Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|9072
Gene name
LocationContig_634:14058..14944
Strand-
Gene length (bp)886
Transcript length (bp)636
Coding sequence length (bp)636
Protein length (aa) 212

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13640 2OG-FeII_Oxy_3 2OG-Fe(II) oxygenase superfamily 4.0E-10 103 203

Swissprot hits

(None)

GO

GO Term Description Terminal node
GO:0016491 oxidoreductase activity Yes
GO:0055114 oxidation-reduction process Yes
GO:0008152 metabolic process No
GO:0008150 biological_process No
GO:0003674 molecular_function No
GO:0003824 catalytic activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 30 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|9072
LPVVDLAARLHPATPRVALIPSFFPRSLCRDYVAFLRTLPLQTTPVRPRRGEAVRVNDRFQVLDGLFARRLWEQT
GLRDALLENEDVKGLWGGEPIGLSPNIRVYRYTKGQYFDCHYDDHNDVDLPTEPPTPARTTWTLLLYLTSAAEGC
VGGETVFYPHDRKSSAEEIVVPLDTGMLLLHKHGGDCLLHEGREVTAGEKWVLRTDLCVRR*
Coding >Hirsu2|9072
CTGCCGGTCGTCGACCTCGCGGCGCGGCTGCACCCGGCCACGCCGCGGGTCGCCCTGATCCCGTCCTTCTTCCCG
CGCTCGCTGTGCCGCGACTACGTGGCCTTCCTTCGGACGCTGCCTCTGCAGACGACACCGGTCCGCCCGCGGCGC
GGCGAGGCGGTGCGCGTCAATGACCGGTTCCAGGTCCTCGACGGCCTCTTTGCCCGCCGCCTGTGGGAGCAGACG
GGCCTGAGAGACGCGCTCCTGGAGAACGAGGACGTCAAGGGGCTGTGGGGAGGCGAGCCCATCGGACTGAGCCCG
AATATCAGGGTGTATCGCTACACCAAAGGACAATACTTTGACTGCCACTACGACGACCACAACGACGTGGACCTG
CCGACCGAACCGCCTACGCCGGCCCGCACCACTTGGACCTTACTGCTCTATCTCACGTCCGCAGCGGAAGGCTGC
GTTGGCGGTGAGACGGTCTTCTACCCGCACGATCGAAAGTCGTCAGCCGAGGAGATCGTCGTGCCCCTGGACACG
GGGATGCTTCTCTTGCACAAGCACGGCGGCGATTGTCTGCTGCACGAGGGCCGTGAAGTGACGGCAGGAGAGAAA
TGGGTATTGCGGACGGATCTCTGCGTCCGAAGGTGA
Transcript >Hirsu2|9072
CTGCCGGTCGTCGACCTCGCGGCGCGGCTGCACCCGGCCACGCCGCGGGTCGCCCTGATCCCGTCCTTCTTCCCG
CGCTCGCTGTGCCGCGACTACGTGGCCTTCCTTCGGACGCTGCCTCTGCAGACGACACCGGTCCGCCCGCGGCGC
GGCGAGGCGGTGCGCGTCAATGACCGGTTCCAGGTCCTCGACGGCCTCTTTGCCCGCCGCCTGTGGGAGCAGACG
GGCCTGAGAGACGCGCTCCTGGAGAACGAGGACGTCAAGGGGCTGTGGGGAGGCGAGCCCATCGGACTGAGCCCG
AATATCAGGGTGTATCGCTACACCAAAGGACAATACTTTGACTGCCACTACGACGACCACAACGACGTGGACCTG
CCGACCGAACCGCCTACGCCGGCCCGCACCACTTGGACCTTACTGCTCTATCTCACGTCCGCAGCGGAAGGCTGC
GTTGGCGGTGAGACGGTCTTCTACCCGCACGATCGAAAGTCGTCAGCCGAGGAGATCGTCGTGCCCCTGGACACG
GGGATGCTTCTCTTGCACAAGCACGGCGGCGATTGTCTGCTGCACGAGGGCCGTGAAGTGACGGCAGGAGAGAAA
TGGGTATTGCGGACGGATCTCTGCGTCCGAAGGTGA
Gene >Hirsu2|9072
CTGCCGGTCGTCGACCTCGCGGCGCGGCTGCACCCGGCCACGCCGCGGGTCGCCCTGATCCCGTCCTTCTTCCCG
CGCTCGCTGTGCCGCGACTACGTGGCCTTCCTTCGGACGCTGCCTCTGCAGACGACACCGGTCCGCCCGCGGCGC
GGCGAGGCGGTGCGCGTCAATGACCGGTTCCAGGTCCTCGACGGCCTCTTTGCCCGCCGCCTGTGGGAGCAGACG
GGCCTGAGAGACGCGCTCCTGGAGAACGAGGACGTCAAGGGGCTGTGGTAGGCCGGCCCGCCGTTACATGTCCGC
TGTCTGGCCCGACCGGGTGAAACTGACTGCTTCCTACTGTTTGTTCCGAAGGGGAGGCGAGCCCATCGGACTGAG
CCCGAATATCAGGGTGTATCGCTACACCAAAGGACAATACTTTGACTGCCACTGTGCGTCGTGCCGAGCGGAAGA
AGGGGAGCCCAAGCGCCCCCTTTCCCGCTCTCCTGTCCCTTGTCTACCCGTAATAACGACGCGCCGGTTCTAGAC
GACGACCACAACGACGTGGACCTGCCGACCGAACCGCCTACGCCGGCCCGCACCACTTGGACCTTACTGCTCTAT
CTCACGTCCGCAGCGGAAGGCTGCGTTGGCGGTGAGACGGTCTTCTACCCGCACGATCGAAAGTCGTCAGCCGAG
GAGATCGTCGTGCCCCTGGACACGGGGATGCTTCTCTTGCACAAGCACGGCGGCGATTGTCTGCTGGTAGGACCT
CCCCTGAACGTTGCCTCTGCGACGTGTGGATGGCACTTGGGTGGCTGACGACGCTTTCTGGGCGTAGCACGAGGG
CCGTGAAGTGACGGCAGGAGAGAAATGGGTATTGCGGACGGATCTCTGCGTCCGAAGGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail