Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|9062
Gene name
LocationContig_633:44..948
Strand+
Gene length (bp)904
Transcript length (bp)756
Coding sequence length (bp)756
Protein length (aa) 252

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF17172 GST_N_4 Glutathione S-transferase N-terminal domain 1.0E-21 16 117
PF17171 GST_C_6 Glutathione S-transferase, C-terminal domain 9.1E-15 173 237
PF10568 Tom37 Outer mitochondrial membrane transport complex protein 2.5E-11 18 117

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q9HE00|MTX1_SCHPO Metaxin-1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mtx1 PE=3 SV=1 6 232 4.0E-12
sp|Q3KPT9|MTX3_XENLA Metaxin-3 OS=Xenopus laevis GN=mtx3 PE=2 SV=2 6 233 5.0E-07
sp|O45503|MTX1_CAEEL Metaxin-1 homolog OS=Caenorhabditis elegans GN=mtx-1 PE=1 SV=1 1 233 4.0E-06

GO

GO Term Description Terminal node
GO:0001401 SAM complex Yes
GO:0044446 intracellular organelle part No
GO:0044422 organelle part No
GO:0044444 cytoplasmic part No
GO:0044464 cell part No
GO:0044429 mitochondrial part No
GO:0032991 protein-containing complex No
GO:0044424 intracellular part No
GO:0098798 mitochondrial protein complex No
GO:0044425 membrane part No
GO:0098796 membrane protein complex No
GO:0044455 mitochondrial membrane part No
GO:0005575 cellular_component No
GO:0098799 outer mitochondrial membrane protein complex No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 19 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|9062
LHVFAGADAAAPSHNPSCLKWQTYLRIAGVDVDVVPSTNHASPSGALPFLLPASSDARPDVPLTGSKIARYAHDH
GARTDADDDLASPSPRREAYLALLTQSVRPAWLYALYLDPANGPLLADLYFSPSSSAASSSLLLRAANQRALRAA
ATAEILKTTRRPLLDPPALAAEAEAAFRALSALLADDDWFFGARAPGLFDAAVFAYTHPILDDGLAWADDGLGAR
LARFANLVAHRTALYERCWGREAENP*
Coding >Hirsu2|9062
CTGCACGTCTTCGCCGGCGCCGACGCCGCGGCGCCGAGTCACAACCCGTCGTGTCTGAAGTGGCAGACGTATCTG
CGCATCGCCGGCGTCGACGTCGACGTCGTCCCCTCGACGAACCACGCCTCGCCCTCGGGCGCGCTGCCCTTCCTC
CTGCCCGCCTCGTCCGACGCGCGGCCCGACGTGCCGCTGACGGGCTCCAAGATTGCGCGCTACGCCCACGACCAC
GGCGCCCGGACCGACGCCGACGACGACCTCGCTTCTCCCTCCCCGCGGCGGGAGGCCTACCTCGCGCTGCTGACG
CAGAGCGTCCGTCCCGCCTGGCTCTACGCCCTCTACCTCGACCCCGCCAACGGCCCCCTCCTCGCCGACCTGTAC
TTCTCGCCATCCTCCTCCGCCGCCTCGTCCTCCCTCCTGCTCCGCGCCGCCAACCAGCGCGCCCTCCGCGCCGCC
GCCACCGCCGAGATCCTCAAGACCACCCGCCGCCCGCTCCTCGACCCGCCCGCCCTCGCCGCCGAGGCCGAGGCC
GCCTTCCGCGCCCTCTCGGCCCTGCTCGCCGACGACGATTGGTTCTTCGGCGCCCGCGCCCCGGGCCTCTTCGAC
GCCGCCGTCTTCGCATACACCCACCCCATCCTCGACGACGGCCTGGCCTGGGCCGACGACGGCCTGGGTGCTCGC
CTCGCCCGCTTCGCCAACCTGGTCGCCCACCGGACGGCCTTGTACGAGAGGTGTTGGGGGCGCGAGGCCGAAAAT
CCCTGA
Transcript >Hirsu2|9062
CTGCACGTCTTCGCCGGCGCCGACGCCGCGGCGCCGAGTCACAACCCGTCGTGTCTGAAGTGGCAGACGTATCTG
CGCATCGCCGGCGTCGACGTCGACGTCGTCCCCTCGACGAACCACGCCTCGCCCTCGGGCGCGCTGCCCTTCCTC
CTGCCCGCCTCGTCCGACGCGCGGCCCGACGTGCCGCTGACGGGCTCCAAGATTGCGCGCTACGCCCACGACCAC
GGCGCCCGGACCGACGCCGACGACGACCTCGCTTCTCCCTCCCCGCGGCGGGAGGCCTACCTCGCGCTGCTGACG
CAGAGCGTCCGTCCCGCCTGGCTCTACGCCCTCTACCTCGACCCCGCCAACGGCCCCCTCCTCGCCGACCTGTAC
TTCTCGCCATCCTCCTCCGCCGCCTCGTCCTCCCTCCTGCTCCGCGCCGCCAACCAGCGCGCCCTCCGCGCCGCC
GCCACCGCCGAGATCCTCAAGACCACCCGCCGCCCGCTCCTCGACCCGCCCGCCCTCGCCGCCGAGGCCGAGGCC
GCCTTCCGCGCCCTCTCGGCCCTGCTCGCCGACGACGATTGGTTCTTCGGCGCCCGCGCCCCGGGCCTCTTCGAC
GCCGCCGTCTTCGCATACACCCACCCCATCCTCGACGACGGCCTGGCCTGGGCCGACGACGGCCTGGGTGCTCGC
CTCGCCCGCTTCGCCAACCTGGTCGCCCACCGGACGGCCTTGTACGAGAGGTGTTGGGGGCGCGAGGCCGAAAAT
CCCTGA
Gene >Hirsu2|9062
CTGCACGTCTTCGCCGGCGCCGACGCCGCGGCGCCGAGTCACAACCCGTCGTGTCTGAAGTGGCAGGTCCGTTCG
AGGCGTCGAGACTGCTGCGGCCTTGTCGCTGACGGCGTGGGCGCACGCGCACGCGTATACATGCATGGATAGACG
TATCTGCGCATCGCCGGCGTCGACGTCGACGTCGTCCCCTCGACGAACCACGCCTCGCCCTCGGGCGCGCTGCCC
TTCCTCCTGCCCGCCTCGTCCGACGCGCGGCCCGACGTGCCGCTGACGGGCTCCAAGATTGCGCGCTACGCCCAC
GACCACGGCGCCCGGACCGACGCCGACGACGACCTCGCTTCTCCCTCCCCGCGGCGGGAGGCCTACCTCGCGCTG
CTGACGCAGAGCGTCCGTCCCGCCTGGGTTCGTCGTTGCCCTCTCTTTCTCTCCCGCTTCGCGTTGGGGCGACGG
CAGAGCTGATCGCTTCCAGCTCTACGCCCTCTACCTCGACCCCGCCAACGGCCCCCTCCTCGCCGACCTGTACTT
CTCGCCATCCTCCTCCGCCGCCTCGTCCTCCCTCCTGCTCCGCGCCGCCAACCAGCGCGCCCTCCGCGCCGCCGC
CACCGCCGAGATCCTCAAGACCACCCGCCGCCCGCTCCTCGACCCGCCCGCCCTCGCCGCCGAGGCCGAGGCCGC
CTTCCGCGCCCTCTCGGCCCTGCTCGCCGACGACGATTGGTTCTTCGGCGCCCGCGCCCCGGGCCTCTTCGACGC
CGCCGTCTTCGCATACACCCACCCCATCCTCGACGACGGCCTGGCCTGGGCCGACGACGGCCTGGGTGCTCGCCT
CGCCCGCTTCGCCAACCTGGTCGCCCACCGGACGGCCTTGTACGAGAGGTGTTGGGGGCGCGAGGCCGAAAATCC
CTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail