Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|9047
Gene name
LocationContig_630:4627..5755
Strand+
Gene length (bp)1128
Transcript length (bp)933
Coding sequence length (bp)933
Protein length (aa) 311

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01670 Glyco_hydro_12 Glycosyl hydrolase family 12 9.2E-20 66 307

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|G4NAZ1|CE12A_MAGO7 Endoglucanase cel12A OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=cel12A PE=1 SV=1 64 308 2.0E-07
sp|A1CRJ0|XGEA_ASPCL Probable xyloglucan-specific endo-beta-1,4-glucanase A OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=xgeA PE=3 SV=1 76 305 7.0E-07
sp|Q2UK93|XGEA_ASPOR Probable xyloglucan-specific endo-beta-1,4-glucanase A OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=xgeA PE=3 SV=1 66 307 5.0E-06
sp|B8N3L3|XGEA_ASPFN Probable xyloglucan-specific endo-beta-1,4-glucanase A OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=xgeA PE=3 SV=1 66 307 5.0E-06
sp|P22669|GUN_ASPAC Endoglucanase-1 OS=Aspergillus aculeatus PE=1 SV=1 64 308 5.0E-06

GO

GO Term Description Terminal node
GO:0008810 cellulase activity Yes
GO:0000272 polysaccharide catabolic process Yes
GO:0008152 metabolic process No
GO:0016052 carbohydrate catabolic process No
GO:0008150 biological_process No
GO:0009057 macromolecule catabolic process No
GO:0043170 macromolecule metabolic process No
GO:0005976 polysaccharide metabolic process No
GO:0003674 molecular_function No
GO:0071704 organic substance metabolic process No
GO:0016798 hydrolase activity, acting on glycosyl bonds No
GO:0009056 catabolic process No
GO:0005975 carbohydrate metabolic process No
GO:0044238 primary metabolic process No
GO:0003824 catalytic activity No
GO:1901575 organic substance catabolic process No
GO:0004553 hydrolase activity, hydrolyzing O-glycosyl compounds No
GO:0016787 hydrolase activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 21 0.5

Transmembrane Domains

Domain # Start End Length
1 5 27 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|9047
MFRWLVNVGFLALPVAATLGILLGLQMHRQSTGQAPLFGPPRDNKRVEKTYCQKSFGIHPDTRGLEYTLNPNQWA
WDEGDPGFLCMNVTTNNNQTYASQTTAPPFRVFWQYPQATDGQPVHAFPNIKVEGDVLPAKLDSVKQMNIDMQWI
MRLDNKTDAPTDVDELQTGNVNSNVAIDMFMDSDKSKAADSERAAYEVMVWFAAVGPATFAIGQKKGPIMSKILD
GAHFYLYFDKNDRGQNVLTWKSSDIAHDFHGDISPLMNEILRTRREGFPSPSDYLGYFSFGSEAYHSDKPVTFSV
PSLSIDIRKS*
Coding >Hirsu2|9047
ATGTTCCGCTGGCTCGTCAACGTCGGCTTCCTGGCCCTGCCAGTGGCCGCCACGCTGGGCATCCTGCTGGGCCTC
CAGATGCACCGCCAGTCCACCGGCCAGGCGCCGCTGTTCGGCCCGCCGCGGGACAACAAGAGGGTCGAGAAGACG
TATTGTCAGAAGTCGTTTGGCATCCACCCCGACACGAGGGGCCTGGAATACACCCTAAACCCCAACCAATGGGCT
TGGGACGAGGGCGACCCGGGCTTCCTGTGTATGAATGTGACGACGAACAACAACCAGACGTATGCGTCCCAGACG
ACGGCGCCGCCGTTCCGAGTCTTCTGGCAATATCCCCAGGCCACCGACGGCCAGCCCGTGCACGCCTTCCCCAAC
ATCAAGGTCGAGGGCGACGTGCTGCCGGCCAAGCTCGACAGCGTCAAGCAGATGAACATCGACATGCAGTGGATC
ATGCGCCTCGACAACAAGACGGACGCCCCGACCGACGTCGACGAGCTGCAGACGGGCAACGTCAACTCCAACGTC
GCCATCGACATGTTCATGGACAGCGACAAGTCCAAGGCGGCCGACAGCGAGCGCGCCGCCTACGAAGTCATGGTC
TGGTTCGCCGCCGTCGGCCCGGCCACCTTTGCCATTGGCCAGAAAAAAGGCCCCATCATGTCCAAGATCCTGGAC
GGAGCCCACTTTTATCTGTACTTTGACAAGAATGACCGGGGCCAGAACGTCCTGACCTGGAAATCGTCCGACATC
GCCCACGACTTCCACGGCGACATCTCGCCCCTCATGAATGAGATTCTGCGCACCCGGAGGGAGGGCTTCCCCAGC
CCCTCGGACTACCTCGGATACTTTAGTTTTGGCTCCGAAGCATACCACTCCGACAAGCCCGTCACATTTTCTGTA
CCATCCCTGTCAATAGACATTCGCAAATCTTGA
Transcript >Hirsu2|9047
ATGTTCCGCTGGCTCGTCAACGTCGGCTTCCTGGCCCTGCCAGTGGCCGCCACGCTGGGCATCCTGCTGGGCCTC
CAGATGCACCGCCAGTCCACCGGCCAGGCGCCGCTGTTCGGCCCGCCGCGGGACAACAAGAGGGTCGAGAAGACG
TATTGTCAGAAGTCGTTTGGCATCCACCCCGACACGAGGGGCCTGGAATACACCCTAAACCCCAACCAATGGGCT
TGGGACGAGGGCGACCCGGGCTTCCTGTGTATGAATGTGACGACGAACAACAACCAGACGTATGCGTCCCAGACG
ACGGCGCCGCCGTTCCGAGTCTTCTGGCAATATCCCCAGGCCACCGACGGCCAGCCCGTGCACGCCTTCCCCAAC
ATCAAGGTCGAGGGCGACGTGCTGCCGGCCAAGCTCGACAGCGTCAAGCAGATGAACATCGACATGCAGTGGATC
ATGCGCCTCGACAACAAGACGGACGCCCCGACCGACGTCGACGAGCTGCAGACGGGCAACGTCAACTCCAACGTC
GCCATCGACATGTTCATGGACAGCGACAAGTCCAAGGCGGCCGACAGCGAGCGCGCCGCCTACGAAGTCATGGTC
TGGTTCGCCGCCGTCGGCCCGGCCACCTTTGCCATTGGCCAGAAAAAAGGCCCCATCATGTCCAAGATCCTGGAC
GGAGCCCACTTTTATCTGTACTTTGACAAGAATGACCGGGGCCAGAACGTCCTGACCTGGAAATCGTCCGACATC
GCCCACGACTTCCACGGCGACATCTCGCCCCTCATGAATGAGATTCTGCGCACCCGGAGGGAGGGCTTCCCCAGC
CCCTCGGACTACCTCGGATACTTTAGTTTTGGCTCCGAAGCATACCACTCCGACAAGCCCGTCACATTTTCTGTA
CCATCCCTGTCAATAGACATTCGCAAATCTTGA
Gene >Hirsu2|9047
ATGTTCCGCTGGCTCGTCAACGTCGGCTTCCTGGCCCTGCCAGTGGCCGCCACGCTGGGCATCCTGCTGGGCCTC
CAGATGCACCGCCAGTCCACCGGCCAGGCGCCGCTGTTCGGCCCGCCGCGGGACAACAAGAGGGTCGAGAAGACG
TATTGTCAGAAGTCGTTTGGCATCCACCCCGACACGAGGGGCCTGGAATACACCCGTCCGTCTCCCCCATCTTCC
TCCGTCGCCTGGATTGCGCTGACCCGGCCGATGCTGCAGTAAACCCCAACCAATGGGCTTGGGACGAGGGCGACC
CGGGCTTCCTGTGTATGAATGTGCGTGCAGAGGCCCCCCCCCTTGACCCCCTCGATGAGGCCGTGCTCAGACTCT
TCAGGTGACGACGAACAACAACCAGACGTATGCGTCCCAGACGACGGCGCCGCCGTTCCGAGTCTTCTGGCAATA
TCCCCAGGCCACCGACGGCCAGCCCGTGCACGCCTTCCCCAACATCAAGGTCGAGGGCGACGTGCTGCCGGCCAA
GCTCGACAGCGTCAAGCAGATGAACATCGACATGCAGTGGATCATGCGCCTCGACAACAAGACGGACGCCCCGAC
CGACGTCGACGAGCTGCAGACGGGCAACGTCAACTCCAACGTCGCCATCGACATGTTCATGGACAGCGACAAGTC
CAAGGCGGCCGACAGCGAGCGCGCCGCCTACGAAGTCATGGTCTGGTTCGCCGCCGTCGGCCCGGCCACCTTTGC
CATTGGCCAGAAAAAAGGCCCCATCATGTCCAAGATCCTGGACGGAGCCCACTTGTACGGCCGCCCCGTCCGCCC
GCCCCCCCTCCCGTGCCCGTGCCGCGCCGGACGCTGACGATGCCTCCGCCCCGAAGTTATCTGTACTTTGACAAG
AATGACCGGGGCCAGAACGTCCTGACCTGGAAATCGTCCGACATCGCCCACGACTTCCACGGCGACATCTCGCCC
CTCATGAATGAGATTCTGCGCACCCGGAGGGAGGGCTTCCCCAGCCCCTCGGACTACCTCGGATACTTTAGTTTT
GGCTCCGAAGCATACCACTCCGACAAGCCCGTCACATTTTCTGTACCATCCCTGTCAATAGACATTCGCAAATCT
TGA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail