Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|9054
Gene name
LocationContig_632:317..1348
Strand-
Gene length (bp)1031
Transcript length (bp)915
Coding sequence length (bp)915
Protein length (aa) 305

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04818 CID CID domain 4.2E-24 37 165

Swissprot hits

(None)

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm|Nucleus Nuclear localization signal 0.6027 0.6895 0.2377 0.0116 0.0422 0.0587 0.058 0.084 0.1198 0.0026

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup4378
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|5403
Ophiocordyceps australis map64 (Brazil) OphauB2|1865
Ophiocordyceps camponoti-floridani Ophcf2|03505
Ophiocordyceps camponoti-rufipedis Ophun1|5554
Ophiocordyceps kimflemingae Ophio5|7544
Ophiocordyceps subramaniannii Hirsu2|9054 (this protein)

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|9054
MVTTPDLAIAKAALTATLLRADPTSLSRAAIAEFLQLLDNTLDECSRPNVQKCKNWIVANAAASSGRNATLGKYL
VALSESMETDFDRPSVRRRRLHVLYVASDVLHHVVTRQGLRDFSRAWEAHLPAVVAAASTFEKYPRHLAKVRDLI
ALWEERAYVPPALVTRIREAFTRASDKDSGTRIQMSSEALKLAKEAPFVLPASHGDASAPWSDLPAASWLAHLDP
NSAMPMSRSLLRPIQLRPGPAKEALAKLVKATLSDADDLYRKGRLQERAAVDFTLLGEMRKPREASSATGLADAN
TEVP*
Coding >Hirsu2|9054
ATGGTGACGACTCCGGACCTCGCCATCGCCAAGGCCGCGCTCACGGCCACGCTTCTTCGCGCCGATCCCACGTCG
CTGAGTCGCGCCGCCATCGCCGAGTTCCTGCAGCTGCTCGACAACACGCTGGACGAGTGTTCGCGTCCCAACGTT
CAGAAATGTAAGAACTGGATTGTCGCCAACGCGGCGGCCTCGAGTGGCCGGAATGCCACCCTGGGCAAGTATCTC
GTCGCTCTCTCCGAGAGCATGGAGACGGACTTTGACCGGCCGAGCGTCCGCCGCCGGAGGCTGCACGTGCTCTAC
GTCGCCAGCGATGTGCTGCACCACGTCGTCACCCGCCAGGGGCTCCGTGACTTCTCCCGGGCCTGGGAGGCTCAC
CTGCCCGCCGTCGTGGCCGCCGCCTCCACCTTCGAAAAGTACCCCAGGCACTTGGCCAAGGTGCGTGACCTGATT
GCGCTCTGGGAGGAGCGTGCCTACGTCCCGCCCGCCCTCGTGACCCGGATCCGAGAAGCCTTCACCCGTGCCTCG
GACAAGGACTCGGGAACCCGCATCCAGATGTCCTCCGAGGCCCTCAAGCTCGCCAAGGAGGCCCCCTTCGTCCTC
CCCGCCTCGCACGGCGACGCCTCGGCGCCCTGGAGCGACCTGCCCGCCGCCTCCTGGCTGGCGCATCTGGATCCC
AACTCTGCCATGCCCATGAGCCGCTCTCTGCTGCGCCCCATCCAGCTCAGGCCGGGGCCTGCCAAGGAGGCGCTG
GCCAAGCTGGTCAAGGCCACGCTCTCGGACGCCGACGACCTGTACCGAAAGGGGCGCCTGCAGGAGAGGGCGGCC
GTCGACTTCACCCTCCTCGGCGAGATGCGCAAGCCGCGCGAGGCGTCCTCGGCCACGGGCCTTGCCGACGCCAAC
ACAGAAGTGCCATGA
Transcript >Hirsu2|9054
ATGGTGACGACTCCGGACCTCGCCATCGCCAAGGCCGCGCTCACGGCCACGCTTCTTCGCGCCGATCCCACGTCG
CTGAGTCGCGCCGCCATCGCCGAGTTCCTGCAGCTGCTCGACAACACGCTGGACGAGTGTTCGCGTCCCAACGTT
CAGAAATGTAAGAACTGGATTGTCGCCAACGCGGCGGCCTCGAGTGGCCGGAATGCCACCCTGGGCAAGTATCTC
GTCGCTCTCTCCGAGAGCATGGAGACGGACTTTGACCGGCCGAGCGTCCGCCGCCGGAGGCTGCACGTGCTCTAC
GTCGCCAGCGATGTGCTGCACCACGTCGTCACCCGCCAGGGGCTCCGTGACTTCTCCCGGGCCTGGGAGGCTCAC
CTGCCCGCCGTCGTGGCCGCCGCCTCCACCTTCGAAAAGTACCCCAGGCACTTGGCCAAGGTGCGTGACCTGATT
GCGCTCTGGGAGGAGCGTGCCTACGTCCCGCCCGCCCTCGTGACCCGGATCCGAGAAGCCTTCACCCGTGCCTCG
GACAAGGACTCGGGAACCCGCATCCAGATGTCCTCCGAGGCCCTCAAGCTCGCCAAGGAGGCCCCCTTCGTCCTC
CCCGCCTCGCACGGCGACGCCTCGGCGCCCTGGAGCGACCTGCCCGCCGCCTCCTGGCTGGCGCATCTGGATCCC
AACTCTGCCATGCCCATGAGCCGCTCTCTGCTGCGCCCCATCCAGCTCAGGCCGGGGCCTGCCAAGGAGGCGCTG
GCCAAGCTGGTCAAGGCCACGCTCTCGGACGCCGACGACCTGTACCGAAAGGGGCGCCTGCAGGAGAGGGCGGCC
GTCGACTTCACCCTCCTCGGCGAGATGCGCAAGCCGCGCGAGGCGTCCTCGGCCACGGGCCTTGCCGACGCCAAC
ACAGAAGTGCCATGA
Gene >Hirsu2|9054
ATGGTGACGACTCCGGACCTCGCCATCGCCAAGGCCGCGCTCACGGCCACGCTTCTTCGCGCCGATCCCACGTCG
CTGAGTCGCGCCGCCATCGCCGAGTTCCTGCAGCTGCTCGACAACACGCTGGACGAGTGTTCGCGTCCCAACGTT
CAGGTTTGCTTCATGGCTCGACAGCCGCACCCGTTCGCCCTGGCCTGTTGACTAAATTGGACCCGCACAGAAATG
TAAGAACTGGATTGTCGCCAACGCGGCGGCCTCGAGTGGCCGGAATGCCACCCTGGGCAAGTATCTCGTCGCTCT
CTCCGAGAGCATGGAGACGGACTTTGACCGGCCGAGCGTCCGCCGCCGGAGGCTGCACGTGCTCTACGTCGCCAG
CGATGTGCTGCACCACGTCGTCACCCGCCAGGGGCTCCGTGACTTCTCCCGGGCCTGGGAGGCTCACCTGCCCGC
CGTCGTGGCCGCCGCCTCCACCTTCGAAAAGTACCCCAGGCACTTGGCCAAGGTGCGTGACCTGATTGCGCTCTG
GGAGGAGCGTGCCTACGTCCCGCCCGCCCTCGTGACCCGGATCCGAGAAGCCTTCACCCGTGCCTCGGACAAGGA
CTCGGGAACCCGCATCCAGATGTCCTCCGAGGCCCTCAAGCTCGCCAAGGAGGCCCCCTTCGTCCTCCCCGCCTC
GCACGGCGACGCCTCGGCGCCCTGGAGCGACCTGCCCGCCGCCTCCTGGCTGGCGCATCTGGATCCCAACTCTGC
CATGCCCATGAGCCGCTCTCTGCTGCGCCCCATCCAGCTCAGGCCGGGGCCTGCCAAGGAGGCGCTGGCCAAGCT
GGTCAAGGCCACGCTCTCGGACGCCGACGACCTGTACCGAAAGGGGCGCCTGCAGGAGAGGGCGGCCGTCGACTT
CACCCTCCTCGGCGAGATGCGCAAGCCGCGCGAGGCGTCCTCGGCCACGGGCCTTGCCGACGCCAACACGTACTG
GGGCTGGTCGCCGCAGCTCTGCTGCCGCATGAAGGAGCGGCAGAGAAGTGCCATGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail