Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|906
Gene name
LocationContig_119:19024..20319
Strand+
Gene length (bp)1295
Transcript length (bp)1146
Coding sequence length (bp)1146
Protein length (aa) 382

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12697 Abhydrolase_6 Alpha/beta hydrolase family 1.1E-11 72 366

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|D4AV38|LIP4_ARTBC Probable secreted lipase ARB_00047 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_00047 PE=1 SV=1 27 380 4.0E-128

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 18 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|906
MMRLLPLLACGAASVAPGARDGVCEAEMPHLRTYFYVGGQYGRDTDGAHRMRGQMYVERLLPIDGVTQEWPVVLV
HGKGMTGTNFLNTPDGRRGWASDFLSQGYEVYLVDQALRGRSPWLPPGDANGTEQWPLPSAFSAELIQDRFTATR
INKLWPQAGAHTQWPGMGIRGDPVFDAFYASTVQSVADAALTQRAVQRAGAALLDRIGRPAILVGHSQGGTLPTL
IADARPALSRALVLLEPAGPPFREAVFDHRPARAWGLTDSPLTYRPAVRDPARDIVQATRPALSKDHTDCILQAD
EPAPRRLVNLARKPILVLTAESSYHARYDHCTVEYLRQAGCSRTQHVELAKLGIRGNGHMMFLERNSRHIQGVVH
QWIQEL*
Coding >Hirsu2|906
ATGATGCGCTTGCTTCCCCTGCTGGCATGCGGCGCGGCCTCCGTGGCGCCGGGGGCGAGAGACGGCGTCTGCGAG
GCCGAGATGCCCCATCTCCGCACCTACTTCTACGTCGGAGGCCAGTACGGCAGAGATACGGACGGGGCCCATCGC
ATGCGCGGCCAGATGTATGTCGAGAGGCTGCTTCCGATCGACGGCGTGACGCAAGAGTGGCCCGTCGTCCTGGTG
CATGGCAAGGGCATGACCGGAACCAACTTCCTCAACACGCCCGACGGCCGCCGCGGCTGGGCGTCCGACTTTCTC
AGCCAGGGCTACGAGGTCTATCTCGTCGACCAGGCGCTGCGCGGCCGCTCGCCCTGGCTTCCGCCCGGCGACGCC
AACGGCACCGAGCAGTGGCCTCTGCCGTCCGCCTTCTCCGCCGAGCTCATCCAGGACCGCTTCACGGCCACGCGC
ATCAACAAGCTCTGGCCGCAGGCGGGCGCCCACACGCAGTGGCCGGGCATGGGAATCAGGGGCGACCCCGTCTTC
GACGCCTTCTACGCCTCCACCGTCCAGTCGGTCGCCGACGCGGCCCTCACGCAGCGCGCCGTGCAGCGCGCCGGG
GCCGCTCTCCTCGACCGGATCGGCCGCCCGGCCATCCTCGTCGGCCACAGCCAGGGAGGCACGCTGCCCACGCTC
ATCGCCGACGCGAGGCCGGCCCTCTCCAGGGCGCTTGTCCTGCTCGAGCCGGCCGGGCCGCCCTTCCGCGAGGCT
GTCTTCGACCACCGGCCCGCCCGCGCCTGGGGCCTCACGGACTCCCCCCTGACCTACCGCCCTGCTGTTCGGGAC
CCCGCGCGAGACATCGTCCAGGCGACCCGGCCTGCCCTGAGCAAGGATCACACGGACTGCATCCTACAGGCCGAC
GAGCCCGCGCCCCGTAGGCTCGTCAACCTGGCTCGTAAGCCCATCCTCGTTCTCACTGCCGAGTCGAGCTACCAC
GCCCGGTACGACCACTGCACGGTCGAATATCTCCGCCAGGCCGGCTGCTCCAGGACGCAGCACGTAGAGCTGGCC
AAGCTCGGCATCCGCGGCAACGGGCACATGATGTTCCTCGAGCGCAACAGCCGCCACATCCAGGGGGTTGTGCAC
CAATGGATTCAAGAGCTGTGA
Transcript >Hirsu2|906
ATGATGCGCTTGCTTCCCCTGCTGGCATGCGGCGCGGCCTCCGTGGCGCCGGGGGCGAGAGACGGCGTCTGCGAG
GCCGAGATGCCCCATCTCCGCACCTACTTCTACGTCGGAGGCCAGTACGGCAGAGATACGGACGGGGCCCATCGC
ATGCGCGGCCAGATGTATGTCGAGAGGCTGCTTCCGATCGACGGCGTGACGCAAGAGTGGCCCGTCGTCCTGGTG
CATGGCAAGGGCATGACCGGAACCAACTTCCTCAACACGCCCGACGGCCGCCGCGGCTGGGCGTCCGACTTTCTC
AGCCAGGGCTACGAGGTCTATCTCGTCGACCAGGCGCTGCGCGGCCGCTCGCCCTGGCTTCCGCCCGGCGACGCC
AACGGCACCGAGCAGTGGCCTCTGCCGTCCGCCTTCTCCGCCGAGCTCATCCAGGACCGCTTCACGGCCACGCGC
ATCAACAAGCTCTGGCCGCAGGCGGGCGCCCACACGCAGTGGCCGGGCATGGGAATCAGGGGCGACCCCGTCTTC
GACGCCTTCTACGCCTCCACCGTCCAGTCGGTCGCCGACGCGGCCCTCACGCAGCGCGCCGTGCAGCGCGCCGGG
GCCGCTCTCCTCGACCGGATCGGCCGCCCGGCCATCCTCGTCGGCCACAGCCAGGGAGGCACGCTGCCCACGCTC
ATCGCCGACGCGAGGCCGGCCCTCTCCAGGGCGCTTGTCCTGCTCGAGCCGGCCGGGCCGCCCTTCCGCGAGGCT
GTCTTCGACCACCGGCCCGCCCGCGCCTGGGGCCTCACGGACTCCCCCCTGACCTACCGCCCTGCTGTTCGGGAC
CCCGCGCGAGACATCGTCCAGGCGACCCGGCCTGCCCTGAGCAAGGATCACACGGACTGCATCCTACAGGCCGAC
GAGCCCGCGCCCCGTAGGCTCGTCAACCTGGCTCGTAAGCCCATCCTCGTTCTCACTGCCGAGTCGAGCTACCAC
GCCCGGTACGACCACTGCACGGTCGAATATCTCCGCCAGGCCGGCTGCTCCAGGACGCAGCACGTAGAGCTGGCC
AAGCTCGGCATCCGCGGCAACGGGCACATGATGTTCCTCGAGCGCAACAGCCGCCACATCCAGGGGGTTGTGCAC
CAATGGATTCAAGAGCTGTGA
Gene >Hirsu2|906
ATGATGCGCTTGCTTCCCCTGCTGGCATGCGGCGCGGCCTCCGTGGCGCCGGGGGCGAGAGACGGCGTCTGCGAG
GCCGAGATGCCCCATCTCCGCACCTACTTCTACGTCGGAGGCCAGTACGGCAGAGATACGGACGGGGCCCATCGC
ATGCGCGGCCAGATGTATGTCGAGAGGCTGCTTCCGATCGACGGCGTGACGCAAGAGTGGCCCGTCGTCCTGGTG
CATGGCAAGGGCATGACCGGAACCGTGAGTCTGCTCGTCCGAGCCCTGCCGCGGGCCTCACGGCAGGGGAGGCCG
GAGAGCGTGTTCCCGTGTCTTGGACCGGCCTCGCCTGCAGCCGGGTGGCTGGATATTGACACGTGTGTCGGGGCT
GAGGGCGCCGCCGCGCGAGACAGAACTTCCTCAACACGCCCGACGGCCGCCGCGGCTGGGCGTCCGACTTTCTCA
GCCAGGGCTACGAGGTCTATCTCGTCGACCAGGCGCTGCGCGGCCGCTCGCCCTGGCTTCCGCCCGGCGACGCCA
ACGGCACCGAGCAGTGGCCTCTGCCGTCCGCCTTCTCCGCCGAGCTCATCCAGGACCGCTTCACGGCCACGCGCA
TCAACAAGCTCTGGCCGCAGGCGGGCGCCCACACGCAGTGGCCGGGCATGGGAATCAGGGGCGACCCCGTCTTCG
ACGCCTTCTACGCCTCCACCGTCCAGTCGGTCGCCGACGCGGCCCTCACGCAGCGCGCCGTGCAGCGCGCCGGGG
CCGCTCTCCTCGACCGGATCGGCCGCCCGGCCATCCTCGTCGGCCACAGCCAGGGAGGCACGCTGCCCACGCTCA
TCGCCGACGCGAGGCCGGCCCTCTCCAGGGCGCTTGTCCTGCTCGAGCCGGCCGGGCCGCCCTTCCGCGAGGCTG
TCTTCGACCACCGGCCCGCCCGCGCCTGGGGCCTCACGGACTCCCCCCTGACCTACCGCCCTGCTGTTCGGGACC
CCGCGCGAGACATCGTCCAGGCGACCCGGCCTGCCCTGAGCAAGGATCACACGGACTGCATCCTACAGGCCGACG
AGCCCGCGCCCCGTAGGCTCGTCAACCTGGCTCGTAAGCCCATCCTCGTTCTCACTGCCGAGTCGAGCTACCACG
CCCGGTACGACCACTGCACGGTCGAATATCTCCGCCAGGCCGGCTGCTCCAGGACGCAGCACGTAGAGCTGGCCA
AGCTCGGCATCCGCGGCAACGGGCACATGATGTTCCTCGAGCGCAACAGCCGCCACATCCAGGGGGTTGTGCACC
AATGGATTCAAGAGCTGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail