protein kinase kinase kinase nsy-1 OS=Caenorhabditis elegans GN=nsy-1 PE=1 SV=4 54 316 1.0E-39
sp|Q5R9Z7|PLK4_PONAB Serine/threonine-protein kinase PLK4 OS=Pongo abelii GN=PLK4 PE=2 SV=1 45 302 2.0E-39
sp|P83510|TNIK_MOUSE Traf2 and NCK-interacting protein kinase OS=Mus musculus GN=Tnik PE=1 SV=2 27 301 2.0E-39
sp|Q9UKE5|TNIK_HUMAN TRAF2 and NCK-interacting protein kinase OS=Homo sapiens GN=TNIK PE=1 SV=1 27 301 2.0E-39
sp|O00444|PLK4_HUMAN Serine/threonine-protein kinase PLK4 OS=Homo sapiens GN=PLK4 PE=1 SV=3 45 302 2.0E-39
sp|P70218|M4K1_MOUSE Mitogen-activated protein kinase kinase kinase kinase 1 OS=Mus musculus GN=Map4k1 PE=1 SV=1 48 302 2.0E-39
sp|Q5F2E8|TAOK1_MOUSE Serine/threonine-protein kinase TAO1 OS=Mus musculus GN=Taok1 PE=1 SV=1 54 305 3.0E-39
sp|O88664|TAOK1_RAT Serine/threonine-protein kinase TAO1 OS=Rattus norvegicus GN=Taok1 PE=1 SV=1 54 305 3.0E-39
sp|Q5R4F3|TAOK3_PONAB Serine/threonine-protein kinase TAO3 OS=Pongo abelii GN=TAOK3 PE=2 SV=1 54 305 3.0E-39
sp|Q7L7X3|TAOK1_HUMAN Serine/threonine-protein kinase TAO1 OS=Homo sapiens GN=TAOK1 PE=1 SV=1 54 305 3.0E-39
sp|Q60806|PLK3_MOUSE Serine/threonine-protein kinase PLK3 OS=Mus musculus GN=Plk3 PE=1 SV=2 46 298 4.0E-39
sp|Q54EY4|DST3_DICDI Serine/threonine-protein kinase dst3 OS=Dictyostelium discoideum GN=dst3 PE=3 SV=1 48 301 5.0E-39
sp|Q9UEW8|STK39_HUMAN STE20/SPS1-related proline-alanine-rich protein kinase OS=Homo sapiens GN=STK39 PE=1 SV=3 48 313 5.0E-39
sp|Q54XL6|FRAY1_DICDI Serine/threonine-protein kinase fray1 OS=Dictyostelium discoideum GN=fray1 PE=3 SV=1 48 306 5.0E-39
sp|Q869N2|PAKB_DICDI Serine/threonine-protein kinase pakB OS=Dictyostelium discoideum GN=pakB PE=1 SV=1 54 301 6.0E-39
sp|Q9Z1W9|STK39_MOUSE STE20/SPS1-related proline-alanine-rich protein kinase OS=Mus musculus GN=Stk39 PE=1 SV=1 48 313 7.0E-39
sp|B2GUY1|PLK4_RAT Serine/threonine-protein kinase PLK4 OS=Rattus norvegicus GN=Plk4 PE=2 SV=1 45 302 7.0E-39
sp|Q9R011|PLK3_RAT Serine/threonine-protein kinase PLK3 OS=Rattus norvegicus GN=Plk3 PE=1 SV=2 25 298 9.0E-39
sp|O88506|STK39_RAT STE20/SPS1-related proline-alanine-rich protein kinase OS=Rattus norvegicus GN=Stk39 PE=1 SV=2 48 313 1.0E-38
sp|B3M6I4|PLK4_DROAN Serine/threonine-protein kinase PLK4 OS=Drosophila ananassae GN=SAK PE=3 SV=1 45 356 1.0E-38
sp|Q6GPK9|TAOK2_XENLA Serine/threonine-protein kinase TAO2 OS=Xenopus laevis GN=taok2 PE=2 SV=1 54 305 1.0E-38
sp|Q64702|PLK4_MOUSE Serine/threonine-protein kinase PLK4 OS=Mus musculus GN=Plk4 PE=1 SV=2 45 313 2.0E-38
sp|B4LDJ6|PLK4_DROVI Serine/threonine-protein kinase PLK4 OS=Drosophila virilis GN=SAK PE=3 SV=1 45 356 2.0E-38
sp|O74304|WIN1_SCHPO MAP kinase kinase kinase win1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=win1 PE=1 SV=1 48 301 2.0E-38
sp|Q6BVA0|IPL1_DEBHA Spindle assembly checkpoint kinase OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=IPL1 PE=3 SV=2 34 306 2.0E-38
sp|Q8TDX7|NEK7_HUMAN Serine/threonine-protein kinase Nek7 OS=Homo sapiens GN=NEK7 PE=1 SV=1 45 289 2.0E-38
sp|O96013|PAK4_HUMAN Serine/threonine-protein kinase PAK 4 OS=Homo sapiens GN=PAK4 PE=1 SV=1 54 302 2.0E-38
sp|Q9NGW9|MKCB_DICDI Probable serine/threonine-protein kinase mkcB OS=Dictyostelium discoideum GN=mkcB PE=2 SV=1 42 301 2.0E-38
sp|Q69ZM6|STK36_MOUSE Serine/threonine-protein kinase 36 OS=Mus musculus GN=Stk36 PE=1 SV=3 45 303 3.0E-38
sp|Q6NU21|TAO1A_XENLA Serine/threonine-protein kinase TAO1-A OS=Xenopus laevis GN=taok1-a PE=2 SV=1 54 305 3.0E-38
sp|O23304|BLUS1_ARATH Serine/threonine-protein kinase BLUS1 OS=Arabidopsis thaliana GN=BLUS1 PE=1 SV=1 54 305 3.0E-38
sp|Q7ZYJ0|TAO1B_XENLA Serine/threonine-protein kinase TAO1-B OS=Xenopus laevis GN=taok1-b PE=2 SV=1 54 305 3.0E-38
sp|G5EGQ3|MAX2_CAEEL Serine/threonine-protein kinase max-2 OS=Caenorhabditis elegans GN=max-2 PE=1 SV=1 45 305 3.0E-38
sp|Q10056|SHK2_SCHPO Serine/threonine-protein kinase shk2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=shk2 PE=3 SV=1 35 301 4.0E-38
sp|B3DL84|PLK4_XENTR Serine/threonine-protein kinase PLK4 OS=Xenopus tropicalis GN=plk4 PE=2 SV=1 46 363 4.0E-38
sp|D4A280|PAK7_RAT Serine/threonine-protein kinase PAK 7 OS=Rattus norvegicus GN=Pak7 PE=1 SV=1 54 301 4.0E-38
sp|Q9P286|PAK7_HUMAN Serine/threonine-protein kinase PAK 7 OS=Homo sapiens GN=PAK7 PE=1 SV=1 54 301 4.0E-38
sp|A2BD05|NEK6_PIG Serine/threonine-protein kinase Nek6 OS=Sus scrofa GN=NEK6 PE=3 SV=1 24 304 4.0E-38
sp|Q6NW76|AURKB_DANRE Aurora kinase B OS=Danio rerio GN=aurkb PE=2 SV=1 28 314 4.0E-38
sp|Q8C015|PAK7_MOUSE Serine/threonine-protein kinase PAK 7 OS=Mus musculus GN=Pak7 PE=1 SV=1 54 301 4.0E-38
sp|Q8WXR4|MYO3B_HUMAN Myosin-IIIb OS=Homo sapiens GN=MYO3B PE=2 SV=4 48 303 5.0E-38
sp|Q6PAD2|PLK4_XENLA Serine/threonine-protein kinase PLK4 OS=Xenopus laevis GN=plk4 PE=2 SV=1 46 363 5.0E-38
sp|Q924X7|STK33_MOUSE Serine/threonine-protein kinase 33 OS=Mus musculus GN=Stk33 PE=1 SV=2 48 375 5.0E-38
sp|Q8BTW9|PAK4_MOUSE Serine/threonine-protein kinase PAK 4 OS=Mus musculus GN=Pak4 PE=1 SV=1 54 301 5.0E-38
sp|Q551H4|FRAY2_DICDI Serine/threonine-protein kinase fray2 OS=Dictyostelium discoideum GN=fray2 PE=3 SV=1 48 308 6.0E-38
sp|Q6ZQ29|TAOK2_MOUSE Serine/threonine-protein kinase TAO2 OS=Mus musculus GN=Taok2 PE=1 SV=3 54 305 7.0E-38
sp|G5EFU0|PK2_CAEEL Serine/threonine-protein kinase pak-2 OS=Caenorhabditis elegans GN=pak-2 PE=2 SV=1 45 309 9.0E-38
sp|Q9JLS3|TAOK2_RAT Serine/threonine-protein kinase TAO2 OS=Rattus norvegicus GN=Taok2 PE=1 SV=1 54 305 9.0E-38
sp|Q55CE0|MKCF_DICDI Probable serine/threonine-protein kinase mkcF OS=Dictyostelium discoideum GN=mkcF PE=3 SV=1 46 309 1.0E-37
sp|Q1EG27|MYO3B_MOUSE Myosin-IIIb OS=Mus musculus GN=Myo3b PE=2 SV=2 42 305 1.0E-37
sp|D3ZBE5|NEK7_RAT Serine/threonine-protein kinase Nek7 OS=Rattus norvegicus GN=Nek7 PE=2 SV=1 45 289 1.0E-37
sp|F4JBP3|ATG1B_ARATH Serine/threonine-protein kinase ATG1b OS=Arabidopsis thaliana GN=ATG1B PE=2 SV=1 45 302 1.0E-37
sp|Q9VXE5|PAKM_DROME Serine/threonine-protein kinase PAK mbt OS=Drosophila melanogaster GN=mbt PE=1 SV=2 54 315 1.0E-37
sp|Q9NRP7|STK36_HUMAN Serine/threonine-protein kinase 36 OS=Homo sapiens GN=STK36 PE=1 SV=2 45 303 1.0E-37
sp|Q9ES74|NEK7_MOUSE Serine/threonine-protein kinase Nek7 OS=Mus musculus GN=Nek7 PE=1 SV=1 45 289 1.0E-37
sp|Q9UL54|TAOK2_HUMAN Serine/threonine-protein kinase TAO2 OS=Homo sapiens GN=TAOK2 PE=1 SV=2 54 305 1.0E-37
sp|Q5RAJ5|STK36_PONAB Serine/threonine-protein kinase 36 OS=Pongo abelii GN=STK36 PE=2 SV=1 45 303 2.0E-37
sp|Q6C3J2|IPL1_YARLI Spindle assembly checkpoint kinase OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=IPL1 PE=3 SV=1 3 305 2.0E-37
sp|P59895|NEK6_RAT Serine/threonine-protein kinase Nek6 OS=Rattus norvegicus GN=Nek6 PE=1 SV=1 25 289 2.0E-37
sp|Q9ES70|NEK6_MOUSE Serine/threonine-protein kinase Nek6 OS=Mus musculus GN=Nek6 PE=1 SV=1 45 304 2.0E-37
sp|Q16W24|PLK4_AEDAE Serine/threonine-protein kinase PLK4 OS=Aedes aegypti GN=SAK PE=3 SV=1 45 301 2.0E-37
sp|Q9LJD8|M3KE1_ARATH MAP3K epsilon protein kinase 1 OS=Arabidopsis thaliana GN=M3KE1 PE=1 SV=1 746 933 3.0E-37
sp|A0A078CGE6|M3KE1_BRANA MAP3K epsilon protein kinase 1 OS=Brassica napus GN=M3KE1 PE=1 SV=1 746 933 3.0E-37
sp|Q6CWQ4|IPL1_KLULA Spindle assembly checkpoint kinase OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=IPL1 PE=3 SV=1 6 305 3.0E-37
sp|G5EEN4|GCK3_CAEEL Germinal center kinase 3 OS=Caenorhabditis elegans GN=gck-3 PE=1 SV=1 48 301 3.0E-37
sp|Q4FZD7|PLK5_MOUSE Inactive serine/threonine-protein kinase PLK5 OS=Mus musculus GN=Plk5 PE=1 SV=1 34 297 3.0E-37
sp|Q2LYK3|PLK4_DROPS Serine/threonine-protein kinase PLK4 OS=Drosophila pseudoobscura pseudoobscura GN=SAK PE=3 SV=1 45 356 4.0E-37
sp|B4HBU3|PLK4_DROPE Serine/threonine-protein kinase PLK4 OS=Drosophila persimilis GN=SAK PE=3 SV=1 45 356 4.0E-37
sp|F4J6F6|IREH1_ARATH Probable serine/threonine protein kinase IREH1 OS=Arabidopsis thaliana GN=IREH1 PE=1 SV=1 45 293 4.0E-37
sp|Q5R8Z4|PAK6_PONAB Serine/threonine-protein kinase PAK 6 OS=Pongo abelii GN=PAK6 PE=2 SV=1 54 301 4.0E-37
sp|Q9NQU5|PAK6_HUMAN Serine/threonine-protein kinase PAK 6 OS=Homo sapiens GN=PAK6 PE=1 SV=1 54 301 5.0E-37
sp|O64629|AUR3_ARATH Serine/threonine-protein kinase Aurora-3 OS=Arabidopsis thaliana GN=AUR3 PE=2 SV=1 45 302 5.0E-37
sp|Q9JM52|MINK1_MOUSE Misshapen-like kinase 1 OS=Mus musculus GN=Mink1 PE=1 SV=3 28 301 9.0E-37
sp|O13839|FIN1_SCHPO G2-specific protein kinase fin1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=fin1 PE=3 SV=1 45 305 1.0E-36
sp|Q9HC98|NEK6_HUMAN Serine/threonine-protein kinase Nek6 OS=Homo sapiens GN=NEK6 PE=1 SV=2 45 304 1.0E-36
sp|B4QK53|PLK4_DROSI Serine/threonine-protein kinase PLK4 OS=Drosophila simulans GN=SAK PE=3 SV=1 45 346 1.0E-36
sp|B4J3F1|PLK4_DROGR Serine/threonine-protein kinase PLK4 OS=Drosophila grimshawi GN=SAK PE=3 SV=1 45 353 1.0E-36
sp|B3NE99|PLK4_DROER Serine/threonine-protein kinase PLK4 OS=Drosophila erecta GN=SAK PE=3 SV=1 45 337 1.0E-36
sp|B4MXR8|PLK4_DROWI Serine/threonine-protein kinase PLK4 OS=Drosophila willistoni GN=SAK PE=3 SV=1 45 356 2.0E-36
sp|Q8N4C8|MINK1_HUMAN Misshapen-like kinase 1 OS=Homo sapiens GN=MINK1 PE=1 SV=2 28 301 2.0E-36
sp|B4IAQ8|PLK4_DROSE Serine/threonine-protein kinase PLK4 OS=Drosophila sechellia GN=SAK PE=3 SV=1 45 337 2.0E-36
sp|Q3ULB5|PAK6_MOUSE Serine/threonine-protein kinase PAK 6 OS=Mus musculus GN=Pak6 PE=2 SV=1 54 301 3.0E-36
sp|B4PDM5|PLK4_DROYA Serine/threonine-protein kinase PLK4 OS=Drosophila yakuba GN=SAK PE=3 SV=1 45 337 3.0E-36
sp|F1LP90|MINK1_RAT Misshapen-like kinase 1 OS=Rattus norvegicus GN=Mink1 PE=1 SV=2 39 301 3.0E-36
sp|O95819|M4K4_HUMAN Mitogen-activated protein kinase kinase kinase kinase 4 OS=Homo sapiens GN=MAP4K4 PE=1 SV=2 38 301 3.0E-36
sp|Q54DC8|Y2350_DICDI Probable serine/threonine-protein kinase DDB_G0292350 OS=Dictyostelium discoideum GN=DDB_G0292350 PE=3 SV=1 20 309 4.0E-36
sp|O97143|PLK4_DROME Serine/threonine-protein kinase PLK4 OS=Drosophila melanogaster GN=SAK PE=1 SV=1 45 337 4.0E-36
sp|P33886|WIS1_SCHPO Protein kinase wis1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=wis1 PE=1 SV=1 52 312 6.0E-36
sp|Q9M077|AUR1_ARATH Serine/threonine-protein kinase Aurora-1 OS=Arabidopsis thaliana GN=AUR1 PE=1 SV=1 45 302 7.0E-36
sp|Q869W6|MYLKG_DICDI Probable myosin light chain kinase DDB_G0275057 OS=Dictyostelium discoideum GN=DDB_G0275057 PE=3 SV=1 48 329 1.0E-35
sp|Q23356|MIG15_CAEEL Serine/threonine-protein kinase mig-15 OS=Caenorhabditis elegans GN=mig-15 PE=2 SV=3 48 301 1.0E-35
sp|B0WAU8|PLK4_CULQU Serine/threonine-protein kinase PLK4 OS=Culex quinquefasciatus GN=SAK PE=3 SV=1 45 331 1.0E-35
sp|P53351|PLK2_MOUSE Serine/threonine-protein kinase PLK2 OS=Mus musculus GN=Plk2 PE=1 SV=1 13 301 1.0E-35
sp|Q9LT35|NEK6_ARATH Serine/threonine-protein kinase Nek6 OS=Arabidopsis thaliana GN=NEK6 PE=3 SV=1 45 335 1.0E-35
sp|Q9R012|PLK2_RAT Serine/threonine-protein kinase PLK2 OS=Rattus norvegicus GN=Plk2 PE=1 SV=1 13 301 1.0E-35
sp|Q28GW8|MELK_XENTR Maternal embryonic leucine zipper kinase OS=Xenopus tropicalis GN=melk PE=2 SV=1 45 369 1.0E-35
sp|Q6H7U5|CIPKQ_ORYSJ CBL-interacting protein kinase 26 OS=Oryza sativa subsp. japonica GN=CIPK26 PE=2 SV=1 48 313 2.0E-35
sp|Q9BYT3|STK33_HUMAN Serine/threonine-protein kinase 33 OS=Homo sapiens GN=STK33 PE=1 SV=1 48 328 2.0E-35
sp|F4IRW0|ATG1C_ARATH Serine/threonine-protein kinase ATG1c OS=Arabidopsis thaliana GN=ATG1C PE=2 SV=1 47 302 2.0E-35
sp|F4HYG2|IRE3_ARATH Probable serine/threonine protein kinase IRE3 OS=Arabidopsis thaliana GN=IRE3 PE=2 SV=1 45 293 2.0E-35
sp|G5EFM9|NEKL3_CAEEL Serine/threonine-protein kinase nekl-3 OS=Caenorhabditis elegans GN=nekl-3 PE=1 SV=1 54 299 3.0E-35
sp|A7SNN5|PLK4_NEMVE Serine/threonine-protein kinase PLK4 OS=Nematostella vectensis GN=v1g246408 PE=3 SV=1 45 302 3.0E-35
sp|Q755C4|IPL1_ASHGO Spindle assembly checkpoint kinase OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=IPL1 PE=3 SV=1 38 305 4.0E-35
sp|Q54JQ1|MKCC_DICDI Probable serine/threonine-protein kinase mkcC OS=Dictyostelium discoideum GN=mkcC PE=3 SV=1 46 309 5.0E-35
sp|Q86AD7|MYLKB_DICDI Probable myosin light chain kinase DDB_G0271550 OS=Dictyostelium discoideum GN=DDB_G0271550 PE=3 SV=1 41 359 6.0E-35
sp|Q5R4L1|PLK2_PONAB Serine/threonine-protein kinase PLK2 OS=Pongo abelii GN=PLK2 PE=3 SV=1 37 301 6.0E-35
sp|Q9NYY3|PLK2_HUMAN Serine/threonine-protein kinase PLK2 OS=Homo sapiens GN=PLK2 PE=1 SV=3 37 301 6.0E-35
sp|Q9SLI2|NEK1_ARATH Serine/threonine-protein kinase Nek1 OS=Arabidopsis thaliana GN=NEK1 PE=2 SV=2 45 298 6.0E-35
sp|Q9CAU7|NEK2_ARATH Serine/threonine-protein kinase Nek2 OS=Arabidopsis thaliana GN=NEK2 PE=2 SV=1 45 361 7.0E-35
sp|Q8SSV3|MKCD_DICDI Probable serine/threonine-protein kinase mkcD OS=Dictyostelium discoideum GN=mkcD PE=3 SV=1 55 302 8.0E-35
sp|A7J1T0|M313B_XENLA Mitogen-activated protein kinase kinase kinase 13-B OS=Xenopus laevis GN=map3k13-b PE=2 SV=1 54 340 1.0E-34
sp|Q5JLQ9|CIPKU_ORYSJ CBL-interacting protein kinase 30 OS=Oryza sativa subsp. japonica GN=CIPK30 PE=2 SV=1 48 301 1.0E-34
sp|Q63796|M3K12_RAT Mitogen-activated protein kinase kinase kinase 12 OS=Rattus norvegicus GN=Map3k12 PE=1 SV=1 54 339 1.0E-34
sp|Q6YY75|NEK6_ORYSJ Serine/threonine-protein kinase Nek6 OS=Oryza sativa subsp. japonica GN=NEK6 PE=3 SV=2 45 301 1.0E-34
sp|P51954|NEK1_MOUSE Serine/threonine-protein kinase Nek1 OS=Mus musculus GN=Nek1 PE=1 SV=2 54 302 1.0E-34
sp|A8X6H4|CMK1_CAEBR Calcium/calmodulin-dependent protein kinase type 1 OS=Caenorhabditis briggsae GN=cmk-1 PE=3 SV=3 28 340 2.0E-34
sp|P0C8M8|CCR1_MAIZE Probable serine/threonine-protein kinase CCRP1 OS=Zea mays GN=CCRP1 PE=1 SV=1 42 304 2.0E-34
sp|Q683C9|AUR2_ARATH Serine/threonine-protein kinase Aurora-2 OS=Arabidopsis thaliana GN=AUR2 PE=2 SV=2 47 302 2.0E-34
sp|O14965|AURKA_HUMAN Aurora kinase A OS=Homo sapiens GN=AURKA PE=1 SV=2 32 304 2.0E-34
sp|Q8BW96|KCC1D_MOUSE Calcium/calmodulin-dependent protein kinase type 1D OS=Mus musculus GN=Camk1d PE=1 SV=2 46 335 3.0E-34
sp|Q12852|M3K12_HUMAN Mitogen-activated protein kinase kinase kinase 12 OS=Homo sapiens GN=MAP3K12 PE=1 SV=2 54 339 3.0E-34
sp|O43283|M3K13_HUMAN Mitogen-activated protein kinase kinase kinase 13 OS=Homo sapiens GN=MAP3K13 PE=1 SV=1 54 340 3.0E-34
sp|Q8IU85|KCC1D_HUMAN Calcium/calmodulin-dependent protein kinase type 1D OS=Homo sapiens GN=CAMK1D PE=1 SV=1 46 335 3.0E-34
sp|Q96PY6|NEK1_HUMAN Serine/threonine-protein kinase Nek1 OS=Homo sapiens GN=NEK1 PE=1 SV=2 54 302 4.0E-34
sp|Q0VD22|STK33_BOVIN Serine/threonine-protein kinase 33 OS=Bos taurus GN=STK33 PE=2 SV=1 48 328 4.0E-34
sp|A5GFW1|AURKA_PIG Aurora kinase A OS=Sus scrofa GN=AURKA PE=3 SV=1 4 306 4.0E-34
sp|Q60700|M3K12_MOUSE Mitogen-activated protein kinase kinase kinase 12 OS=Mus musculus GN=Map3k12 PE=1 SV=1 54 339 4.0E-34
sp|Q1HKZ5|M3K13_MOUSE Mitogen-activated protein kinase kinase kinase 13 OS=Mus musculus GN=Map3k13 PE=1 SV=1 54 339 4.0E-34
sp|Q9LWM4|CIPK5_ORYSJ CBL-interacting protein kinase 5 OS=Oryza sativa subsp. japonica GN=CIPK5 PE=2 SV=1 48 301 5.0E-34
sp|Q4V7Q6|ULK3_XENLA Serine/threonine-protein kinase ULK3 OS=Xenopus laevis GN=ulk3 PE=2 SV=1 43 301 5.0E-34
sp|Q2TA06|AURKA_BOVIN Aurora kinase A OS=Bos taurus GN=AURKA PE=2 SV=1 25 306 5.0E-34
sp|O01427|AIR2_CAEEL Aurora/IPL1-related protein kinase 2 OS=Caenorhabditis elegans GN=air-2 PE=1 SV=2 45 308 5.0E-34
sp|Q7ZVS3|PLK4_DANRE Serine/threonine-protein kinase PLK4 OS=Danio rerio GN=plk4 PE=2 SV=2 45 304 5.0E-34
sp|Q8RXT4|NEK4_ARATH Serine/threonine-protein kinase Nek4 OS=Arabidopsis thaliana GN=NEK4 PE=2 SV=1 45 364 6.0E-34
sp|Q07832|PLK1_MOUSE Serine/threonine-protein kinase PLK1 OS=Mus musculus GN=Plk1 PE=1 SV=2 24 296 8.0E-34
sp|P51956|NEK3_HUMAN Serine/threonine-protein kinase Nek3 OS=Homo sapiens GN=NEK3 PE=1 SV=2 45 302 8.0E-34
sp|F4JY37|RUK_ARATH Serine/threonine-protein kinase RUNKEL OS=Arabidopsis thaliana GN=RUK PE=1 SV=1 45 300 9.0E-34
sp|Q5R8X7|M3K13_PONAB Mitogen-activated protein kinase kinase kinase 13 OS=Pongo abelii GN=MAP3K13 PE=2 SV=1 54 340 9.0E-34
sp|Q39030|KPK2_ARATH Serine/threonine-protein kinase AtPK2/AtPK19 OS=Arabidopsis thaliana GN=ATPK2 PE=1 SV=2 12 322 9.0E-34
sp|Q6P3R8|NEK5_HUMAN Serine/threonine-protein kinase Nek5 OS=Homo sapiens GN=NEK5 PE=2 SV=1 45 301 9.0E-34
sp|Q9SFB6|M3KE2_ARATH MAP3K epsilon protein kinase 2 OS=Arabidopsis thaliana GN=MAP3KE2 PE=2 SV=1 746 933 1.0E-33
sp|P42818|KPK1_ARATH Serine/threonine-protein kinase AtPK1/AtPK6 OS=Arabidopsis thaliana GN=ATPK1 PE=1 SV=1 44 303 1.0E-33
sp|Q9SPK4|PPCK1_ARATH Phosphoenolpyruvate carboxylase kinase 1 OS=Arabidopsis thaliana GN=PPCK1 PE=1 SV=1 48 301 1.0E-33
sp|A7J1T2|M313A_XENLA Mitogen-activated protein kinase kinase kinase 13-A OS=Xenopus laevis GN=map3k13-a PE=2 SV=1 54 340 1.0E-33
sp|P51957|NEK4_HUMAN Serine/threonine-protein kinase Nek4 OS=Homo sapiens GN=NEK4 PE=1 SV=2 54 301 1.0E-33
sp|D3ZHP7|ULK3_RAT Serine/threonine-protein kinase ULK3 OS=Rattus norvegicus GN=Ulk3 PE=1 SV=1 43 301 2.0E-33
sp|Q2TA25|PLK1_BOVIN Serine/threonine-protein kinase PLK1 OS=Bos taurus GN=PLK1 PE=2 SV=2 54 296 2.0E-33
sp|Q91821|MELK_XENLA Maternal embryonic leucine zipper kinase OS=Xenopus laevis GN=melk PE=1 SV=2 45 301 2.0E-33
sp|Q0JI49|CIPKB_ORYSJ CBL-interacting protein kinase 11 OS=Oryza sativa subsp. japonica GN=CIPK11 PE=2 SV=1 48 300 2.0E-33
sp|P54644|KRAC_DICDI RAC family serine/threonine-protein kinase homolog OS=Dictyostelium discoideum GN=pkbA PE=1 SV=1 44 301 2.0E-33
sp|Q9TXJ0|CMK1_CAEEL Calcium/calmodulin-dependent protein kinase type 1 OS=Caenorhabditis elegans GN=cmk-1 PE=1 SV=1 48 340 2.0E-33
sp|Q7Z2Y5|NRK_HUMAN Nik-related protein kinase OS=Homo sapiens GN=NRK PE=1 SV=2 48 301 2.0E-33
sp|P46549|SULU_CAEEL Serine/threonine-protein kinase SULU OS=Caenorhabditis elegans GN=kin-18 PE=2 SV=1 41 305 2.0E-33
sp|Q61XD3|AIR2_CAEBR Aurora/IPL1-related protein kinase 2 OS=Caenorhabditis briggsae GN=air-2 PE=3 SV=1 45 302 2.0E-33
sp|Q3U3Q1|ULK3_MOUSE Serine/threonine-protein kinase ULK3 OS=Mus musculus GN=Ulk3 PE=2 SV=1 43 301 2.0E-33
sp|Q62673|PLK1_RAT Serine/threonine-protein kinase PLK1 OS=Rattus norvegicus GN=Plk1 PE=2 SV=2 46 296 2.0E-33
sp|P32491|MKK2_YEAST MAP kinase kinase MKK2/SSP33 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MKK2 PE=1 SV=2 54 313 2.0E-33
sp|P53350|PLK1_HUMAN Serine/threonine-protein kinase PLK1 OS=Homo sapiens GN=PLK1 PE=1 SV=1 54 312 2.0E-33
sp|Q91820|AURAA_XENLA Aurora kinase A-A OS=Xenopus laevis GN=aurka-a PE=1 SV=1 45 301 2.0E-33
sp|Q62862|MP2K5_RAT Dual specificity mitogen-activated protein kinase kinase 5 OS=Rattus norvegicus GN=Map2k5 PE=1 SV=1 2 312 3.0E-33
sp|Q9P7I2|KCC1_SCHPO Calcium/calmodulin-dependent protein kinase type I OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cmk1 PE=1 SV=1 48 333 3.0E-33
sp|Q6PHR2|ULK3_HUMAN Serine/threonine-protein kinase ULK3 OS=Homo sapiens GN=ULK3 PE=1 SV=2 43 301 3.0E-33
sp|Q9LE81|IRE_ARATH Probable serine/threonine protein kinase IRE OS=Arabidopsis thaliana GN=IRE PE=2 SV=1 45 292 3.0E-33
sp|Q38873|CDPK7_ARATH Calcium-dependent protein kinase 7 OS=Arabidopsis thaliana GN=CPK7 PE=2 SV=1 38 307 4.0E-33
sp|Q9S7U9|M2K2_ARATH Mitogen-activated protein kinase kinase 2 OS=Arabidopsis thaliana GN=MKK2 PE=1 SV=2 45 301 4.0E-33
sp|A7MBB4|M3K13_BOVIN Mitogen-activated protein kinase kinase kinase 13 OS=Bos taurus GN=MAP3K13 PE=2 SV=1 54 340 4.0E-33
sp|U4PR86|MELK_CAEEL Maternal embryonic leucine zipper kinase OS=Caenorhabditis elegans GN=pig-1 PE=1 SV=1 48 329 4.0E-33
sp|Q42438|CDPK8_ARATH Calcium-dependent protein kinase 8 OS=Arabidopsis thaliana GN=CPK8 PE=1 SV=1 38 307 5.0E-33
sp|Q5ZJH6|ULK3_CHICK Serine/threonine-protein kinase ULK3 OS=Gallus gallus GN=ULK3 PE=2 SV=1 43 301 5.0E-33
sp|Q59S66|IPL1_CANAL Spindle assembly checkpoint kinase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=IPL1 PE=3 SV=1 41 305 5.0E-33
sp|Q10GB1|NEK1_ORYSJ Serine/threonine-protein kinase Nek1 OS=Oryza sativa subsp. japonica GN=NEK1 PE=3 SV=1 45 298 5.0E-33
sp|Q8WNU8|NEK11_MACFA Serine/threonine-protein kinase Nek11 OS=Macaca fascicularis GN=NEK11 PE=2 SV=1 48 301 6.0E-33
sp|Q59W62|GIN4_CANAL Serine/threonine-protein kinase GIN4 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=GIN4 PE=1 SV=1 48 302 6.0E-33
sp|Q9N2L7|PLK2_CAEEL Serine/threonine-protein kinase plk-2 OS=Caenorhabditis elegans GN=plk-2 PE=2 SV=1 48 312 7.0E-33
sp|Q55DD4|PAKD_DICDI Serine/threonine-protein kinase pakD OS=Dictyostelium discoideum GN=pakD PE=3 SV=1 48 325 7.0E-33
sp|Q13163|MP2K5_HUMAN Dual specificity mitogen-activated protein kinase kinase 5 OS=Homo sapiens GN=MAP2K5 PE=1 SV=2 46 312 8.0E-33
sp|Q8NG66|NEK11_HUMAN Serine/threonine-protein kinase Nek11 OS=Homo sapiens GN=NEK11 PE=1 SV=2 48 301 8.0E-33
sp|P97477|AURKA_MOUSE Aurora kinase A OS=Mus musculus GN=Aurka PE=1 SV=1 16 304 8.0E-33
sp|Q8RX66|NEK3_ARATH Serine/threonine-protein kinase Nek3 OS=Arabidopsis thaliana GN=NEK3 PE=2 SV=1 45 298 9.0E-33
sp|P97820|M4K4_MOUSE Mitogen-activated protein kinase kinase kinase kinase 4 OS=Mus musculus GN=Map4k4 PE=1 SV=1 38 301 1.0E-32
sp|Q9R0A5|NEK3_MOUSE Serine/threonine-protein kinase Nek3 OS=Mus musculus GN=Nek3 PE=1 SV=2 45 296 1.0E-32
sp|Q91VB2|KCC1G_MOUSE Calcium/calmodulin-dependent protein kinase type 1G OS=Mus musculus GN=Camk1g PE=1 SV=1 46 335 1.0E-32
sp|Q91819|AURAB_XENLA Aurora kinase A-B OS=Xenopus laevis GN=aurka-b PE=2 SV=3 3 314 1.0E-32
sp|Q54WX4|AURK_DICDI Aurora kinase OS=Dictyostelium discoideum GN=aurK PE=1 SV=1 45 301 1.0E-32
sp|A4IGM9|AURKB_XENTR Aurora kinase B OS=Xenopus tropicalis GN=aurkb PE=2 SV=1 45 314 1.0E-32
sp|Q7TNJ7|KCC1G_RAT Calcium/calmodulin-dependent protein kinase type 1G OS=Rattus norvegicus GN=Camk1g PE=2 SV=1 46 335 1.0E-32
sp|F1QGZ6|MELK_DANRE Maternal embryonic leucine zipper kinase OS=Danio rerio GN=melk PE=2 SV=1 45 301 1.0E-32
sp|Q9Z1J2|NEK4_MOUSE Serine/threonine-protein kinase Nek4 OS=Mus musculus GN=Nek4 PE=1 SV=1 54 301 1.0E-32
sp|D7UQM5|AURK_PATPE Aurora kinase OS=Patiria pectinifera GN=aur PE=1 SV=1 45 301 2.0E-32
sp|Q9FJ54|CIPKK_ARATH CBL-interacting serine/threonine-protein kinase 20 OS=Arabidopsis thaliana GN=CIPK20 PE=1 SV=1 45 361 2.0E-32
sp|Q94C95|ATG1A_ARATH Serine/threonine-protein kinase ATG1a OS=Arabidopsis thaliana GN=ATG1A PE=1 SV=1 47 306 2.0E-32
sp|P34102|PK3_DICDI Protein kinase 3 OS=Dictyostelium discoideum GN=pkgC PE=3 SV=2 34 292 2.0E-32
sp|Q6ZEZ5|NEK3_ORYSJ Serine/threonine-protein kinase Nek3 OS=Oryza sativa subsp. japonica GN=NEK3 PE=2 SV=1 45 298 2.0E-32
sp|Q6FV07|IPL1_CANGA Spindle assembly checkpoint kinase OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=IPL1 PE=3 SV=1 21 305 2.0E-32
sp|Q9UQB9|AURKC_HUMAN Aurora kinase C OS=Homo sapiens GN=AURKC PE=1 SV=1 26 313 3.0E-32
sp|P32562|CDC5_YEAST Cell cycle serine/threonine-protein kinase CDC5/MSD2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CDC5 PE=1 SV=1 28 346 3.0E-32
sp|Q9WVS7|MP2K5_MOUSE Dual specificity mitogen-activated protein kinase kinase 5 OS=Mus musculus GN=Map2k5 PE=1 SV=1 2 302 3.0E-32
sp|Q61846|MELK_MOUSE Maternal embryonic leucine zipper kinase OS=Mus musculus GN=Melk PE=1 SV=2 42 301 3.0E-32
sp|Q0WPH8|NEK5_ARATH Serine/threonine-protein kinase Nek5 OS=Arabidopsis thaliana GN=NEK5 PE=1 SV=1 45 301 3.0E-32
sp|Q8SRL5|IPL1_ENCCU Probable spindle assembly checkpoint kinase homolog OS=Encephalitozoon cuniculi (strain GB-M1) GN=IPL1 PE=3 SV=1 40 302 4.0E-32
sp|Q6GPL3|AUKBB_XENLA Aurora kinase B-B OS=Xenopus laevis GN=aurkb-b PE=2 SV=1 45 314 4.0E-32
sp|Q9C098|DCLK3_HUMAN Serine/threonine-protein kinase DCLK3 OS=Homo sapiens GN=DCLK3 PE=2 SV=2 46 301 5.0E-32
sp|Q2QMH1|NEK2_ORYSJ Serine/threonine-protein kinase Nek2 OS=Oryza sativa subsp. japonica GN=NEK2 PE=2 SV=1 45 298 5.0E-32
sp|A2ZMH2|NEK2_ORYSI Serine/threonine-protein kinase Nek2 OS=Oryza sativa subsp. indica GN=NEK2 PE=3 SV=1 45 298 5.0E-32
sp|Q8SWM6|CDC5_ENCCU Probable cell cycle serine/threonine-protein kinase CDC5 homolog OS=Encephalitozoon cuniculi (strain GB-M1) GN=CDC5 PE=3 SV=2 48 302 6.0E-32
sp|Q4V3C8|PDPK2_ARATH 3-phosphoinositide-dependent protein kinase 2 OS=Arabidopsis thaliana GN=PDPK2 PE=1 SV=1 47 315 6.0E-32
sp|P52304|POLO_DROME Serine/threonine-protein kinase polo OS=Drosophila melanogaster GN=polo PE=1 SV=2 46 305 7.0E-32
sp|Q6DE08|AUKBA_XENLA Aurora kinase B-A OS=Xenopus laevis GN=aurkb-a PE=1 SV=1 45 314 7.0E-32
sp|Q86CS2|ATG1_DICDI Serine/threonine-protein kinase atg1 OS=Dictyostelium discoideum GN=atg1 PE=3 SV=1 47 301 9.0E-32
sp|Q8BWQ5|DCLK3_MOUSE Serine/threonine-protein kinase DCLK3 OS=Mus musculus GN=Dclk3 PE=2 SV=2 46 301 1.0E-31
sp|Q14680|MELK_HUMAN Maternal embryonic leucine zipper kinase OS=Homo sapiens GN=MELK PE=1 SV=3 42 301 1.0E-31
sp|O01700|DLK1_CAEEL Mitogen-activated protein kinase kinase kinase dlk-1 OS=Caenorhabditis elegans GN=dlk-1 PE=1 SV=4 52 298 1.0E-31
sp|Q8LIG4|CIPK3_ORYSJ CBL-interacting protein kinase 3 OS=Oryza sativa subsp. japonica GN=CIPK3 PE=2 SV=1 45 311 1.0E-31
sp|Q24324|DSOR1_DROME Dual specificity mitogen-activated protein kinase kinase dSOR1 OS=Drosophila melanogaster GN=Dsor1 PE=1 SV=2 49 308 2.0E-31
sp|Q9R0G8|NRK_MOUSE Nik-related protein kinase OS=Mus musculus GN=Nrk PE=1 SV=2 48 301 2.0E-31
sp|Q96NX5|KCC1G_HUMAN Calcium/calmodulin-dependent protein kinase type 1G OS=Homo sapiens GN=CAMK1G PE=1 SV=3 46 335 2.0E-31
sp|P59241|AURKA_RAT Aurora kinase A OS=Rattus norvegicus GN=Aurka PE=1 SV=1 26 304 2.0E-31
sp|Q91YS8|KCC1A_MOUSE Calcium/calmodulin-dependent protein kinase type 1 OS=Mus musculus GN=Camk1 PE=1 SV=1 33 335 2.0E-31
sp|Q63450|KCC1A_RAT Calcium/calmodulin-dependent protein kinase type 1 OS=Rattus norvegicus GN=Camk1 PE=1 SV=2 33 335 2.0E-31
sp|A3B529|CIPKS_ORYSJ CBL-interacting protein kinase 28 OS=Oryza sativa subsp. japonica GN=CIPK28 PE=2 SV=2 45 300 2.0E-31
sp|Q14012|KCC1A_HUMAN Calcium/calmodulin-dependent protein kinase type 1 OS=Homo sapiens GN=CAMK1 PE=1 SV=1 33 335 2.0E-31
sp|Q7X996|CIPK2_ORYSJ CBL-interacting protein kinase 2 OS=Oryza sativa subsp. japonica GN=CIPK2 PE=2 SV=1 45 301 2.0E-31
sp|Q94A06|M2K1_ARATH Mitogen-activated protein kinase kinase 1 OS=Arabidopsis thaliana GN=MKK1 PE=1 SV=2 45 301 3.0E-31
sp|Q9SEZ7|CIPKG_ARATH CBL-interacting serine/threonine-protein kinase 16 OS=Arabidopsis thaliana GN=CIPK16 PE=1 SV=1 31 301 3.0E-31
sp|Q9SCU5|WNK5_ARATH Probable serine/threonine-protein kinase WNK5 OS=Arabidopsis thaliana GN=WNK5 PE=1 SV=2 42 315 4.0E-31
sp|Q9XF67|PDPK1_ARATH 3-phosphoinositide-dependent protein kinase 1 OS=Arabidopsis thaliana GN=PDPK1 PE=1 SV=1 47 315 4.0E-31
sp|O70150|KCC1B_RAT Calcium/calmodulin-dependent protein kinase type 1B OS=Rattus norvegicus GN=Pnck PE=1 SV=1 48 349 4.0E-31
sp|Q8W490|PEPK2_ARATH Serine/threonine-protein kinase PEPKR2 OS=Arabidopsis thaliana GN=PEPKR2 PE=2 SV=1 47 301 4.0E-31
sp|P34331|PLK1_CAEEL Serine/threonine-protein kinase plk-1 OS=Caenorhabditis elegans GN=plk-1 PE=1 SV=3 28 301 4.0E-31
sp|P92937|CIPKF_ARATH CBL-interacting serine/threonine-protein kinase 15 OS=Arabidopsis thaliana GN=CIPK15 PE=1 SV=2 48 301 5.0E-31
sp|O88445|AURKC_MOUSE Aurora kinase C OS=Mus musculus GN=Aurkc PE=1 SV=1 45 312 5.0E-31
sp|Q9QYK9|KCC1B_MOUSE Calcium/calmodulin-dependent protein kinase type 1B OS=Mus musculus GN=Pnck PE=1 SV=1 48 349 6.0E-31
sp|Q00526|CDK3_HUMAN Cyclin-dependent kinase 3 OS=Homo sapiens GN=CDK3 PE=1 SV=1 52 302 6.0E-31
sp|Q55FT4|TSUA_DICDI Probable serine/threonine-protein kinase tsuA OS=Dictyostelium discoideum GN=tsuA PE=1 SV=1 47 309 7.0E-31
sp|Q93VK0|PPCK2_ARATH Phosphoenolpyruvate carboxylase kinase 2 OS=Arabidopsis thaliana GN=PPCK2 PE=1 SV=2 47 301 7.0E-31
sp|P17157|PHO85_YEAST Cyclin-dependent protein kinase PHO85 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PHO85 PE=1 SV=2 52 302 7.0E-31
sp|Q86HN7|PLK_DICDI Probable serine/threonine-protein kinase PLK OS=Dictyostelium discoideum GN=PLK PE=3 SV=1 45 304 7.0E-31
sp|Q9Y884|SKH1_SCHPO MAP kinase kinase skh1/pek1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=skh1 PE=3 SV=1 17 306 7.0E-31
sp|Q7TSC3|NEK5_MOUSE Serine/threonine-protein kinase Nek5 OS=Mus musculus GN=Nek5 PE=2 SV=1 45 301 8.0E-31
sp|Q54MH0|FHKD_DICDI Probable serine/threonine-protein kinase fhkD OS=Dictyostelium discoideum GN=fhkD PE=3 SV=1 46 323 8.0E-31
sp|Q5E9Y0|CDK2_BOVIN Cyclin-dependent kinase 2 OS=Bos taurus GN=CDK2 PE=2 SV=1 45 301 8.0E-31
sp|Q9SN43|CIPKC_ARATH CBL-interacting serine/threonine-protein kinase 12 OS=Arabidopsis thaliana GN=CIPK12 PE=1 SV=1 35 301 8.0E-31
sp|Q00532|CDKL1_HUMAN Cyclin-dependent kinase-like 1 OS=Homo sapiens GN=CDKL1 PE=1 SV=5 54 308 9.0E-31
sp|Q9SCS2|CAMK5_ARATH CDPK-related kinase 5 OS=Arabidopsis thaliana GN=CRK5 PE=2 SV=1 48 311 9.0E-31
sp|Q9LGV5|CIPK1_ORYSJ CBL-interacting protein kinase 1 OS=Oryza sativa subsp. japonica GN=CIPK1 PE=2 SV=1 36 327 1.0E-30
sp|Q00771|KCC1_EMENI Calcium/calmodulin-dependent protein kinase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=cmkA PE=2 SV=2 48 303 1.0E-30
sp|P93759|CDPKE_ARATH Calcium-dependent protein kinase 14 OS=Arabidopsis thaliana GN=CPK14 PE=2 SV=1 48 307 1.0E-30
sp|Q6FKD4|PHO85_CANGA Negative regulator of the PHO system OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=PHO85 PE=3 SV=1 52 302 1.0E-30
sp|P32490|MKK1_YEAST MAP kinase kinase MKK1/SSP32 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MKK1 PE=1 SV=1 54 313 1.0E-30
sp|Q9LQM8|M2K10_ARATH Mitogen-activated protein kinase kinase 10 OS=Arabidopsis thaliana GN=MKK10 PE=1 SV=1 36 301 1.0E-30
sp|Q6P2M8|KCC1B_HUMAN Calcium/calmodulin-dependent protein kinase type 1B OS=Homo sapiens GN=PNCK PE=2 SV=2 48 349 1.0E-30
sp|P34117|CDK5_DICDI Cyclin-dependent kinase 5 homolog OS=Dictyostelium discoideum GN=cdk5 PE=2 SV=2 45 303 1.0E-30
sp|A8X775|DLK1_CAEBR Mitogen-activated protein kinase kinase kinase dlk-1 OS=Caenorhabditis briggsae GN=dlk-1 PE=3 SV=1 52 298 2.0E-30
sp|Q2QAV0|TIO_ARATH Serine/threonine-protein kinase TIO OS=Arabidopsis thaliana GN=TIO PE=1 SV=1 44 301 2.0E-30
sp|O22971|CIPKD_ARATH CBL-interacting serine/threonine-protein kinase 13 OS=Arabidopsis thaliana GN=CIPK13 PE=1 SV=2 19 301 2.0E-30
sp|P92958|KIN11_ARATH SNF1-related protein kinase catalytic subunit alpha KIN11 OS=Arabidopsis thaliana GN=KIN11 PE=1 SV=1 45 301 2.0E-30
sp|O55099|AURKB_RAT Aurora kinase B OS=Rattus norvegicus GN=Aurkb PE=1 SV=1 17 312 2.0E-30
sp|P23647|FUSED_DROME Serine/threonine-protein kinase fused OS=Drosophila melanogaster GN=fu PE=1 SV=2 45 339 2.0E-30
sp|Q9FJ55|CIPKJ_ARATH CBL-interacting serine/threonine-protein kinase 19 OS=Arabidopsis thaliana GN=CIPK19 PE=2 SV=1 32 301 2.0E-30
sp|P70032|PLK1_XENLA Serine/threonine-protein kinase PLK1 OS=Xenopus laevis GN=plk1 PE=1 SV=1 54 296 2.0E-30
sp|Q63699|CDK2_RAT Cyclin-dependent kinase 2 OS=Rattus norvegicus GN=Cdk2 PE=1 SV=1 45 301 3.0E-30
sp|Q54TN4|MKCE_DICDI Probable serine/threonine-protein kinase mkcE OS=Dictyostelium discoideum GN=mkcE PE=3 SV=1 41 309 3.0E-30
sp|P24941|CDK2_HUMAN Cyclin-dependent kinase 2 OS=Homo sapiens GN=CDK2 PE=1 SV=2 45 301 3.0E-30
sp|Q12263|GIN4_YEAST Serine/threonine-protein kinase GIN4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GIN4 PE=1 SV=1 39 298 4.0E-30
sp|O55076|CDK2_CRIGR Cyclin-dependent kinase 2 OS=Cricetulus griseus GN=CDK2 PE=2 SV=1 45 301 4.0E-30
sp|P27466|KCC1_YEAST Calcium/calmodulin-dependent protein kinase I OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CMK1 PE=1 SV=2 46 301 4.0E-30
sp|O80397|M2K4_ARATH Mitogen-activated protein kinase kinase 4 OS=Arabidopsis thaliana GN=MKK4 PE=1 SV=1 51 320 4.0E-30
sp|F4I1N8|ATG1T_ARATH Serine/threonine-protein kinase ATG1t OS=Arabidopsis thaliana GN=At1g49180 PE=2 SV=1 45 246 4.0E-30
sp|O49717|CDPKF_ARATH Calcium-dependent protein kinase 15 OS=Arabidopsis thaliana GN=CPK15 PE=2 SV=1 6 314 4.0E-30
sp|A1A5Q6|SMK_RAT Sperm motility kinase OS=Rattus norvegicus GN=Smok PE=2 SV=1 37 301 5.0E-30
sp|Q38997|KIN10_ARATH SNF1-related protein kinase catalytic subunit alpha KIN10 OS=Arabidopsis thaliana GN=KIN10 PE=1 SV=2 45 301 5.0E-30
sp|Q02111|KPCT_MOUSE Protein kinase C theta type OS=Mus musculus GN=Prkcq PE=1 SV=1 19 297 6.0E-30
sp|P34112|CDK1_DICDI Cyclin-dependent kinase 1 OS=Dictyostelium discoideum GN=cdk1 PE=2 SV=1 42 302 7.0E-30
sp|P50528|PLO1_SCHPO Serine/threonine-protein kinase plo1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=plo1 PE=1 SV=1 48 301 7.0E-30
sp|Q8W1D5|CIPKP_ARATH CBL-interacting serine/threonine-protein kinase 25 OS=Arabidopsis thaliana GN=CIPK25 PE=2 SV=1 28 301 7.0E-30
sp|Q6X4A2|CIPKV_ORYSJ CBL-interacting protein kinase 31 OS=Oryza sativa subsp. japonica GN=CIPK31 PE=1 SV=1 48 301 7.0E-30
sp|O43293|DAPK3_HUMAN Death-associated protein kinase 3 OS=Homo sapiens GN=DAPK3 PE=1 SV=1 48 306 8.0E-30
sp|P25323|MYLKA_DICDI Myosin light chain kinase A OS=Dictyostelium discoideum GN=mlkA PE=1 SV=2 46 301 8.0E-30
sp|Q5UQ78|YR517_MIMIV Putative serine/threonine-protein kinase R517/R518 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R517 PE=3 SV=2 48 339 8.0E-30
sp|P28582|CDPK_DAUCA Calcium-dependent protein kinase OS=Daucus carota PE=2 SV=2 48 314 9.0E-30
sp|Q86I06|NEK3_DICDI Probable serine/threonine-protein kinase nek3 OS=Dictyostelium discoideum GN=nek3 PE=3 SV=1 48 301 9.0E-30
sp|Q9M9V8|CDPKA_ARATH Calcium-dependent protein kinase 10 OS=Arabidopsis thaliana GN=CPK10 PE=1 SV=1 48 307 9.0E-30
sp|Q8VBY2|KKCC1_MOUSE Calcium/calmodulin-dependent protein kinase kinase 1 OS=Mus musculus GN=Camkk1 PE=1 SV=1 45 384 9.0E-30
sp|Q7YRC6|AURKB_BOVIN Aurora kinase B OS=Bos taurus GN=AURKB PE=2 SV=1 45 312 9.0E-30
sp|O01775|NEKL2_CAEEL Serine/threonine-protein kinase nekl-2 OS=Caenorhabditis elegans GN=nekl-2 PE=2 SV=1 45 296 1.0E-29
sp|O08679|MARK2_RAT Serine/threonine-protein kinase MARK2 OS=Rattus norvegicus GN=Mark2 PE=1 SV=1 33 301 1.0E-29
sp|P54666|CC2H3_TRYBB Cell division control protein 2 homolog 3 OS=Trypanosoma brucei brucei GN=CRK3 PE=3 SV=1 44 302 1.0E-29
sp|P23573|CDK2_DROME Cyclin-dependent kinase 2 OS=Drosophila melanogaster GN=Cdk2 PE=1 SV=1 45 301 1.0E-29
sp|Q2QY53|CIPKW_ORYSJ CBL-interacting protein kinase 32 OS=Oryza sativa subsp. japonica GN=CIPK32 PE=2 SV=2 48 361 1.0E-29
sp|Q7XJR9|CDPKG_ARATH Calcium-dependent protein kinase 16 OS=Arabidopsis thaliana GN=CPK16 PE=3 SV=1 48 311 1.0E-29
sp|Q8CEQ0|CDKL1_MOUSE Cyclin-dependent kinase-like 1 OS=Mus musculus GN=Cdkl1 PE=2 SV=1 54 305 1.0E-29
sp|P48963|CDK2_MESAU Cyclin-dependent kinase 2 OS=Mesocricetus auratus GN=CDK2 PE=2 SV=1 45 301 1.0E-29
sp|Q7PLI7|DCLK_DROME Serine/threonine-protein kinase CG17528 OS=Drosophila melanogaster GN=CG17528 PE=1 SV=1 48 313 1.0E-29
sp|Q7KZI7|MARK2_HUMAN Serine/threonine-protein kinase MARK2 OS=Homo sapiens GN=MARK2 PE=1 SV=2 33 301 1.0E-29
sp|Q05512|MARK2_MOUSE Serine/threonine-protein kinase MARK2 OS=Mus musculus GN=Mark2 PE=1 SV=3 33 301 1.0E-29
sp|Q5QN75|M2K1_ORYSJ Mitogen-activated protein kinase kinase 1 OS=Oryza sativa subsp. japonica GN=MKK1 PE=1 SV=1 32 301 2.0E-29
sp|Q2RBF0|CIPKF_ORYSJ CBL-interacting protein kinase 15 OS=Oryza sativa subsp. japonica GN=CIPK15 PE=2 SV=1 45 301 2.0E-29
sp|Q8C0Q4|NEK11_MOUSE Serine/threonine-protein kinase Nek11 OS=Mus musculus GN=Nek11 PE=2 SV=2 46 301 2.0E-29
sp|P23437|CDK2_XENLA Cyclin-dependent kinase 2 OS=Xenopus laevis GN=cdk2 PE=1 SV=3 45 306 2.0E-29
sp|Q2RAX3|CIPKX_ORYSJ CBL-interacting protein kinase 33 OS=Oryza sativa subsp. japonica GN=CIPK33 PE=2 SV=1 48 361 2.0E-29
sp|Q66HE7|CDKL1_RAT Cyclin-dependent kinase-like 1 OS=Rattus norvegicus GN=Cdkl1 PE=2 SV=1 54 305 2.0E-29
sp|Q0V7M1|KPSH1_BOVIN Serine/threonine-protein kinase H1 OS=Bos taurus GN=PSKH1 PE=2 SV=1 9 302 2.0E-29
sp|P62205|PLK1_XENTR Serine/threonine-protein kinase PLK1 OS=Xenopus tropicalis GN=plk1 PE=2 SV=1 54 296 2.0E-29
sp|Q91YA2|KPSH1_MOUSE Serine/threonine-protein kinase H1 OS=Mus musculus GN=Pskh1 PE=2 SV=3 3 302 2.0E-29
sp|Q5JLS2|CIPKC_ORYSJ CBL-interacting protein kinase 12 OS=Oryza sativa subsp. japonica GN=CIPK12 PE=1 SV=1 45 301 2.0E-29
sp|O22932|CIPKB_ARATH CBL-interacting serine/threonine-protein kinase 11 OS=Arabidopsis thaliana GN=CIPK11 PE=1 SV=1 41 356 2.0E-29
sp|Q2QYM3|CIPKE_ORYSJ CBL-interacting protein kinase 14 OS=Oryza sativa subsp. japonica GN=CIPK14 PE=2 SV=1 45 301 2.0E-29
sp|Q9STV4|CIPK8_ARATH CBL-interacting serine/threonine-protein kinase 8 OS=Arabidopsis thaliana GN=CIPK8 PE=1 SV=1 48 301 2.0E-29
sp|Q00372|SNF1_CANGA Carbon catabolite-derepressing protein kinase OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=SNF1 PE=3 SV=2 47 301 3.0E-29
sp|O54784|DAPK3_MOUSE Death-associated protein kinase 3 OS=Mus musculus GN=Dapk3 PE=1 SV=1 48 306 3.0E-29
sp|O88764|DAPK3_RAT Death-associated protein kinase 3 OS=Rattus norvegicus GN=Dapk3 PE=1 SV=1 48 306 3.0E-29
sp|Q3TZA2|CDKL4_MOUSE Cyclin-dependent kinase-like 4 OS=Mus musculus GN=Cdkl4 PE=2 SV=1 54 301 4.0E-29
sp|Q8INB9|AKT1_DROME RAC serine/threonine-protein kinase OS=Drosophila melanogaster GN=Akt1 PE=1 SV=3 37 371 4.0E-29
sp|Q9LP51|CIPKI_ARATH CBL-interacting serine/threonine-protein kinase 18 OS=Arabidopsis thaliana GN=CIPK18 PE=1 SV=1 48 301 4.0E-29
sp|Q5Z6X0|CIPKP_ORYSJ CBL-interacting protein kinase 25 OS=Oryza sativa subsp. japonica GN=CIPK25 PE=2 SV=1 48 301 4.0E-29
sp|Q04759|KPCT_HUMAN Protein kinase C theta type OS=Homo sapiens GN=PRKCQ PE=1 SV=3 45 297 4.0E-29
sp|P27448|MARK3_HUMAN MAP/microtubule affinity-regulating kinase 3 OS=Homo sapiens GN=MARK3 PE=1 SV=4 37 301 4.0E-29
sp|Q08942|NRKA_TRYBB Putative serine/threonine-protein kinase A OS=Trypanosoma brucei brucei GN=NRKA PE=2 SV=1 54 325 4.0E-29
sp|Q9LPQ3|M2K7_ARATH Mitogen-activated protein kinase kinase 7 OS=Arabidopsis thaliana GN=MKK7 PE=1 SV=1 54 301 4.0E-29
sp|Q20845|PLK3_CAEEL Serine/threonine-protein kinase plk-3 OS=Caenorhabditis elegans GN=plk-3 PE=2 SV=1 48 296 4.0E-29
sp|Q9NAH6|KS6B_CAEEL Ribosomal protein S6 kinase beta OS=Caenorhabditis elegans GN=rsks-1 PE=1 SV=2 3 360 4.0E-29
sp|Q26671|CDC2H_THEAN Cell division control protein 2 homolog OS=Theileria annulata GN=CRK2 PE=2 SV=1 45 306 4.0E-29
sp|O80396|M2K3_ARATH Mitogen-activated protein kinase kinase 3 OS=Arabidopsis thaliana GN=MKK3 PE=1 SV=1 27 332 4.0E-29
sp|Q6ERS4|CIPKG_ORYSJ CBL-interacting protein kinase 16 OS=Oryza sativa subsp. japonica GN=CIPK16 PE=2 SV=1 29 301 5.0E-29
sp|P22517|KCC2_YEAST Calcium/calmodulin-dependent protein kinase II OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CMK2 PE=1 SV=2 47 309 5.0E-29
sp|P00531|MIL_AVIMH Serine/threonine-protein kinase-transforming protein mil OS=Avian retrovirus MH2 GN=V-MIL PE=3 SV=1 13 310 6.0E-29
sp|Q66L42|M3K10_MOUSE Mitogen-activated protein kinase kinase kinase 10 OS=Mus musculus GN=Map3k10 PE=1 SV=2 41 298 6.0E-29
sp|P52497|SNF1_CANAX Carbon catabolite-derepressing protein kinase OS=Candida albicans GN=SNF1 PE=2 SV=2 48 301 6.0E-29
sp|Q6ZLP5|CIPKN_ORYSJ CBL-interacting protein kinase 23 OS=Oryza sativa subsp. japonica GN=CIPK23 PE=2 SV=1 48 301 7.0E-29
sp|Q9N0X0|AURKB_PIG Aurora kinase B OS=Sus scrofa GN=AURKB PE=2 SV=2 45 312 8.0E-29
sp|Q501V0|KPSH1_DANRE Serine/threonine-protein kinase H1 homolog OS=Danio rerio GN=pskh1 PE=2 SV=2 48 302 8.0E-29
sp|P97756|KKCC1_RAT Calcium/calmodulin-dependent protein kinase kinase 1 OS=Rattus norvegicus GN=Camkk1 PE=1 SV=1 45 384 8.0E-29
sp|O14408|KCC1_METAN Calcium/calmodulin-dependent protein kinase OS=Metarhizium anisopliae PE=2 SV=1 48 303 8.0E-29
sp|O96017|CHK2_HUMAN Serine/threonine-protein kinase Chk2 OS=Homo sapiens GN=CHEK2 PE=1 SV=1 39 301 8.0E-29
sp|Q54XJ4|Y8901_DICDI Probable serine/threonine-protein kinase DDB_G0278901 OS=Dictyostelium discoideum GN=DDB_G0278901 PE=3 SV=1 698 937 3.0E-22
sp|Q9LJD8|M3KE1_ARATH MAP3K epsilon protein kinase 1 OS=Arabidopsis thaliana GN=M3KE1 PE=1 SV=1 951 1101 5.0E-20
sp|A0A078CGE6|M3KE1_BRANA MAP3K epsilon protein kinase 1 OS=Brassica napus GN=M3KE1 PE=1 SV=1 951 1101 7.0E-20
sp|Q9SFB6|M3KE2_ARATH MAP3K epsilon protein kinase 2 OS=Arabidopsis thaliana GN=MAP3KE2 PE=2 SV=1 951 1101 8.0E-20
sp|Q54XJ4|Y8901_DICDI Probable serine/threonine-protein kinase DDB_G0278901 OS=Dictyostelium discoideum GN=DDB_G0278901 PE=3 SV=1 940 1093 8.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0005524 ATP binding Yes
GO:0004672 protein kinase activity Yes
GO:0006468 protein phosphorylation Yes
GO:0044238 primary metabolic process No
GO:0016773 phosphotransferase activity, alcohol group as acceptor No
GO:0032559 adenyl ribonucleotide binding No
GO:0097159 organic cyclic compound binding No
GO:0006793 phosphorus metabolic process No
GO:0071704 organic substance metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0005488 binding No
GO:1901265 nucleoside phosphate binding No
GO:0044267 cellular protein metabolic process No
GO:0044237 cellular metabolic process No
GO:0008152 metabolic process No
GO:0008150 biological_process No
GO:0036094 small molecule binding No
GO:0016301 kinase activity No
GO:0044260 cellular macromolecule metabolic process No
GO:0008144 drug binding No
GO:0036211 protein modification process No
GO:0016740 transferase activity No
GO:0003674 molecular_function No
GO:0016772 transferase activity, transferring phosphorus-containing groups No
GO:0003824 catalytic activity No
GO:0016310 phosphorylation No
GO:0009987 cellular process No
GO:1901564 organonitrogen compound metabolic process No
GO:0006464 cellular protein modification process No
GO:1901363 heterocyclic compound binding No
GO:0000166 nucleotide binding No
GO:0043167 ion binding No
GO:0043168 anion binding No
GO:0097367 carbohydrate derivative binding No
GO:0043170 macromolecule metabolic process No
GO:0032555 purine ribonucleotide binding No
GO:0019538 protein metabolic process No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0032553 ribonucleotide binding No
GO:0030554 adenyl nucleotide binding No
GO:0140096 catalytic activity, acting on a protein No
GO:0006796 phosphate-containing compound metabolic process No
GO:0043412 macromolecule modification No
GO:0017076 purine nucleotide binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 44 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|9080
MPPERHYHANNGPSVPSRDRSSVVPGTPSRKERQRESSAVQDPGLKDYRLGECLGKGAFGSVYKAFNWSTGEAVA
VKQIKLADLPKSELRMIESEIDLLKNLLHDNIVKYIGFVKSVDCLNIILEYCENGSLHSILKAYGKFPENLVGVY
MTQVLQGLQYLHDQGVIHRDIKGANILTTKDGTVKLADFGVSTSTLAGGQDKEAQVVGTPYWMAPEIIQLSGASS
ASDIWSVGCTVIELLQGKPPYHNLAAMPALFAIVNDDHPPLPEGISAAARDFLMQCFQKDPNLRVSARKLLRHAW
IAGSRRAEAPVAKAPANFNQAVEEVKQWNKALNSSDSALRTSFGSDPSGPSSRFTSGTPAKGPLTLVKPRPGAEA
FRSPELTGTSSVRGPGGRASILSPPRAGVRRGLSMPGLEADPPAPDDDNWDDDFATTISLSALQLPHLKPQDNFG
GLLSSERLKAFASSTDGRNDTYSYDDDFEGELLTIKGPSSRPRDFDSQEHTIRPISKKTVAKATDSPRTQHRAKS
SYGSLAPAASSSTGSAGSGASCAPRSPSKSQLASKFGMPRRLDASYREHSIEDYSDLFVDNDGVFDHRVSQAVKR
GVRAADAPQLFHPSDLTSLPRSMQAPEGSIRKKKAQLRPSVLPDRPMRRTRSSIEIQKFAEDDDEDFSDVFGATD
SLGGEREESERGSEDGGLMLLSKMSNNSWLGDEEDEYDPFATMDPGWDEMDLEANIARDRHARLAERVEALVGSL
KTTEGEDMLSELSEDLLALLWENKEVKNLVISAHGLLPILEILEPCTVKSRQYMILQLLKVVNAIILDDVEIQEN
LCFVGGIPIITKFAARQYSNEIRLEAAAFVRQMYQTSTLTLQMFVSAGGLNVLVKFLDEDYDSARDLVLIGVNGI
WNVFELQGPTPKNDFCRIFSRSKILYPLALVLHRVLDEEGEDELDELIEGRIVNIFYLFSQAENYVKEVVADRQV
LKSVLKDLRRMTPMHQITMLKFIKNLSMLSTTIESLHSADAIDFLIDLLGYGLKRGQRHFREISNQVLNTLFNLC
RLSKERQEDAAVGGIIPLLLRIMKTDRPPKEFALPILCDMAHSGSKGRRYL*
Coding >Hirsu2|9080
ATGCCCCCCGAGCGCCACTACCACGCCAACAATGGCCCATCCGTGCCTTCGCGAGATAGGTCCTCCGTCGTACCG
GGCACCCCCTCCCGCAAGGAGAGGCAGCGCGAGAGCTCAGCCGTTCAAGATCCCGGGCTCAAGGACTATCGCTTG
GGCGAGTGTCTCGGCAAGGGCGCCTTCGGCTCTGTCTACAAGGCCTTCAACTGGAGCACCGGCGAGGCCGTGGCC
GTCAAGCAAATCAAGCTGGCCGACCTCCCCAAGAGCGAGCTGCGCATGATCGAGAGTGAAATCGACCTGCTCAAA
AATCTCTTGCACGACAATATTGTCAAGTACATCGGCTTTGTCAAGTCGGTAGACTGCCTCAACATCATCCTCGAG
TACTGCGAGAACGGCTCCCTGCATTCGATACTCAAGGCCTACGGCAAGTTCCCTGAGAACCTCGTCGGCGTTTAC
ATGACCCAGGTCCTGCAGGGGCTGCAGTATCTCCACGACCAGGGCGTCATCCACCGCGACATCAAGGGCGCCAAC
ATCCTCACCACCAAGGATGGCACCGTCAAGCTCGCCGACTTTGGCGTCTCCACCAGCACTCTGGCCGGCGGCCAG
GACAAGGAGGCCCAGGTCGTCGGCACCCCCTACTGGATGGCGCCCGAGATCATCCAGCTCTCCGGAGCCAGCTCC
GCCTCCGACATCTGGAGCGTCGGCTGCACCGTCATCGAGCTTCTGCAGGGCAAGCCGCCCTACCACAACCTGGCC
GCCATGCCCGCCCTCTTCGCCATCGTCAACGACGACCACCCTCCCCTGCCCGAAGGCATCTCCGCGGCCGCCCGG
GATTTTCTCATGCAGTGCTTCCAGAAGGACCCCAACCTGAGGGTCAGCGCGCGGAAGCTGCTGCGGCACGCCTGG
ATCGCCGGCTCCCGCCGAGCCGAGGCCCCCGTCGCCAAGGCGCCGGCCAACTTCAATCAGGCCGTCGAGGAGGTC
AAGCAGTGGAACAAGGCGCTCAACTCGTCCGACTCGGCCCTGCGCACGTCCTTCGGCTCCGACCCCTCGGGACCC
TCATCTCGCTTCACCAGCGGCACCCCGGCCAAGGGGCCCCTCACCCTGGTCAAGCCGAGGCCGGGCGCCGAGGCC
TTCAGGTCGCCTGAACTCACCGGTACGTCGTCGGTTCGCGGGCCCGGTGGACGGGCCTCCATCCTCTCCCCGCCC
CGCGCCGGCGTGCGCCGCGGGCTCAGCATGCCCGGGCTCGAGGCTGACCCTCCGGCGCCAGATGATGACAACTGG
GACGACGACTTTGCGACGACCATCTCGCTGAGCGCGCTGCAGCTGCCGCACCTCAAGCCCCAGGACAACTTTGGC
GGCCTCCTGTCGAGCGAGAGGCTCAAGGCGTTTGCCTCGTCGACGGACGGGCGGAACGACACGTACAGCTACGAC
GACGACTTCGAGGGAGAGCTTCTGACCATTAAAGGCCCCAGCAGCCGCCCTCGAGACTTTGATTCCCAGGAACAC
ACCATCCGCCCCATCTCCAAGAAGACGGTGGCCAAGGCGACCGACAGCCCGAGAACCCAGCACCGTGCCAAGTCG
AGCTATGGGAGCCTGGCGCCCGCCGCCTCGTCCTCGACCGGCAGCGCCGGCAGCGGCGCGTCGTGCGCGCCGAGG
TCTCCGTCCAAGTCGCAGCTCGCCAGCAAGTTCGGGATGCCGCGGCGGCTGGACGCGTCGTACCGCGAGCACAGC
ATCGAGGACTACTCGGACCTTTTCGTCGACAACGACGGCGTCTTCGACCACCGAGTCAGCCAAGCCGTCAAACGG
GGCGTCCGGGCCGCCGACGCTCCGCAGCTCTTCCACCCGTCCGACCTCACCAGCCTGCCCAGGTCCATGCAGGCC
CCCGAGGGCAGCATCAGGAAGAAGAAAGCGCAGCTGCGGCCGTCGGTGCTGCCGGACCGCCCCATGCGGCGCACC
CGCTCGTCCATCGAGATCCAAAAGTTCGCCGAGGACGACGACGAGGACTTCTCCGACGTCTTCGGCGCCACCGAC
TCCCTCGGCGGCGAGAGGGAGGAGAGCGAGCGCGGCTCCGAGGACGGCGGGCTCATGCTCCTGTCCAAGATGTCC
AACAACTCGTGGCTGGGGGACGAGGAGGACGAATATGACCCGTTCGCCACGATGGACCCCGGCTGGGACGAGATG
GACCTGGAGGCCAACATCGCCAGGGACAGGCACGCCCGGCTGGCGGAGCGCGTCGAGGCCCTCGTGGGGTCGCTG
AAGACGACGGAGGGCGAGGACATGCTCTCCGAGCTGTCGGAAGACCTGCTCGCCCTGCTCTGGGAGAACAAGGAG
GTCAAGAATCTCGTCATCAGTGCGCACGGCCTGCTGCCCATCCTCGAGATACTGGAGCCGTGCACGGTCAAGAGC
AGGCAATACATGATACTGCAGCTCCTGAAGGTGGTCAACGCCATCATCCTCGACGACGTCGAGATCCAGGAGAAC
CTATGCTTCGTGGGCGGGATCCCGATCATCACCAAGTTCGCGGCCCGGCAGTACTCCAACGAGATACGGCTGGAG
GCGGCGGCGTTCGTGCGGCAAATGTACCAGACGTCGACGCTGACGCTGCAGATGTTCGTTTCTGCCGGCGGGCTG
AACGTGCTGGTCAAGTTCCTGGACGAGGACTACGACAGCGCGCGGGACCTGGTGCTCATCGGCGTCAACGGCATC
TGGAACGTGTTCGAGCTGCAGGGCCCGACGCCCAAGAACGACTTCTGCCGCATCTTCTCGCGCAGCAAGATCCTG
TACCCGCTGGCGCTGGTGCTGCATCGGGTGCTGGACGAGGAGGGCGAGGACGAGCTGGACGAGCTGATCGAGGGC
CGCATCGTCAACATCTTCTACCTCTTCAGCCAGGCGGAGAACTACGTCAAGGAGGTGGTGGCGGACCGACAGGTG
CTGAAGAGCGTGCTCAAGGACCTGCGGCGGATGACGCCGATGCACCAGATCACGATGCTCAAGTTCATCAAGAAC
CTGTCGATGCTGTCGACGACGATCGAGTCGCTCCACTCGGCCGACGCCATCGACTTCCTCATCGACCTGCTCGGC
TACGGCCTCAAGAGGGGCCAGCGGCACTTCCGCGAGATCTCGAACCAGGTCCTCAACACCCTCTTCAACCTGTGC
CGGCTGAGCAAGGAGAGGCAGGAGGACGCGGCGGTGGGGGGCATCATCCCGCTGCTGCTGCGCATCATGAAGACG
GACCGGCCGCCCAAGGAGTTCGCGCTGCCGATCCTGTGCGACATGGCGCACTCGGGCTCCAAGGGGCGGCGCTAC
CTGTGA
Transcript >Hirsu2|9080
ATGCCCCCCGAGCGCCACTACCACGCCAACAATGGCCCATCCGTGCCTTCGCGAGATAGGTCCTCCGTCGTACCG
GGCACCCCCTCCCGCAAGGAGAGGCAGCGCGAGAGCTCAGCCGTTCAAGATCCCGGGCTCAAGGACTATCGCTTG
GGCGAGTGTCTCGGCAAGGGCGCCTTCGGCTCTGTCTACAAGGCCTTCAACTGGAGCACCGGCGAGGCCGTGGCC
GTCAAGCAAATCAAGCTGGCCGACCTCCCCAAGAGCGAGCTGCGCATGATCGAGAGTGAAATCGACCTGCTCAAA
AATCTCTTGCACGACAATATTGTCAAGTACATCGGCTTTGTCAAGTCGGTAGACTGCCTCAACATCATCCTCGAG
TACTGCGAGAACGGCTCCCTGCATTCGATACTCAAGGCCTACGGCAAGTTCCCTGAGAACCTCGTCGGCGTTTAC
ATGACCCAGGTCCTGCAGGGGCTGCAGTATCTCCACGACCAGGGCGTCATCCACCGCGACATCAAGGGCGCCAAC
ATCCTCACCACCAAGGATGGCACCGTCAAGCTCGCCGACTTTGGCGTCTCCACCAGCACTCTGGCCGGCGGCCAG
GACAAGGAGGCCCAGGTCGTCGGCACCCCCTACTGGATGGCGCCCGAGATCATCCAGCTCTCCGGAGCCAGCTCC
GCCTCCGACATCTGGAGCGTCGGCTGCACCGTCATCGAGCTTCTGCAGGGCAAGCCGCCCTACCACAACCTGGCC
GCCATGCCCGCCCTCTTCGCCATCGTCAACGACGACCACCCTCCCCTGCCCGAAGGCATCTCCGCGGCCGCCCGG
GATTTTCTCATGCAGTGCTTCCAGAAGGACCCCAACCTGAGGGTCAGCGCGCGGAAGCTGCTGCGGCACGCCTGG
ATCGCCGGCTCCCGCCGAGCCGAGGCCCCCGTCGCCAAGGCGCCGGCCAACTTCAATCAGGCCGTCGAGGAGGTC
AAGCAGTGGAACAAGGCGCTCAACTCGTCCGACTCGGCCCTGCGCACGTCCTTCGGCTCCGACCCCTCGGGACCC
TCATCTCGCTTCACCAGCGGCACCCCGGCCAAGGGGCCCCTCACCCTGGTCAAGCCGAGGCCGGGCGCCGAGGCC
TTCAGGTCGCCTGAACTCACCGGTACGTCGTCGGTTCGCGGGCCCGGTGGACGGGCCTCCATCCTCTCCCCGCCC
CGCGCCGGCGTGCGCCGCGGGCTCAGCATGCCCGGGCTCGAGGCTGACCCTCCGGCGCCAGATGATGACAACTGG
GACGACGACTTTGCGACGACCATCTCGCTGAGCGCGCTGCAGCTGCCGCACCTCAAGCCCCAGGACAACTTTGGC
GGCCTCCTGTCGAGCGAGAGGCTCAAGGCGTTTGCCTCGTCGACGGACGGGCGGAACGACACGTACAGCTACGAC
GACGACTTCGAGGGAGAGCTTCTGACCATTAAAGGCCCCAGCAGCCGCCCTCGAGACTTTGATTCCCAGGAACAC
ACCATCCGCCCCATCTCCAAGAAGACGGTGGCCAAGGCGACCGACAGCCCGAGAACCCAGCACCGTGCCAAGTCG
AGCTATGGGAGCCTGGCGCCCGCCGCCTCGTCCTCGACCGGCAGCGCCGGCAGCGGCGCGTCGTGCGCGCCGAGG
TCTCCGTCCAAGTCGCAGCTCGCCAGCAAGTTCGGGATGCCGCGGCGGCTGGACGCGTCGTACCGCGAGCACAGC
ATCGAGGACTACTCGGACCTTTTCGTCGACAACGACGGCGTCTTCGACCACCGAGTCAGCCAAGCCGTCAAACGG
GGCGTCCGGGCCGCCGACGCTCCGCAGCTCTTCCACCCGTCCGACCTCACCAGCCTGCCCAGGTCCATGCAGGCC
CCCGAGGGCAGCATCAGGAAGAAGAAAGCGCAGCTGCGGCCGTCGGTGCTGCCGGACCGCCCCATGCGGCGCACC
CGCTCGTCCATCGAGATCCAAAAGTTCGCCGAGGACGACGACGAGGACTTCTCCGACGTCTTCGGCGCCACCGAC
TCCCTCGGCGGCGAGAGGGAGGAGAGCGAGCGCGGCTCCGAGGACGGCGGGCTCATGCTCCTGTCCAAGATGTCC
AACAACTCGTGGCTGGGGGACGAGGAGGACGAATATGACCCGTTCGCCACGATGGACCCCGGCTGGGACGAGATG
GACCTGGAGGCCAACATCGCCAGGGACAGGCACGCCCGGCTGGCGGAGCGCGTCGAGGCCCTCGTGGGGTCGCTG
AAGACGACGGAGGGCGAGGACATGCTCTCCGAGCTGTCGGAAGACCTGCTCGCCCTGCTCTGGGAGAACAAGGAG
GTCAAGAATCTCGTCATCAGTGCGCACGGCCTGCTGCCCATCCTCGAGATACTGGAGCCGTGCACGGTCAAGAGC
AGGCAATACATGATACTGCAGCTCCTGAAGGTGGTCAACGCCATCATCCTCGACGACGTCGAGATCCAGGAGAAC
CTATGCTTCGTGGGCGGGATCCCGATCATCACCAAGTTCGCGGCCCGGCAGTACTCCAACGAGATACGGCTGGAG
GCGGCGGCGTTCGTGCGGCAAATGTACCAGACGTCGACGCTGACGCTGCAGATGTTCGTTTCTGCCGGCGGGCTG
AACGTGCTGGTCAAGTTCCTGGACGAGGACTACGACAGCGCGCGGGACCTGGTGCTCATCGGCGTCAACGGCATC
TGGAACGTGTTCGAGCTGCAGGGCCCGACGCCCAAGAACGACTTCTGCCGCATCTTCTCGCGCAGCAAGATCCTG
TACCCGCTGGCGCTGGTGCTGCATCGGGTGCTGGACGAGGAGGGCGAGGACGAGCTGGACGAGCTGATCGAGGGC
CGCATCGTCAACATCTTCTACCTCTTCAGCCAGGCGGAGAACTACGTCAAGGAGGTGGTGGCGGACCGACAGGTG
CTGAAGAGCGTGCTCAAGGACCTGCGGCGGATGACGCCGATGCACCAGATCACGATGCTCAAGTTCATCAAGAAC
CTGTCGATGCTGTCGACGACGATCGAGTCGCTCCACTCGGCCGACGCCATCGACTTCCTCATCGACCTGCTCGGC
TACGGCCTCAAGAGGGGCCAGCGGCACTTCCGCGAGATCTCGAACCAGGTCCTCAACACCCTCTTCAACCTGTGC
CGGCTGAGCAAGGAGAGGCAGGAGGACGCGGCGGTGGGGGGCATCATCCCGCTGCTGCTGCGCATCATGAAGACG
GACCGGCCGCCCAAGGAGTTCGCGCTGCCGATCCTGTGCGACATGGCGCACTCGGGCTCCAAGGGGCGGCGCTAC
CTGTGA
Gene >Hirsu2|9080
ATGCCCCCCGAGCGCCACTACCACGCCAACAATGGCCCATCCGTGCCTTCGCGAGATAGGTCCTCCGTCGTACCG
GGCACCCCCTCCCGCAAGGAGAGGCAGCGCGAGAGCTCAGCCGTTCAAGATCCCGGGCTCAAGGACTATGTGCGT
CGTCCGCCCTCCTCCGACACTTCCCAATTTTTGTTTTTCTTTTCCTTTTTTTTTCCGGGCTGTGCACCCACAACC
CCCCCTCTGTCCGTGAGGGGTTCGGGGAGATCACGAGGAACGAGTGCTGACCGTGTCGTCGGAATGGCAGCGCTT
GGGCGAGTGTCTCGGCAAGGGCGCCTTCGGCTCTGTCTACAAGGCCTTCAACTGGAGCACCGGCGAGGCCGTGGC
CGTCAAGCAAATCAAGCTGGCCGACCTCCCCAAGAGCGAGCTGCGCATGATCGAGGTGAGCCTCAGGCCGCCGCG
GCACCTGGGAGGCGACTGACAGCCCCCCCCCTCCCGACAGAGTGAAATCGACCTGCTCAAAAATCTCTTGGTAAG
AATCCCTCATGGCAAGGGGGAGACGTTGCGCGGCCGCCATCCTCGGCCCCGCTGACTCCAAGGCGGCCAGCACGA
CAATATTGTCAAGTACATCGGCTTTGTCAAGTCGGTAGACTGCCTCAACATCATCCTCGAGTATGCCGCTTGCCC
GCCCGACAACCAGGCCGGGCCATGGCTGACGTTGCTGCAGGTACTGCGAGAACGGCTCCCTGCATTCGATACTCA
AGGCCTACGGCAAGTTCCCTGAGAACCTCGTCGGCGTTTACATGACCCAGGTCCTGCAGGGGCTGCAGTATCTCC
ACGACCAGGGCGTCATCCACCGCGACATCAAGGGCGCCAACATCCTCACCACCAAGGATGGCACCGTCAAGCTCG
CCGACTTTGGCGTCTCCACCAGCACTCTGGCCGGCGGCCAGGACAAGGAGGCCCAGGTCGTCGGCACCCCCTACT
GGATGGCGCCCGAGATCATCCAGCTCTCCGGAGCCAGCTCCGCCTCCGACATCTGGAGCGTCGGCTGCACCGTCA
TCGAGCTTCTGCAGGGCAAGCCGCCCTACCACAACCTGGCCGCCATGCCCGCCCTCTTCGCCATCGTCAACGACG
ACCACCCTCCCCTGCCCGAAGGCATCTCCGCGGTACGCACCCGTCCCCCCCGAAGACTCTGACGGCAACGCCCCC
GGACTGACTGGGCGCGCATACGCAGGCCGCCCGGGATTTTCTCATGCAGTGCTTCCAGAAGGACCCCAACCTGAG
GGTCAGCGCGCGGAAGCTGCTGCGGCACGCCTGGATCGCCGGCTCCCGCCGAGCCGAGGCCCCCGTCGCCAAGGC
GCCGGCCAACTTCAATCAGGCCGTCGAGGAGGTCAAGCAGTGGAACAAGGCGCTCAACTCGTCCGACTCGGCCCT
GCGCACGTCCTTCGGCTCCGACCCCTCGGGACCCTCATCTCGCTTCACCAGCGGCACCCCGGCCAAGGGGCCCCT
CACCCTGGTCAAGCCGAGGCCGGGCGCCGAGGCCTTCAGGTCGCCTGAACTCACCGGTACGTCGTCGGTTCGCGG
GCCCGGTGGACGGGCCTCCATCCTCTCCCCGCCCCGCGCCGGCGTGCGCCGCGGGCTCAGCATGCCCGGGCTCGA
GGCTGACCCTCCGGCGCCAGATGATGACAACTGGGACGACGACTTTGCGACGACCATCTCGCTGAGCGCGCTGCA
GCTGCCGCACCTCAAGCCCCAGGACAACTTTGGCGGCCTCCTGTCGAGCGAGAGGCTCAAGGCGTTTGCCTCGTC
GACGGACGGGCGGAACGACACGTACAGCTACGACGACGACTTCGAGGGAGAGCTTCTGACCATTAAAGGCCCCAG
CAGCCGCCCTCGAGACTTTGATTCCCAGGAACACACCATCCGCCCCATCTCCAAGAAGACGGTGGCCAAGGCGAC
CGACAGCCCGAGAACCCAGCACCGTGCCAAGTCGAGCTATGGGAGCCTGGCGCCCGCCGCCTCGTCCTCGACCGG
CAGCGCCGGCAGCGGCGCGTCGTGCGCGCCGAGGTCTCCGTCCAAGTCGCAGCTCGCCAGCAAGTTCGGGATGCC
GCGGCGGCTGGACGCGTCGTACCGCGAGCACAGCATCGAGGACTACTCGGACCTTTTCGTCGACAACGACGGCGT
CTTCGACCACCGAGTCAGCCAAGCCGTCAAACGGGTACGTTGCGCACAGGCGGGCACGCGCGACACGTTCATCTC
CTTGCTGACCGGCCGCGCACAGGGCGTCCGGGCCGCCGACGCTCCGCAGCTCTTCCACCCGTCCGACCTCACCAG
CCTGCCCAGGTCCATGCAGGCCCCCGAGGGCAGCATCAGGAAGAAGAAAGCGCAGCTGCGGCCGTCGGTGCTGCC
GGACCGCCCCATGCGGCGCACCCGCTCGTCCATCGAGATCCAAAAGTTCGCCGAGGACGACGACGAGGACTTCTC
CGACGTCTTCGGCGCCACCGACTCCCTCGGCGGCGAGAGGGAGGAGAGCGAGCGCGGCTCCGAGGACGGCGGGCT
CATGCTCCTGTCCAAGATGTCCAACAACTCGTGGCTGGGGGACGAGGAGGACGAATATGACCCGTTCGCCACGAT
GGACCCCGGCTGGGACGAGATGGACCTGGAGGCCAACATCGCCAGGGACAGGCACGCCCGGCTGGCGGAGCGCGT
CGAGGCCCTCGTGGGGTCGCTGAAGACGACGGAGGGCGAGGACATGCTCTCCGAGCTGTCGGAAGACCTGGTGAG
TGGGCGCCCCGCCGCCCGAAGACTCGACGACGACCCGCCCGTTGACACGCCGTTCCCAGCTCGCCCTGCTCTGGG
AGAACAAGGAGGTCAAGAATCTCGTCATCAGTGCGCACGGCCTGCTGCCCATCCTCGAGATACTGGAGCCGTGCA
CGGTCAAGAGCAGGCAATACATGATACTGCAGCTCCTGAAGGTGGTCAACGCCGTAAGTGCCGCCGCCGCTCTCC
CACCAGCCCCTTGCCCCCCCCTGCCCCCCTGCCCCTCGGCCCCAAAAGCTCTCCGCTCACCGCTCACCACGCGCG
CCACAGATCATCCTCGACGACGTCGAGATCCAGGAGAACCTATGCTTCGTGGGCGGGATCCCGATCATCACCAAG
TTCGCGGCCCGGCAGTACTCCAACGAGATACGGCTGGAGGCGGCGGCGTTCGTGCGGCAAATGTACCAGACGTCG
ACGCTGACGCTGCAGATGTTCGTTTCTGCCGGCGGGCTGAACGTGCTGGTCAAGTTCCTGGACGAGGACTACGAC
AGCGCGCGGGACCTGGTGCTCATCGGCGTCAACGGCATCTGGAACGTGTTCGAGCTGCAGGGCCCGACGCCCAAG
AACGACTTCTGCCGCATCTTCTCGCGCAGCAAGATCCTGTACCCGCTGGCGCTGGTGCTGCATCGGGTGCTGGAC
GAGGAGGGCGAGGACGAGCTGGACGAGCTGATCGAGGGCCGCATCGTCAACATCTTCTACCTCTTCAGCCAGGCG
GAGAACTACGTCAAGGAGGTGGTGGCGGACCGACAGGTGCTGAAGAGCGTGCTCAAGGACCTGCGGCGGATGACG
CCGATGCACCAGATCACGATGCTCAAGTTCATCAAGAACCTGTCGATGCTGTCGACGACGATCGAGTCGCTCCAC
TCGGCCGACGCCATCGACTTCCTCATCGACCTGCTCGGCTACGGCCTCAAGAGGGGCCAGCGGCACTTCCGCGAG
ATCTCGAACCAGGTCCTCAACACCCTCTTCAACCTGTGCCGGCTGAGCAAGGAGAGGCAGGAGGACGCGGCGGTG
GGGGGCATCATCCCGCTGCTGCTGCGCATCATGAAGACGGACCGGCCGCCCAAGGAGTTCGCGCTGCCGATCCTG
TGCGACATGGCGCACTCGGGCTCCAAGGGGCGGCGCTACCTGTGGCAGAACAAGGGCCTCGACTTCTACGTGTCG
CTGCTGACGGACCAGTACTGGCAGGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail