Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|9059
Gene name
LocationContig_632:10724..12054
Strand+
Gene length (bp)1330
Transcript length (bp)957
Coding sequence length (bp)957
Protein length (aa) 319

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00230 MIP Major intrinsic protein 3.3E-31 63 290

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9ATM5|PIP26_MAIZE Aquaporin PIP2-6 OS=Zea mays GN=PIP2-6 PE=2 SV=1 54 293 1.0E-22
sp|P25794|PIP2_PEA Probable aquaporin PIP-type 7a OS=Pisum sativum GN=TRG-31 PE=2 SV=2 67 290 7.0E-22
sp|Q7XLR1|PIP26_ORYSJ Probable aquaporin PIP2-6 OS=Oryza sativa subsp. japonica GN=PIP2-6 PE=2 SV=2 60 293 2.0E-21
sp|Q8GRI8|PIP25_ORYSJ Aquaporin PIP2-5 OS=Oryza sativa subsp. japonica GN=PIP2-5 PE=2 SV=1 67 293 7.0E-21
sp|P42767|PIP1_ATRCA Aquaporin PIP-type OS=Atriplex canescens PE=2 SV=1 60 290 1.0E-20
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9ATM5|PIP26_MAIZE Aquaporin PIP2-6 OS=Zea mays GN=PIP2-6 PE=2 SV=1 54 293 1.0E-22
sp|P25794|PIP2_PEA Probable aquaporin PIP-type 7a OS=Pisum sativum GN=TRG-31 PE=2 SV=2 67 290 7.0E-22
sp|Q7XLR1|PIP26_ORYSJ Probable aquaporin PIP2-6 OS=Oryza sativa subsp. japonica GN=PIP2-6 PE=2 SV=2 60 293 2.0E-21
sp|Q8GRI8|PIP25_ORYSJ Aquaporin PIP2-5 OS=Oryza sativa subsp. japonica GN=PIP2-5 PE=2 SV=1 67 293 7.0E-21
sp|P42767|PIP1_ATRCA Aquaporin PIP-type OS=Atriplex canescens PE=2 SV=1 60 290 1.0E-20
sp|Q8GRT8|PIP24_ORYSJ Aquaporin PIP2-4 OS=Oryza sativa subsp. japonica GN=PIP2-4 PE=2 SV=1 60 290 3.0E-20
sp|Q9ATM6|PIP24_MAIZE Aquaporin PIP2-4 OS=Zea mays GN=PIP2-4 PE=1 SV=1 67 290 1.0E-19
sp|Q9ATM4|PIP27_MAIZE Aquaporin PIP2-7 OS=Zea mays GN=PIP2-7 PE=2 SV=1 67 290 1.0E-19
sp|Q6K215|PIP22_ORYSJ Probable aquaporin PIP2-2 OS=Oryza sativa subsp. japonica GN=PIP2-2 PE=2 SV=1 67 290 2.0E-19
sp|Q9ATM7|PIP23_MAIZE Aquaporin PIP2-3 OS=Zea mays GN=PIP2-3 PE=2 SV=1 67 290 3.0E-19
sp|Q9XF58|PIP25_MAIZE Aquaporin PIP2-5 OS=Zea mays GN=PIP2-5 PE=1 SV=1 67 290 5.0E-19
sp|Q9ZV07|PIP26_ARATH Probable aquaporin PIP2-6 OS=Arabidopsis thaliana GN=PIP2-6 PE=1 SV=1 56 290 7.0E-19
sp|Q06611|PIP12_ARATH Aquaporin PIP1-2 OS=Arabidopsis thaliana GN=PIP1-2 PE=1 SV=1 67 293 8.0E-19
sp|Q08451|PIP1_SOLLC Probable aquaporin PIP-type pTOM75 OS=Solanum lycopersicum PE=2 SV=1 67 293 9.0E-19
sp|P93004|PIP27_ARATH Aquaporin PIP2-7 OS=Arabidopsis thaliana GN=PIP2-7 PE=1 SV=2 60 293 1.0E-18
sp|P30302|PIP23_ARATH Aquaporin PIP2-3 OS=Arabidopsis thaliana GN=PIP2-3 PE=1 SV=1 53 290 1.0E-18
sp|P61838|PIP11_VICFA Aquaporin PIP1.1 OS=Vicia faba GN=PIP1.1 PE=2 SV=1 67 293 2.0E-18
sp|P61837|PIP11_ARATH Aquaporin PIP1-1 OS=Arabidopsis thaliana GN=PIP1-1 PE=1 SV=1 67 293 2.0E-18
sp|Q7XUA6|PIP23_ORYSJ Probable aquaporin PIP2-3 OS=Oryza sativa subsp. japonica GN=PIP2-3 PE=2 SV=1 67 290 2.0E-18
sp|Q7Y1E6|PIP28_ORYSJ Probable aquaporin PIP2-8 OS=Oryza sativa subsp. japonica GN=PIP2-8 PE=2 SV=1 60 283 4.0E-18
sp|O22588|TIP32_ARATH Probable aquaporin TIP3-2 OS=Arabidopsis thaliana GN=TIP3-2 PE=2 SV=1 124 301 5.0E-18
sp|Q39196|PIP14_ARATH Probable aquaporin PIP1-4 OS=Arabidopsis thaliana GN=PIP1.4 PE=1 SV=1 67 293 6.0E-18
sp|Q651D5|PIP27_ORYSJ Probable aquaporin PIP2-7 OS=Oryza sativa subsp. japonica GN=PIP2-7 PE=2 SV=2 60 290 6.0E-18
sp|Q9FF53|PIP24_ARATH Probable aquaporin PIP2-4 OS=Arabidopsis thaliana GN=PIP2-4 PE=1 SV=1 40 283 7.0E-18
sp|Q9ZVX8|PIP28_ARATH Probable aquaporin PIP2-8 OS=Arabidopsis thaliana GN=PIP2-8 PE=1 SV=1 67 293 1.0E-17
sp|P43287|PIP22_ARATH Aquaporin PIP2-2 OS=Arabidopsis thaliana GN=PIP2-2 PE=1 SV=2 67 290 1.0E-17
sp|Q9AQU5|PIP13_MAIZE Aquaporin PIP1-3/PIP1-4 OS=Zea mays GN=PIP1-3 PE=2 SV=1 61 290 1.0E-17
sp|Q9SXF8|PIP13_ORYSJ Aquaporin PIP 1-3 OS=Oryza sativa subsp. japonica GN=PIP1-3 PE=2 SV=2 67 293 1.0E-17
sp|P43286|PIP21_ARATH Aquaporin PIP2-1 OS=Arabidopsis thaliana GN=PIP2-1 PE=1 SV=1 42 290 2.0E-17
sp|Q8H5N9|PIP21_ORYSJ Probable aquaporin PIP2-1 OS=Oryza sativa subsp. japonica GN=PIP2-1 PE=2 SV=1 60 290 2.0E-17
sp|Q6EU94|PIP11_ORYSJ Aquaporin PIP1-1 OS=Oryza sativa subsp. japonica GN=PIP1-1 PE=2 SV=1 61 293 2.0E-17
sp|Q9AR14|PIP15_MAIZE Aquaporin PIP1-5 OS=Zea mays GN=PIP1-5 PE=2 SV=1 67 293 2.0E-17
sp|Q9ATM8|PIP22_MAIZE Aquaporin PIP2-2 OS=Zea mays GN=PIP2-2 PE=2 SV=1 60 290 3.0E-17
sp|Q9XF59|PIP12_MAIZE Aquaporin PIP1-2 OS=Zea mays GN=PIP1-2 PE=1 SV=1 61 290 4.0E-17
sp|Q8LAA6|PIP15_ARATH Probable aquaporin PIP1-5 OS=Arabidopsis thaliana GN=PIP1-5 PE=2 SV=2 61 293 4.0E-17
sp|Q84RL7|PIP21_MAIZE Aquaporin PIP2-1 OS=Zea mays GN=PIP2-1 PE=1 SV=2 60 290 5.0E-17
sp|Q08733|PIP13_ARATH Aquaporin PIP1-3 OS=Arabidopsis thaliana GN=PIP1-3 PE=1 SV=1 67 290 6.0E-17
sp|Q9SV31|PIP25_ARATH Probable aquaporin PIP2-5 OS=Arabidopsis thaliana GN=PIP2-5 PE=1 SV=1 51 290 7.0E-17
sp|Q7XSQ9|PIP12_ORYSJ Probable aquaporin PIP1-2 OS=Oryza sativa subsp. japonica GN=PIP1-2 PE=2 SV=3 61 290 8.0E-17
sp|P23958|TIPA_PHAVU Probable aquaporin TIP-type alpha OS=Phaseolus vulgaris PE=1 SV=1 119 297 3.0E-16
sp|Q9LWR2|TIP43_ORYSJ Probable aquaporin TIP4-3 OS=Oryza sativa subsp. japonica GN=TIP4-3 PE=2 SV=1 124 297 8.0E-16
sp|Q9ATN0|PIP16_MAIZE Aquaporin PIP1-6 OS=Zea mays GN=PIP1-6 PE=2 SV=1 67 293 2.0E-15
sp|P26587|TIP31_ARATH Aquaporin TIP3-1 OS=Arabidopsis thaliana GN=TIP3-1 PE=2 SV=1 124 298 3.0E-15
sp|Q9ATL3|TIP44_MAIZE Aquaporin TIP4-4 OS=Zea mays GN=TIP4-4 PE=2 SV=1 105 312 3.0E-15
sp|Q9ATL8|TIP22_MAIZE Aquaporin TIP2-2 OS=Zea mays GN=TIP2-2 PE=2 SV=1 105 290 4.0E-15
sp|Q9NHW7|AQP_AEDAE Aquaporin AQPAe.a OS=Aedes aegypti GN=AAEL003512 PE=2 SV=2 103 290 6.0E-15
sp|Q41870|PIP11_MAIZE Aquaporin PIP1-1 OS=Zea mays GN=PIP1-1 PE=1 SV=1 61 293 1.0E-14
sp|Q75GA5|TIP41_ORYSJ Probable aquaporin TIP4-1 OS=Oryza sativa subsp. japonica GN=TIP4-1 PE=2 SV=1 105 290 2.0E-14
sp|Q9AT75|TIP32_MAIZE Aquaporin TIP3-2 OS=Zea mays GN=TIP3-2 PE=2 SV=1 70 295 2.0E-14
sp|Q9FGL2|TIP23_ARATH Aquaporin TIP2-3 OS=Arabidopsis thaliana GN=TIP2-3 PE=1 SV=1 60 290 2.0E-14
sp|Q9ATL9|TIP21_MAIZE Aquaporin TIP2-1 OS=Zea mays GN=TIP2-1 PE=2 SV=1 121 290 3.0E-14
sp|Q84RL6|TIP23_MAIZE Aquaporin TIP2-3 OS=Zea mays GN=TIP2-3 PE=2 SV=2 105 290 3.0E-14
sp|P33560|TIP_ANTMA Probable aquaporin TIP-type OS=Antirrhinum majus GN=DIP PE=2 SV=1 121 290 3.0E-14
sp|Q9ATL5|TIP42_MAIZE Aquaporin TIP4-2 OS=Zea mays GN=TIP4-2 PE=2 SV=1 124 290 4.0E-14
sp|Q25074|AQP_HAEIX Aquaporin OS=Haematobia irritans exigua PE=2 SV=1 124 305 4.0E-14
sp|Q9ATL4|TIP43_MAIZE Aquaporin TIP4-3 OS=Zea mays GN=TIP4-3 PE=2 SV=1 105 297 6.0E-14
sp|Q5I4F9|AQP4_NOTAL Aquaporin-4 OS=Notomys alexis GN=AQP4 PE=2 SV=1 106 290 1.0E-13
sp|P50156|TIP11_ORYSJ Probable aquaporin TIP1-1 OS=Oryza sativa subsp. japonica GN=TIP1-1 PE=2 SV=1 121 301 1.0E-13
sp|Q9ATL6|TIP41_MAIZE Aquaporin TIP4-1 OS=Zea mays GN=TIP4-1 PE=2 SV=1 124 290 1.0E-13
sp|Q41975|TIP22_ARATH Probable aquaporin TIP2-2 OS=Arabidopsis thaliana GN=TIP2-2 PE=1 SV=2 121 290 1.0E-13
sp|P55088|AQP4_MOUSE Aquaporin-4 OS=Mus musculus GN=Aqp4 PE=1 SV=2 106 290 1.0E-13
sp|O82598|TIP13_ARATH Aquaporin TIP1-3 OS=Arabidopsis thaliana GN=TIP1-3 PE=1 SV=1 113 301 1.0E-13
sp|P47863|AQP4_RAT Aquaporin-4 OS=Rattus norvegicus GN=Aqp4 PE=1 SV=1 106 290 1.0E-13
sp|Q9LWR0|TIP42_ORYSJ Probable aquaporin TIP4-2 OS=Oryza sativa subsp. japonica GN=TIP4-2 PE=2 SV=2 124 290 2.0E-13
sp|O82316|TIP41_ARATH Aquaporin TIP4-1 OS=Arabidopsis thaliana GN=TIP4-1 PE=2 SV=1 124 290 2.0E-13
sp|P29975|AQP1_RAT Aquaporin-1 OS=Rattus norvegicus GN=Aqp1 PE=1 SV=4 69 290 2.0E-13
sp|Q41951|TIP21_ARATH Aquaporin TIP2-1 OS=Arabidopsis thaliana GN=TIP2-1 PE=1 SV=2 113 290 3.0E-13
sp|Q7XA61|TIP21_ORYSJ Probable aquaporin TIP2-1 OS=Oryza sativa subsp. japonica GN=TIP2-1 PE=2 SV=1 121 290 3.0E-13
sp|Q5Z6F0|TIP22_ORYSJ Probable aquaporin TIP2-2 OS=Oryza sativa subsp. japonica GN=TIP2-2 PE=2 SV=1 121 290 4.0E-13
sp|Q923J4|AQP4_DIPME Aquaporin-4 OS=Dipodomys merriami GN=AQP4 PE=2 SV=1 40 290 7.0E-13
sp|Q7PWV1|AQP_ANOGA Aquaporin AQPAn.G OS=Anopheles gambiae GN=AGAP008842 PE=3 SV=4 103 305 7.0E-13
sp|P47865|AQP1_BOVIN Aquaporin-1 OS=Bos taurus GN=AQP1 PE=1 SV=3 63 290 8.0E-13
sp|O77750|AQP4_BOVIN Aquaporin-4 OS=Bos taurus GN=AQP4 PE=2 SV=3 106 290 8.0E-13
sp|Q41963|TIP12_ARATH Aquaporin TIP1-2 OS=Arabidopsis thaliana GN=TIP1-2 PE=1 SV=2 70 290 9.0E-13
sp|O64964|TIP11_MAIZE Aquaporin TIP1-1 OS=Zea mays GN=TIP1-1 PE=2 SV=1 121 301 1.0E-12
sp|P55087|AQP4_HUMAN Aquaporin-4 OS=Homo sapiens GN=AQP4 PE=1 SV=2 106 290 1.0E-12
sp|P50501|AQPA_PELES Aquaporin FA-CHIP OS=Pelophylax esculentus GN=AQPA PE=2 SV=1 63 290 1.0E-12
sp|P25818|TIP11_ARATH Aquaporin TIP1-1 OS=Arabidopsis thaliana GN=TIP1-1 PE=1 SV=1 121 290 1.0E-12
sp|Q02013|AQP1_MOUSE Aquaporin-1 OS=Mus musculus GN=Aqp1 PE=1 SV=3 69 290 2.0E-12
sp|Q9N2J4|AQP1_CANLF Aquaporin-1 OS=Canis lupus familiaris GN=AQP1 PE=2 SV=3 63 290 2.0E-12
sp|Q94CS9|TIP12_ORYSJ Probable aquaporin TIP1-2 OS=Oryza sativa subsp. japonica GN=TIP1-2 PE=2 SV=1 121 290 4.0E-12
sp|Q9ATL7|TIP31_MAIZE Aquaporin TIP3-1 OS=Zea mays GN=TIP3-1 PE=2 SV=1 124 294 1.0E-11
sp|P29972|AQP1_HUMAN Aquaporin-1 OS=Homo sapiens GN=AQP1 PE=1 SV=3 63 290 1.0E-11
sp|Q9ATM0|TIP12_MAIZE Aquaporin TIP1-2 OS=Zea mays GN=TIP1-2 PE=2 SV=1 124 290 1.0E-11
sp|P06624|MIP_BOVIN Lens fiber major intrinsic protein OS=Bos taurus GN=MIP PE=1 SV=1 64 290 2.0E-11
sp|A4L9J0|MIP_RABIT Lens fiber major intrinsic protein OS=Oryctolagus cuniculus GN=MIP PE=2 SV=1 64 290 2.0E-11
sp|Q6PQZ1|AQP1_PIG Aquaporin-1 OS=Sus scrofa GN=AQP1 PE=2 SV=3 63 290 2.0E-11
sp|Q5R819|AQP1_PONAB Aquaporin-1 OS=Pongo abelii GN=AQP1 PE=2 SV=3 63 290 2.0E-11
sp|P24422|TIP2_TOBAC Probable aquaporin TIP-type RB7-18C OS=Nicotiana tabacum PE=2 SV=2 121 290 2.0E-11
sp|P21653|TIP1_TOBAC Probable aquaporin TIP-type RB7-5A OS=Nicotiana tabacum PE=2 SV=1 121 290 3.0E-11
sp|Q9FWV6|TIP31_ORYSJ Probable aquaporin TIP3-1 OS=Oryza sativa subsp. japonica GN=TIP3-1 PE=2 SV=1 124 294 3.0E-11
sp|Q54WT8|AQPB_DICDI Aquaporin-B OS=Dictyostelium discoideum GN=aqpB PE=1 SV=1 70 283 4.0E-11
sp|Q6J8I9|MIP_SHEEP Lens fiber major intrinsic protein OS=Ovis aries GN=MIP PE=1 SV=1 64 290 6.0E-11
sp|Q9FY14|TIP1_MEDTR Probable aquaporin TIP-type OS=Medicago truncatula GN=AQP1 PE=1 SV=1 113 282 8.0E-11
sp|A2IBY8|MIP_CANLF Lens fiber major intrinsic protein OS=Canis lupus familiaris GN=MIP PE=2 SV=1 64 290 9.0E-11
sp|Q06019|MIP_LITPI Lens fiber major intrinsic protein OS=Lithobates pipiens PE=1 SV=1 63 285 9.0E-11
sp|Q23808|AQP_CICVR Aquaporin AQPcic OS=Cicadella viridis GN=AQP PE=1 SV=1 65 293 2.0E-10
sp|P56401|AQP1_SHEEP Aquaporin-1 OS=Ovis aries GN=AQP1 PE=1 SV=3 63 290 3.0E-10
sp|Q9WTY4|AQP5_MOUSE Aquaporin-5 OS=Mus musculus GN=Aqp5 PE=1 SV=1 119 291 4.0E-10
sp|P55064|AQP5_HUMAN Aquaporin-5 OS=Homo sapiens GN=AQP5 PE=1 SV=1 119 291 4.0E-10
sp|P51180|MIP_MOUSE Lens fiber major intrinsic protein OS=Mus musculus GN=Mip PE=1 SV=2 64 290 6.0E-10
sp|Q7XKI5|TIP32_ORYSJ Probable aquaporin TIP3-2 OS=Oryza sativa subsp. japonica GN=TIP3-2 PE=2 SV=2 123 290 6.0E-10
sp|A8W649|AQP5_PIG Aquaporin-5 OS=Sus scrofa GN=AQP5 PE=2 SV=1 119 291 7.0E-10
sp|Q9V5Z7|AQP_DROME Aquaporin OS=Drosophila melanogaster GN=Drip PE=2 SV=2 124 301 1.0E-09
sp|P09011|MIP_RAT Lens fiber major intrinsic protein (Fragment) OS=Rattus norvegicus GN=Mip PE=1 SV=2 64 290 1.0E-09
sp|P47864|AQP5_RAT Aquaporin-5 OS=Rattus norvegicus GN=Aqp5 PE=2 SV=1 119 291 3.0E-09
sp|Q866S3|AQP5_SHEEP Aquaporin-5 OS=Ovis aries GN=AQP5 PE=2 SV=1 119 296 4.0E-09
sp|Q9U8P7|AQPA_DICDI Aquaporin A OS=Dictyostelium discoideum GN=aqpA PE=2 SV=1 106 290 5.0E-09
sp|Q9ATL2|TIP51_MAIZE Aquaporin TIP5-1 OS=Zea mays GN=TIP5-1 PE=2 SV=1 70 302 5.0E-09
sp|P49173|NIP1_NICAL Probable aquaporin NIP-type OS=Nicotiana alata PE=2 SV=1 111 307 8.0E-09
sp|Q9STX9|TIP51_ARATH Probable aquaporin TIP5-1 OS=Arabidopsis thaliana GN=TIP5-1 PE=2 SV=1 107 290 9.0E-09
sp|O28846|AQPM_ARCFU Probable aquaporin AqpM OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=aqpM PE=1 SV=1 105 290 1.0E-08
sp|Q6RZ07|MIP_CAVPO Lens fiber major intrinsic protein OS=Cavia porcellus GN=MIP PE=1 SV=1 124 290 1.0E-08
sp|Q8LAI1|NIP71_ARATH Probable aquaporin NIP7-1 OS=Arabidopsis thaliana GN=NIP7-1 PE=2 SV=2 70 293 3.0E-08
sp|P42067|TIP1_MEDSA Probable aquaporin TIP-type OS=Medicago sativa GN=MCP1 PE=2 SV=2 113 282 6.0E-08
sp|Q8W036|NIP42_ARATH Probable aquaporin NIP4-2 OS=Arabidopsis thaliana GN=NIP4-2 PE=2 SV=2 105 282 6.0E-08
sp|Q7EYH7|NIP32_ORYSJ Aquaporin NIP3-2 OS=Oryza sativa subsp. japonica GN=NIP3-2 PE=2 SV=1 81 293 6.0E-08
sp|Q9FIZ9|NIP41_ARATH Putative aquaporin NIP4-1 OS=Arabidopsis thaliana GN=NIP4-1 PE=3 SV=1 105 284 7.0E-08
sp|P30301|MIP_HUMAN Lens fiber major intrinsic protein OS=Homo sapiens GN=MIP PE=1 SV=1 64 290 1.0E-07
sp|Q9WTY0|AQP6_RAT Aquaporin-6 OS=Rattus norvegicus GN=Aqp6 PE=1 SV=1 124 315 1.0E-07
sp|Q9ATN2|NIP22_MAIZE Aquaporin NIP2-2 OS=Zea mays GN=NIP2-2 PE=2 SV=1 70 293 1.0E-07
sp|Q88F17|AQPZ_PSEPK Aquaporin Z OS=Pseudomonas putida (strain KT2440) GN=aqpZ PE=3 SV=1 118 290 3.0E-07
sp|P56402|AQP2_MOUSE Aquaporin-2 OS=Mus musculus GN=Aqp2 PE=1 SV=2 116 290 5.0E-07
sp|O62735|AQP2_SHEEP Aquaporin-2 OS=Ovis aries GN=AQP2 PE=2 SV=1 99 295 6.0E-07
sp|Q9AT74|NIP23_MAIZE Aquaporin NIP2-3 OS=Zea mays GN=NIP2-3 PE=2 SV=1 70 293 6.0E-07
sp|P79099|AQP2_BOVIN Aquaporin-2 OS=Bos taurus GN=AQP2 PE=2 SV=2 99 295 7.0E-07
sp|P41181|AQP2_HUMAN Aquaporin-2 OS=Homo sapiens GN=AQP2 PE=1 SV=1 116 295 8.0E-07
sp|P34080|AQP2_RAT Aquaporin-2 OS=Rattus norvegicus GN=Aqp2 PE=1 SV=1 113 290 9.0E-07
sp|B7XIC4|AQP_ENTBH Aquaporin OS=Enterocytozoon bieneusi (strain H348) GN=AQP PE=3 SV=1 88 285 1.0E-06
sp|Q84S07|NIP33_ORYSJ Aquaporin NIP3-3 OS=Oryza sativa subsp. japonica GN=NIP3-3 PE=2 SV=1 81 293 2.0E-06
sp|Q8VZW1|NIP11_ARATH Aquaporin NIP1-1 OS=Arabidopsis thaliana GN=NIP1-1 PE=1 SV=1 82 284 2.0E-06
sp|Q67WJ8|NIP22_ORYSJ Aquaporin NIP2-2 OS=Oryza sativa subsp. japonica GN=NIP2-2 PE=2 SV=1 70 293 2.0E-06
sp|Q6Z2T3|NIP21_ORYSJ Aquaporin NIP2-1 OS=Oryza sativa subsp. japonica GN=NIP2-1 PE=1 SV=1 45 284 2.0E-06
sp|Q54V53|AQPC_DICDI Aquaporin C OS=Dictyostelium discoideum GN=wacA PE=2 SV=1 113 285 2.0E-06
sp|Q13520|AQP6_HUMAN Aquaporin-6 OS=Homo sapiens GN=AQP6 PE=2 SV=2 105 290 3.0E-06
sp|Q0IWF3|NIP31_ORYSJ Aquaporin NIP3-1 OS=Oryza sativa subsp. japonica GN=NIP3-1 PE=2 SV=2 116 304 3.0E-06
sp|Q9HWZ3|AQPZ_PSEAE Aquaporin Z OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=aqpZ PE=3 SV=1 104 290 4.0E-06
sp|P08995|NO26_SOYBN Nodulin-26 OS=Glycine max PE=1 SV=2 105 284 7.0E-06
sp|Q7XU31|TIP51_ORYSJ Probable aquaporin TIP5-1 OS=Oryza sativa subsp. japonica GN=TIP5;1 PE=2 SV=3 97 307 7.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0015267 channel activity Yes
GO:0055085 transmembrane transport Yes
GO:0016020 membrane Yes
GO:0008150 biological_process No
GO:0006810 transport No
GO:0003674 molecular_function No
GO:0051234 establishment of localization No
GO:0022803 passive transmembrane transporter activity No
GO:0022857 transmembrane transporter activity No
GO:0051179 localization No
GO:0005575 cellular_component No
GO:0005215 transporter activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 48 0.45

Transmembrane Domains

Domain # Start End Length
1 101 123 22
2 147 169 22
3 192 214 22
4 229 251 22
5 272 294 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|9059
MAETKDGGGRLPDAASGRSSGESSVEAKLHLASFEGSFVPSARPVEARTVPWFRDREYLVGGWRTASVWRSALVE
GVAAACLIYTSGQTAATLMSYESKQLGSYIGISSAVLLALFIYATAPATGGHINPMITFSSILAGLCPVSRGVLY
MCGQTIGAALAGGLLTGVWGRERSISVHGGGCFYDPAAMTAGRVFLAEVVGSFVLLYLSYGVGLDPRQAALFGPR
LGPLLVGVTLGLVSFSTSGVAPGYAGAQMNPARCFAFGIARRDLSDQWIWWFGPAAGSVLLAALYLAIPPHHAGR
EAARAGTKTIPRIRDTGV*
Coding >Hirsu2|9059
ATGGCCGAGACCAAGGACGGCGGCGGCCGGCTGCCGGACGCGGCGTCGGGCCGGAGCAGCGGCGAGTCGAGCGTC
GAGGCCAAGTTGCACCTGGCCTCGTTCGAGGGCTCGTTCGTGCCGTCGGCAAGGCCGGTCGAGGCGCGCACCGTG
CCGTGGTTCCGCGACCGCGAGTACCTGGTGGGCGGCTGGCGGACGGCGTCGGTGTGGCGCTCGGCGCTGGTCGAG
GGCGTGGCGGCCGCGTGCCTCATCTACACGTCGGGCCAGACGGCGGCGACGCTCATGAGCTACGAGTCCAAGCAG
CTGGGCTCGTACATCGGCATCTCCAGCGCCGTCCTGCTGGCGCTCTTCATCTACGCCACCGCGCCCGCCACTGGC
GGCCACATCAACCCCATGATCACCTTTTCCTCCATCCTGGCCGGCCTGTGTCCCGTCTCGCGAGGCGTGCTGTAC
ATGTGCGGCCAGACCATCGGCGCCGCTCTGGCCGGCGGCCTGTTGACGGGCGTCTGGGGCCGTGAGCGGTCCATC
AGCGTACACGGCGGCGGCTGCTTCTACGACCCGGCCGCCATGACGGCCGGGCGCGTCTTCCTGGCCGAGGTCGTC
GGCTCCTTCGTCCTGCTCTACCTCAGCTACGGCGTCGGCCTCGACCCGCGGCAGGCGGCCCTCTTCGGCCCGCGC
CTGGGCCCGCTGCTGGTCGGCGTCACGCTCGGCCTCGTGTCCTTTAGCACGAGCGGCGTCGCGCCCGGCTATGCT
GGCGCGCAGATGAACCCGGCGCGGTGCTTCGCCTTCGGCATCGCCAGGCGCGACTTGTCCGACCAGTGGATTTGG
TGGTTCGGGCCGGCCGCCGGCTCCGTCCTGCTGGCGGCGCTGTATCTGGCCATTCCGCCGCACCATGCCGGGCGG
GAGGCGGCGCGGGCGGGCACCAAGACCATACCGAGGATCCGCGATACGGGTGTGTGA
Transcript >Hirsu2|9059
ATGGCCGAGACCAAGGACGGCGGCGGCCGGCTGCCGGACGCGGCGTCGGGCCGGAGCAGCGGCGAGTCGAGCGTC
GAGGCCAAGTTGCACCTGGCCTCGTTCGAGGGCTCGTTCGTGCCGTCGGCAAGGCCGGTCGAGGCGCGCACCGTG
CCGTGGTTCCGCGACCGCGAGTACCTGGTGGGCGGCTGGCGGACGGCGTCGGTGTGGCGCTCGGCGCTGGTCGAG
GGCGTGGCGGCCGCGTGCCTCATCTACACGTCGGGCCAGACGGCGGCGACGCTCATGAGCTACGAGTCCAAGCAG
CTGGGCTCGTACATCGGCATCTCCAGCGCCGTCCTGCTGGCGCTCTTCATCTACGCCACCGCGCCCGCCACTGGC
GGCCACATCAACCCCATGATCACCTTTTCCTCCATCCTGGCCGGCCTGTGTCCCGTCTCGCGAGGCGTGCTGTAC
ATGTGCGGCCAGACCATCGGCGCCGCTCTGGCCGGCGGCCTGTTGACGGGCGTCTGGGGCCGTGAGCGGTCCATC
AGCGTACACGGCGGCGGCTGCTTCTACGACCCGGCCGCCATGACGGCCGGGCGCGTCTTCCTGGCCGAGGTCGTC
GGCTCCTTCGTCCTGCTCTACCTCAGCTACGGCGTCGGCCTCGACCCGCGGCAGGCGGCCCTCTTCGGCCCGCGC
CTGGGCCCGCTGCTGGTCGGCGTCACGCTCGGCCTCGTGTCCTTTAGCACGAGCGGCGTCGCGCCCGGCTATGCT
GGCGCGCAGATGAACCCGGCGCGGTGCTTCGCCTTCGGCATCGCCAGGCGCGACTTGTCCGACCAGTGGATTTGG
TGGTTCGGGCCGGCCGCCGGCTCCGTCCTGCTGGCGGCGCTGTATCTGGCCATTCCGCCGCACCATGCCGGGCGG
GAGGCGGCGCGGGCGGGCACCAAGACCATACCGAGGATCCGCGATACGGGTGTGTGA
Gene >Hirsu2|9059
ATGGCCGAGACCAAGGACGGCGGCGGCCGGCTGCCGGACGCGGCGTCGGGCCGGAGCAGCGGCGAGTCGAGCGTC
GAGGCCAAGTTGCACCTGGCCTCGTTCGAGGGCTCGTTCGTGCCGTCGGCAAGGCCGGTCGAGGCGCGCACCGTG
CCGTGGTTCCGCGACCGCGAGTACCTGGTGGGCGGCTGGCGGACGGCGTCGGTGTGGCGCTCGGCGGTGCGTCTC
TGTCGTTGCTGTTGCTGACGGTCCCTTGTTGTTGACGGACGGGGACAGCTGGTCGAGGGCGTGGCGGCCGCGTGC
CTCATCTACACGTCGGGCCAGACGGCGGCGACGCTCATGAGCTACGAGTCCAAGCAGCTGGGCTCGTACATCGGC
ATCTCCAGCGCCGTCCTGCTGGCGCTCTTCATCTACGCCACCGCGCCCGCCACTGGCGGCCACATCAACCCCATG
ATCACCTTTTCCTCCATCCTGGCCGGCCTGTGTCCCGTCTCGCGAGGTCTGTTTCTCCATTCCCCGGGTCCCGTG
AGCGAGGGGGGGGTAGCCGCCCAAGACAGAGGAGAGACTGAGGCGAGCGAAAGGCGTGCTGTACATGTGCGGCCA
GACCATCGGCGCCGCTCTGGCCGGCGGCCTGTTGACGGGCGTCTGGGGCCGTGAGCGGTCCATCAGGTATGGATG
AGAGAGAGAGGCCCGCCGATCCCGCTTCTTTGCATTGTGCTTCCTCCCCTTTGCTTCTTCTTCTTCCCTTGCTTT
TTCTTCTTCTCCTTCTTCTTCTCCCCCCCCTGGCTGACGGGAGAGGGGGGAAAAAAGCGTACACGGCGGCGGCTG
CTTCTACGACCCGGCCGCCATGACGGCCGGGCGCGTCTTCCTGGCCGAGGTCGTCGGCTCCTTCGTCCTGCTCTA
CCTCAGCTACGGCGTCGGCCTCGACCCGCGGCAGGCGGCCCTCTTCGGCCCGCGCCTGGGCCCGCTGCTGGTCGG
CGTCACGCTCGGCCTCGTGTCCTTTAGCACGAGCGGCGTCGCGCCCGGCTATGCTGGCGCGCAGATGAACCCGGC
GCGGTGCTTCGCCTTCGGCATCGCCAGGCGCGACTTGTCCGGTGAGTCGCTTGATCGGTCGCCGCGTGAGACGGC
GAGGGAGAGGCGGAGTCTAAGGGCGCGGCGAGCTGACGATGGTCGTGGGCGGCCGACAGACCAGTGGATTTGGTG
GTTCGGGCCGGCCGCCGGCTCCGTCCTGCTGGCGGCGCTGTATCTGGCCATTCCGCCGCACCATGCCGGGCGGGA
GGCGGCGCGGGCGGGCACCAAGACCATACCGAGGATCCGCGATACGGGTGTGTGA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail