Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|9074
Gene name
LocationContig_635:11188..13792
Strand+
Gene length (bp)2604
Transcript length (bp)2604
Coding sequence length (bp)2604
Protein length (aa) 868

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00884 Sulfatase Sulfatase 5.3E-23 444 729
PF01663 Phosphodiest Type I phosphodiesterase / nucleotide pyrophosphatase 4.2E-07 586 678

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|O32206|YVGJ_BACSU Lipoteichoic acid synthase-like YvgJ OS=Bacillus subtilis (strain 168) GN=yvgJ PE=3 SV=1 587 729 3.0E-06
sp|P54496|YQGS_BACSU Lipoteichoic acid synthase-like YqgS OS=Bacillus subtilis (strain 168) GN=yqgS PE=3 SV=2 568 729 8.0E-06

GO

GO Term Description Terminal node
GO:0008484 sulfuric ester hydrolase activity Yes
GO:0003824 catalytic activity Yes
GO:0016788 hydrolase activity, acting on ester bonds No
GO:0003674 molecular_function No
GO:0016787 hydrolase activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 17 0.5

Transmembrane Domains

Domain # Start End Length
1 36 58 22
2 68 90 22
3 103 125 22
4 148 170 22
5 175 192 17

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|9074
MNSSPSRRPRAASPAPAISSASSLLARLFNRRLFLAVRFAFAFAAASILGAKVVHVYAHLDALAASDVVAYGISF
FAQDVFLLLSLRLLLDSLSHLTLRSVRLFVAALVSLVILASFFFASISISFFLVTGTELHWRNAGVAGGSGSFGM
LLTGLFSLGVVTAAILVVAWLAQDLCYIVSAAALVVARWPFAFVLSRIPCRRWRISSPKLTYQHVPQQDDVEGRK
SRREDDDDDDGACEKLVPEQPPQSKWSFGLHLSVAFVWTALILTSLFRPNDSSLVFMSWTVPLMPLVDLMHSSPS
LVDLVPSYGSDVNSDLQNRTALADPPHWPWLPAGEPLPGFEDWYENKEHYRASEDPLHISNLDFGVLADIRNKLA
DVKIRHVMLIKLESTRKDVFPIKKGGLIWERLLGNQPKQNTTPSVAATQRFSTLTPVANLLTGDFDDGFPHADRK
PRGGINANNVHTTSTYTLKSLAGTLCGLYPLVADFNVEQSHHVYQPCLPHIFNAFNRLQAHKEGEEQGDDFTTFK
WKSMFMQSVTQGYDKQDAEMPVLGFPPENFVSKESLLSGEGKFGKVNMTDINYYGMPEVAIQEYLRDAFASAKKN
KERLFLSHLTSTTHHPFGMPETEEYIPLTSDKKLNDLSHYANAVGYVDRWIGHILKMLEEEGAADETLLVLVGDH
GLSLPETGAVTPYYGGNVGNFHVPLVLSHPKLPHVDVDDAVVSLQILPTILDLLIESGSLAKPAKRAALDMLHNY
EGQSLIRPQSKASRETGDTNWLFTVMNPGRATVAVRDAHRQDWRIIVPVIDDVEWRFTDTGRDPHEEEPTVAFSF
KGLLDKVEAKYGVDAAKWAEAAAIKARWWVKENNKRWRYQAS*
Coding >Hirsu2|9074
ATGAATTCTAGCCCGAGTCGACGCCCTCGGGCCGCCTCGCCTGCGCCCGCCATCTCGTCCGCTTCCTCCCTCCTT
GCCCGCTTGTTCAACAGGAGGCTCTTTCTCGCCGTCCGCTTCGCTTTCGCCTTCGCCGCCGCCTCCATCCTCGGC
GCCAAGGTCGTCCACGTCTACGCCCACCTCGACGCCCTGGCCGCCTCCGACGTCGTCGCCTACGGCATCTCCTTC
TTCGCCCAGGATGTCTTCCTCCTCCTCTCCCTGCGCCTGCTACTTGACAGCCTTTCCCACCTGACGCTGCGCAGC
GTCCGCCTCTTCGTCGCCGCTCTCGTCTCCCTCGTCATCCTCGCCTCCTTCTTCTTCGCCTCCATCAGCATCTCC
TTCTTCCTCGTCACCGGCACCGAGCTGCACTGGCGAAACGCCGGCGTCGCCGGCGGCTCGGGATCTTTTGGCATG
CTGCTCACCGGCCTCTTCTCCCTCGGCGTCGTCACCGCCGCCATCCTCGTCGTCGCCTGGCTCGCCCAGGACTTG
TGCTACATCGTCTCCGCCGCCGCCCTCGTCGTCGCCCGTTGGCCCTTTGCCTTTGTCCTCAGCCGGATCCCGTGT
CGCCGCTGGCGCATCTCGTCCCCGAAGCTCACCTACCAGCACGTCCCGCAGCAGGACGACGTCGAGGGCCGGAAA
TCACGCCGAGAAGACGACGACGACGACGATGGCGCCTGCGAGAAACTTGTCCCCGAGCAGCCGCCGCAGTCGAAA
TGGTCGTTCGGTCTGCACCTTTCCGTCGCCTTCGTCTGGACGGCCCTCATCCTCACCTCGCTCTTCCGGCCCAAC
GATAGCTCCCTCGTCTTCATGTCGTGGACTGTGCCGCTCATGCCCCTCGTCGACCTGATGCACTCGTCGCCCAGC
CTCGTCGACCTCGTCCCCTCGTACGGCAGCGACGTCAACAGCGACCTGCAGAACCGGACCGCTCTCGCCGACCCG
CCCCACTGGCCCTGGCTCCCCGCGGGCGAGCCGCTCCCGGGCTTCGAGGACTGGTACGAGAACAAGGAGCACTAC
CGCGCGTCCGAGGACCCCCTCCACATCTCCAACCTCGACTTCGGCGTCCTCGCCGACATCAGGAACAAGCTCGCC
GACGTCAAGATCCGCCACGTGATGCTCATCAAGCTCGAGAGCACCCGCAAAGACGTCTTCCCCATCAAGAAGGGC
GGCCTCATCTGGGAGCGCCTGCTCGGCAACCAGCCCAAGCAGAACACGACGCCCAGCGTCGCCGCCACCCAACGC
TTCTCTACCCTCACCCCGGTGGCCAACTTGCTCACCGGCGACTTCGACGACGGCTTCCCCCACGCCGACAGGAAG
CCGCGCGGCGGCATCAACGCCAACAACGTCCACACCACCAGCACCTACACGCTCAAGAGCCTGGCGGGGACCCTG
TGCGGCCTGTACCCGCTCGTCGCCGACTTCAACGTCGAACAGTCGCACCACGTGTACCAGCCGTGCCTGCCGCAC
ATCTTCAACGCCTTCAACCGCCTGCAGGCCCATAAGGAGGGCGAGGAGCAGGGCGACGACTTCACCACCTTCAAG
TGGAAGTCGATGTTCATGCAGTCCGTCACGCAGGGCTACGACAAGCAGGACGCCGAGATGCCCGTCCTCGGCTTC
CCGCCCGAGAATTTCGTGTCCAAGGAGTCGCTGCTGAGCGGCGAGGGCAAGTTTGGCAAGGTCAACATGACGGAC
ATCAACTACTACGGAATGCCCGAGGTGGCGATCCAGGAATACCTGCGCGACGCCTTCGCCTCGGCCAAGAAGAAC
AAGGAGCGCCTGTTCCTGTCGCACCTGACGAGCACGACCCATCACCCGTTCGGCATGCCCGAGACGGAGGAGTAC
ATACCGCTGACAAGCGACAAGAAGCTCAACGACCTCTCGCACTACGCCAACGCCGTCGGCTACGTCGACCGCTGG
ATCGGCCACATCCTCAAGATGCTCGAGGAGGAGGGCGCGGCCGACGAGACGCTGCTCGTCCTCGTCGGCGACCAC
GGCCTCTCGCTGCCCGAGACGGGCGCCGTCACGCCCTACTACGGCGGCAACGTGGGCAACTTCCACGTGCCGCTG
GTGCTGTCGCACCCGAAGCTGCCGCATGTCGACGTCGACGACGCCGTCGTCTCCCTCCAGATCCTGCCGACCATC
CTCGACCTGCTGATCGAGTCGGGCTCGCTGGCCAAGCCGGCGAAGCGGGCGGCGCTCGACATGCTCCACAACTAC
GAGGGCCAGTCGCTGATCCGGCCGCAGTCCAAGGCCTCGCGCGAGACGGGCGACACCAACTGGCTCTTCACCGTC
ATGAACCCGGGCCGGGCCACGGTGGCGGTGCGCGACGCGCACCGGCAGGACTGGCGCATCATCGTGCCCGTCATC
GACGACGTCGAGTGGCGCTTCACCGACACGGGCCGGGATCCGCACGAGGAGGAGCCGACCGTCGCCTTCTCCTTC
AAGGGGCTGCTCGACAAGGTCGAGGCCAAGTACGGCGTCGACGCGGCCAAATGGGCCGAGGCGGCGGCCATCAAG
GCCCGGTGGTGGGTCAAGGAGAACAACAAGCGCTGGCGGTACCAGGCGAGCTGA
Transcript >Hirsu2|9074
ATGAATTCTAGCCCGAGTCGACGCCCTCGGGCCGCCTCGCCTGCGCCCGCCATCTCGTCCGCTTCCTCCCTCCTT
GCCCGCTTGTTCAACAGGAGGCTCTTTCTCGCCGTCCGCTTCGCTTTCGCCTTCGCCGCCGCCTCCATCCTCGGC
GCCAAGGTCGTCCACGTCTACGCCCACCTCGACGCCCTGGCCGCCTCCGACGTCGTCGCCTACGGCATCTCCTTC
TTCGCCCAGGATGTCTTCCTCCTCCTCTCCCTGCGCCTGCTACTTGACAGCCTTTCCCACCTGACGCTGCGCAGC
GTCCGCCTCTTCGTCGCCGCTCTCGTCTCCCTCGTCATCCTCGCCTCCTTCTTCTTCGCCTCCATCAGCATCTCC
TTCTTCCTCGTCACCGGCACCGAGCTGCACTGGCGAAACGCCGGCGTCGCCGGCGGCTCGGGATCTTTTGGCATG
CTGCTCACCGGCCTCTTCTCCCTCGGCGTCGTCACCGCCGCCATCCTCGTCGTCGCCTGGCTCGCCCAGGACTTG
TGCTACATCGTCTCCGCCGCCGCCCTCGTCGTCGCCCGTTGGCCCTTTGCCTTTGTCCTCAGCCGGATCCCGTGT
CGCCGCTGGCGCATCTCGTCCCCGAAGCTCACCTACCAGCACGTCCCGCAGCAGGACGACGTCGAGGGCCGGAAA
TCACGCCGAGAAGACGACGACGACGACGATGGCGCCTGCGAGAAACTTGTCCCCGAGCAGCCGCCGCAGTCGAAA
TGGTCGTTCGGTCTGCACCTTTCCGTCGCCTTCGTCTGGACGGCCCTCATCCTCACCTCGCTCTTCCGGCCCAAC
GATAGCTCCCTCGTCTTCATGTCGTGGACTGTGCCGCTCATGCCCCTCGTCGACCTGATGCACTCGTCGCCCAGC
CTCGTCGACCTCGTCCCCTCGTACGGCAGCGACGTCAACAGCGACCTGCAGAACCGGACCGCTCTCGCCGACCCG
CCCCACTGGCCCTGGCTCCCCGCGGGCGAGCCGCTCCCGGGCTTCGAGGACTGGTACGAGAACAAGGAGCACTAC
CGCGCGTCCGAGGACCCCCTCCACATCTCCAACCTCGACTTCGGCGTCCTCGCCGACATCAGGAACAAGCTCGCC
GACGTCAAGATCCGCCACGTGATGCTCATCAAGCTCGAGAGCACCCGCAAAGACGTCTTCCCCATCAAGAAGGGC
GGCCTCATCTGGGAGCGCCTGCTCGGCAACCAGCCCAAGCAGAACACGACGCCCAGCGTCGCCGCCACCCAACGC
TTCTCTACCCTCACCCCGGTGGCCAACTTGCTCACCGGCGACTTCGACGACGGCTTCCCCCACGCCGACAGGAAG
CCGCGCGGCGGCATCAACGCCAACAACGTCCACACCACCAGCACCTACACGCTCAAGAGCCTGGCGGGGACCCTG
TGCGGCCTGTACCCGCTCGTCGCCGACTTCAACGTCGAACAGTCGCACCACGTGTACCAGCCGTGCCTGCCGCAC
ATCTTCAACGCCTTCAACCGCCTGCAGGCCCATAAGGAGGGCGAGGAGCAGGGCGACGACTTCACCACCTTCAAG
TGGAAGTCGATGTTCATGCAGTCCGTCACGCAGGGCTACGACAAGCAGGACGCCGAGATGCCCGTCCTCGGCTTC
CCGCCCGAGAATTTCGTGTCCAAGGAGTCGCTGCTGAGCGGCGAGGGCAAGTTTGGCAAGGTCAACATGACGGAC
ATCAACTACTACGGAATGCCCGAGGTGGCGATCCAGGAATACCTGCGCGACGCCTTCGCCTCGGCCAAGAAGAAC
AAGGAGCGCCTGTTCCTGTCGCACCTGACGAGCACGACCCATCACCCGTTCGGCATGCCCGAGACGGAGGAGTAC
ATACCGCTGACAAGCGACAAGAAGCTCAACGACCTCTCGCACTACGCCAACGCCGTCGGCTACGTCGACCGCTGG
ATCGGCCACATCCTCAAGATGCTCGAGGAGGAGGGCGCGGCCGACGAGACGCTGCTCGTCCTCGTCGGCGACCAC
GGCCTCTCGCTGCCCGAGACGGGCGCCGTCACGCCCTACTACGGCGGCAACGTGGGCAACTTCCACGTGCCGCTG
GTGCTGTCGCACCCGAAGCTGCCGCATGTCGACGTCGACGACGCCGTCGTCTCCCTCCAGATCCTGCCGACCATC
CTCGACCTGCTGATCGAGTCGGGCTCGCTGGCCAAGCCGGCGAAGCGGGCGGCGCTCGACATGCTCCACAACTAC
GAGGGCCAGTCGCTGATCCGGCCGCAGTCCAAGGCCTCGCGCGAGACGGGCGACACCAACTGGCTCTTCACCGTC
ATGAACCCGGGCCGGGCCACGGTGGCGGTGCGCGACGCGCACCGGCAGGACTGGCGCATCATCGTGCCCGTCATC
GACGACGTCGAGTGGCGCTTCACCGACACGGGCCGGGATCCGCACGAGGAGGAGCCGACCGTCGCCTTCTCCTTC
AAGGGGCTGCTCGACAAGGTCGAGGCCAAGTACGGCGTCGACGCGGCCAAATGGGCCGAGGCGGCGGCCATCAAG
GCCCGGTGGTGGGTCAAGGAGAACAACAAGCGCTGGCGGTACCAGGCGAGCTGA
Gene >Hirsu2|9074
ATGAATTCTAGCCCGAGTCGACGCCCTCGGGCCGCCTCGCCTGCGCCCGCCATCTCGTCCGCTTCCTCCCTCCTT
GCCCGCTTGTTCAACAGGAGGCTCTTTCTCGCCGTCCGCTTCGCTTTCGCCTTCGCCGCCGCCTCCATCCTCGGC
GCCAAGGTCGTCCACGTCTACGCCCACCTCGACGCCCTGGCCGCCTCCGACGTCGTCGCCTACGGCATCTCCTTC
TTCGCCCAGGATGTCTTCCTCCTCCTCTCCCTGCGCCTGCTACTTGACAGCCTTTCCCACCTGACGCTGCGCAGC
GTCCGCCTCTTCGTCGCCGCTCTCGTCTCCCTCGTCATCCTCGCCTCCTTCTTCTTCGCCTCCATCAGCATCTCC
TTCTTCCTCGTCACCGGCACCGAGCTGCACTGGCGAAACGCCGGCGTCGCCGGCGGCTCGGGATCTTTTGGCATG
CTGCTCACCGGCCTCTTCTCCCTCGGCGTCGTCACCGCCGCCATCCTCGTCGTCGCCTGGCTCGCCCAGGACTTG
TGCTACATCGTCTCCGCCGCCGCCCTCGTCGTCGCCCGTTGGCCCTTTGCCTTTGTCCTCAGCCGGATCCCGTGT
CGCCGCTGGCGCATCTCGTCCCCGAAGCTCACCTACCAGCACGTCCCGCAGCAGGACGACGTCGAGGGCCGGAAA
TCACGCCGAGAAGACGACGACGACGACGATGGCGCCTGCGAGAAACTTGTCCCCGAGCAGCCGCCGCAGTCGAAA
TGGTCGTTCGGTCTGCACCTTTCCGTCGCCTTCGTCTGGACGGCCCTCATCCTCACCTCGCTCTTCCGGCCCAAC
GATAGCTCCCTCGTCTTCATGTCGTGGACTGTGCCGCTCATGCCCCTCGTCGACCTGATGCACTCGTCGCCCAGC
CTCGTCGACCTCGTCCCCTCGTACGGCAGCGACGTCAACAGCGACCTGCAGAACCGGACCGCTCTCGCCGACCCG
CCCCACTGGCCCTGGCTCCCCGCGGGCGAGCCGCTCCCGGGCTTCGAGGACTGGTACGAGAACAAGGAGCACTAC
CGCGCGTCCGAGGACCCCCTCCACATCTCCAACCTCGACTTCGGCGTCCTCGCCGACATCAGGAACAAGCTCGCC
GACGTCAAGATCCGCCACGTGATGCTCATCAAGCTCGAGAGCACCCGCAAAGACGTCTTCCCCATCAAGAAGGGC
GGCCTCATCTGGGAGCGCCTGCTCGGCAACCAGCCCAAGCAGAACACGACGCCCAGCGTCGCCGCCACCCAACGC
TTCTCTACCCTCACCCCGGTGGCCAACTTGCTCACCGGCGACTTCGACGACGGCTTCCCCCACGCCGACAGGAAG
CCGCGCGGCGGCATCAACGCCAACAACGTCCACACCACCAGCACCTACACGCTCAAGAGCCTGGCGGGGACCCTG
TGCGGCCTGTACCCGCTCGTCGCCGACTTCAACGTCGAACAGTCGCACCACGTGTACCAGCCGTGCCTGCCGCAC
ATCTTCAACGCCTTCAACCGCCTGCAGGCCCATAAGGAGGGCGAGGAGCAGGGCGACGACTTCACCACCTTCAAG
TGGAAGTCGATGTTCATGCAGTCCGTCACGCAGGGCTACGACAAGCAGGACGCCGAGATGCCCGTCCTCGGCTTC
CCGCCCGAGAATTTCGTGTCCAAGGAGTCGCTGCTGAGCGGCGAGGGCAAGTTTGGCAAGGTCAACATGACGGAC
ATCAACTACTACGGAATGCCCGAGGTGGCGATCCAGGAATACCTGCGCGACGCCTTCGCCTCGGCCAAGAAGAAC
AAGGAGCGCCTGTTCCTGTCGCACCTGACGAGCACGACCCATCACCCGTTCGGCATGCCCGAGACGGAGGAGTAC
ATACCGCTGACAAGCGACAAGAAGCTCAACGACCTCTCGCACTACGCCAACGCCGTCGGCTACGTCGACCGCTGG
ATCGGCCACATCCTCAAGATGCTCGAGGAGGAGGGCGCGGCCGACGAGACGCTGCTCGTCCTCGTCGGCGACCAC
GGCCTCTCGCTGCCCGAGACGGGCGCCGTCACGCCCTACTACGGCGGCAACGTGGGCAACTTCCACGTGCCGCTG
GTGCTGTCGCACCCGAAGCTGCCGCATGTCGACGTCGACGACGCCGTCGTCTCCCTCCAGATCCTGCCGACCATC
CTCGACCTGCTGATCGAGTCGGGCTCGCTGGCCAAGCCGGCGAAGCGGGCGGCGCTCGACATGCTCCACAACTAC
GAGGGCCAGTCGCTGATCCGGCCGCAGTCCAAGGCCTCGCGCGAGACGGGCGACACCAACTGGCTCTTCACCGTC
ATGAACCCGGGCCGGGCCACGGTGGCGGTGCGCGACGCGCACCGGCAGGACTGGCGCATCATCGTGCCCGTCATC
GACGACGTCGAGTGGCGCTTCACCGACACGGGCCGGGATCCGCACGAGGAGGAGCCGACCGTCGCCTTCTCCTTC
AAGGGGCTGCTCGACAAGGTCGAGGCCAAGTACGGCGTCGACGCGGCCAAATGGGCCGAGGCGGCGGCCATCAAG
GCCCGGTGGTGGGTCAAGGAGAACAACAAGCGCTGGCGGTACCAGGCGAGCTGA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail