Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|9060
Gene name
LocationContig_632:13449..14219
Strand+
Gene length (bp)770
Transcript length (bp)621
Coding sequence length (bp)621
Protein length (aa) 207

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00857 Isochorismatase Isochorismatase family 1.1E-20 14 166

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P21367|YCAC_ECOLI Uncharacterized protein YcaC OS=Escherichia coli (strain K12) GN=ycaC PE=1 SV=1 1 201 3.0E-86
sp|Q54NZ6|ISC1A_DICDI Isochorismatase family protein 1A OS=Dictyostelium discoideum GN=DDB_G0285041 PE=3 SV=1 12 177 9.0E-08
sp|Q54NZ8|ISC1B_DICDI Isochorismatase family protein 1B OS=Dictyostelium discoideum GN=DDB_G0284901 PE=3 SV=1 31 175 1.0E-07
sp|A0JME6|ISOC2_DANRE Isochorismatase domain-containing protein 2 OS=Danio rerio GN=isoc2 PE=2 SV=1 7 178 2.0E-07
sp|Q54RC7|ISC2B_DICDI Isochorismatase family protein 2B OS=Dictyostelium discoideum GN=DDB_G0283199 PE=3 SV=1 106 178 3.0E-07
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P21367|YCAC_ECOLI Uncharacterized protein YcaC OS=Escherichia coli (strain K12) GN=ycaC PE=1 SV=1 1 201 3.0E-86
sp|Q54NZ6|ISC1A_DICDI Isochorismatase family protein 1A OS=Dictyostelium discoideum GN=DDB_G0285041 PE=3 SV=1 12 177 9.0E-08
sp|Q54NZ8|ISC1B_DICDI Isochorismatase family protein 1B OS=Dictyostelium discoideum GN=DDB_G0284901 PE=3 SV=1 31 175 1.0E-07
sp|A0JME6|ISOC2_DANRE Isochorismatase domain-containing protein 2 OS=Danio rerio GN=isoc2 PE=2 SV=1 7 178 2.0E-07
sp|Q54RC7|ISC2B_DICDI Isochorismatase family protein 2B OS=Dictyostelium discoideum GN=DDB_G0283199 PE=3 SV=1 106 178 3.0E-07
sp|Q5PQA5|ISOC1_XENLA Isochorismatase domain-containing protein 1 OS=Xenopus laevis GN=isoc1 PE=2 SV=1 41 175 4.0E-06
sp|Q91V64|ISOC1_MOUSE Isochorismatase domain-containing protein 1 OS=Mus musculus GN=Isoc1 PE=1 SV=1 41 175 6.0E-06
sp|Q6I7R3|ISOC1_RAT Isochorismatase domain-containing protein 1 OS=Rattus norvegicus GN=Isoc1 PE=1 SV=1 41 175 6.0E-06
sp|Q08C33|ISOC1_DANRE Isochorismatase domain-containing protein 1 OS=Danio rerio GN=isoc1 PE=2 SV=1 41 175 7.0E-06
sp|Q96CN7|ISOC1_HUMAN Isochorismatase domain-containing protein 1 OS=Homo sapiens GN=ISOC1 PE=1 SV=3 41 175 8.0E-06
sp|A6QLY4|ISOC1_BOVIN Isochorismatase domain-containing protein 1 OS=Bos taurus GN=ISOC1 PE=2 SV=1 41 175 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0003824 catalytic activity Yes
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|9060
MPPAYKRLDRDNCAFLFIDHQAGLIQLVRDFEPHEFKANVQALARVASYYKVPTVLTTSFDTGPNGPIAKEIPEQ
LPDARLIRRPGQINAMDNEDFATLVKSFGKQQIVISGVLTEVCVAFPALSLIEQGYDVFVVTDASGTFAEHTREA
AHKRMASQGVQLMNWAAVAAELHRDWRNDIEGFGKIWTDYVPGYWCLMQSYTAKRD*
Coding >Hirsu2|9060
ATGCCTCCCGCCTACAAGCGCCTCGATCGCGACAACTGCGCCTTTCTCTTCATCGATCACCAAGCCGGCCTCATC
CAGCTGGTGCGCGACTTCGAACCGCATGAGTTCAAGGCCAACGTCCAGGCCCTGGCCAGGGTGGCCAGCTACTAC
AAGGTGCCGACGGTCCTGACCACCTCGTTCGACACGGGGCCCAACGGCCCCATCGCCAAGGAGATTCCCGAGCAG
CTGCCCGATGCCCGCCTGATCCGACGCCCGGGTCAGATCAACGCCATGGACAACGAGGATTTCGCGACCCTCGTC
AAGTCGTTCGGCAAGCAGCAGATCGTCATCAGCGGCGTCTTGACCGAGGTCTGCGTCGCCTTCCCGGCCCTCAGC
CTGATTGAGCAGGGCTACGACGTCTTCGTCGTGACGGACGCCTCGGGCACCTTCGCCGAGCACACGCGCGAGGCG
GCGCACAAGCGCATGGCCTCGCAGGGCGTCCAGCTGATGAACTGGGCCGCCGTCGCCGCCGAGTTGCACCGCGAC
TGGCGCAACGACATCGAGGGCTTCGGCAAGATCTGGACCGACTACGTCCCGGGCTACTGGTGCCTGATGCAGAGC
TACACCGCCAAGCGGGACTAA
Transcript >Hirsu2|9060
ATGCCTCCCGCCTACAAGCGCCTCGATCGCGACAACTGCGCCTTTCTCTTCATCGATCACCAAGCCGGCCTCATC
CAGCTGGTGCGCGACTTCGAACCGCATGAGTTCAAGGCCAACGTCCAGGCCCTGGCCAGGGTGGCCAGCTACTAC
AAGGTGCCGACGGTCCTGACCACCTCGTTCGACACGGGGCCCAACGGCCCCATCGCCAAGGAGATTCCCGAGCAG
CTGCCCGATGCCCGCCTGATCCGACGCCCGGGTCAGATCAACGCCATGGACAACGAGGATTTCGCGACCCTCGTC
AAGTCGTTCGGCAAGCAGCAGATCGTCATCAGCGGCGTCTTGACCGAGGTCTGCGTCGCCTTCCCGGCCCTCAGC
CTGATTGAGCAGGGCTACGACGTCTTCGTCGTGACGGACGCCTCGGGCACCTTCGCCGAGCACACGCGCGAGGCG
GCGCACAAGCGCATGGCCTCGCAGGGCGTCCAGCTGATGAACTGGGCCGCCGTCGCCGCCGAGTTGCACCGCGAC
TGGCGCAACGACATCGAGGGCTTCGGCAAGATCTGGACCGACTACGTCCCGGGCTACTGGTGCCTGATGCAGAGC
TACACCGCCAAGCGGGACTAA
Gene >Hirsu2|9060
ATGCCTCCCGCCTACAAGCGCCTCGATCGCGACAACTGCGCCTTTCTCTTCATCGATCACCAAGTAAGGCCCTCG
GACCGCGTTTGAAAAAAAACTCGCATACGCACCAAGGGCGGAACCCTTGCTGACGAGCCTCTCCTCCCTCGCCAA
AGGCCGGCCTCATCCAGCTGGTGCGCGACTTCGAACCGCATGAGTTCAAGGCCAACGTCCAGGCCCTGGCCAGGG
TGGCCAGCTACTACAAGGTGCCGACGGTCCTGACCACCTCGTTCGACACGGGGCCCAACGGCCCCATCGCCAAGG
AGATTCCCGAGCAGCTGCCCGATGCCCGCCTGATCCGACGCCCGGGTCAGATCAACGCCATGGACAACGAGGATT
TCGCGACCCTCGTCAAGTCGTTCGGCAAGCAGCAGATCGTCATCAGGTAACATCTCCAAAAGGCCATGACATGTC
AGTGTGACTGACGAATCGCACCCTCCCGTAGCGGCGTCTTGACCGAGGTCTGCGTCGCCTTCCCGGCCCTCAGCC
TGATTGAGCAGGGCTACGACGTCTTCGTCGTGACGGACGCCTCGGGCACCTTCGCCGAGCACACGCGCGAGGCGG
CGCACAAGCGCATGGCCTCGCAGGGCGTCCAGCTGATGAACTGGGCCGCCGTCGCCGCCGAGTTGCACCGCGACT
GGCGCAACGACATCGAGGGCTTCGGCAAGATCTGGACCGACTACGTCCCGGGCTACTGGTGCCTGATGCAGAGCT
ACACCGCCAAGCGGGACTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail