Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|9042
Gene name
LocationContig_63:38322..39369
Strand-
Gene length (bp)1047
Transcript length (bp)936
Coding sequence length (bp)936
Protein length (aa) 312

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O94348|YIP1_SCHPO Protein transport protein yip1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=yip1 PE=3 SV=1 81 296 2.0E-64
sp|Q54QY3|YIPF5_DICDI Protein YIPF5 homolog OS=Dictyostelium discoideum GN=yipf5 PE=3 SV=1 91 294 2.0E-46
sp|Q5R6W5|YIPF5_PONAB Protein YIPF5 OS=Pongo abelii GN=YIPF5 PE=2 SV=1 25 294 5.0E-45
sp|Q969M3|YIPF5_HUMAN Protein YIPF5 OS=Homo sapiens GN=YIPF5 PE=1 SV=1 25 294 5.0E-45
sp|Q4R5M4|YIPF5_MACFA Protein YIPF5 OS=Macaca fascicularis GN=YIPF5 PE=2 SV=1 25 294 6.0E-45
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O94348|YIP1_SCHPO Protein transport protein yip1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=yip1 PE=3 SV=1 81 296 2.0E-64
sp|Q54QY3|YIPF5_DICDI Protein YIPF5 homolog OS=Dictyostelium discoideum GN=yipf5 PE=3 SV=1 91 294 2.0E-46
sp|Q5R6W5|YIPF5_PONAB Protein YIPF5 OS=Pongo abelii GN=YIPF5 PE=2 SV=1 25 294 5.0E-45
sp|Q969M3|YIPF5_HUMAN Protein YIPF5 OS=Homo sapiens GN=YIPF5 PE=1 SV=1 25 294 5.0E-45
sp|Q4R5M4|YIPF5_MACFA Protein YIPF5 OS=Macaca fascicularis GN=YIPF5 PE=2 SV=1 25 294 6.0E-45
sp|Q5E9E8|YIPF5_BOVIN Protein YIPF5 OS=Bos taurus GN=YIPF5 PE=2 SV=1 25 294 6.0E-45
sp|Q6P5I8|YIPF5_DANRE Protein YIPF5 OS=Danio rerio GN=yipf5 PE=2 SV=1 94 294 3.0E-43
sp|Q66KA5|YIPF5_XENTR Protein YIPF5 OS=Xenopus tropicalis GN=yipf5 PE=2 SV=1 94 294 6.0E-43
sp|Q7SXS2|YIPF5_XENLA Protein YIPF5 OS=Xenopus laevis GN=yipf5 PE=2 SV=1 94 294 7.0E-43
sp|P53039|YIP1_YEAST Protein transport protein YIP1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YIP1 PE=1 SV=1 81 294 3.0E-41
sp|Q9JIM5|YIPF7_MOUSE Protein YIPF7 OS=Mus musculus GN=Yipf7 PE=2 SV=1 90 294 6.0E-40
sp|Q8N8F6|YIPF7_HUMAN Protein YIPF7 OS=Homo sapiens GN=YIPF7 PE=2 SV=2 91 294 1.0E-39
sp|Q9EQQ2|YIPF5_MOUSE Protein YIPF5 OS=Mus musculus GN=Yipf5 PE=1 SV=1 21 294 6.0E-37
sp|Q5XID0|YIPF5_RAT Protein YIPF5 OS=Rattus norvegicus GN=Yipf5 PE=2 SV=1 21 294 7.0E-37
sp|A5D7K7|YIPF7_BOVIN Protein YIPF7 OS=Bos taurus GN=YIPF7 PE=2 SV=1 105 294 3.0E-33
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 16 0.45

Transmembrane Domains

Domain # Start End Length
1 135 152 17
2 157 179 22
3 218 237 19
4 244 266 22
5 276 298 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|9042
MSSFYGAQANNPSYGAPPAGAGAQNLQFYSSSYAPAVSGSATPHQAAYGYGGGGGGGGGAQAGFSSASFGVSGRM
GEQGGLRTGWLAAFSTEGYDGEPPLWEELGVNFAHIQKKTLAVLNPFRHIDQHLMDDSDLAGPILFFLLFGTFLL
FSGKVHFGYIYGLALLGSTSLHMILSLMSPSEPQSSQSFHPQYSEPPAQSHMQHGGHFSATLTFPRSASVLGYCL
LPLVATSLFGVVMPMDTPIGIVLTTAAIVWCTYSASGMFCAVGRMRGMRGLVAYPLALFYVGFGIIGIFSSRGSG
SLANAAAKLNT*
Coding >Hirsu2|9042
ATGTCGAGCTTCTACGGCGCGCAGGCCAACAACCCGTCCTACGGGGCACCCCCCGCCGGAGCCGGCGCCCAGAAC
CTGCAGTTCTACTCGTCGTCGTACGCCCCGGCCGTCTCCGGCTCTGCCACGCCGCACCAGGCTGCCTATGGCTAC
GGCGGCGGCGGCGGTGGCGGCGGCGGCGCCCAGGCCGGCTTCTCCTCCGCCAGCTTCGGCGTCTCCGGCCGCATG
GGCGAGCAGGGCGGGCTGCGGACCGGCTGGCTGGCAGCCTTTTCCACCGAAGGCTACGACGGGGAGCCGCCGCTG
TGGGAGGAGCTGGGCGTCAACTTTGCTCACATCCAAAAGAAGACGCTGGCTGTCCTCAACCCCTTCAGACACATC
GATCAGCACCTGATGGACGACTCCGACCTGGCCGGCCCCATCCTCTTCTTCCTGCTCTTCGGCACCTTCCTTCTG
TTTTCCGGCAAGGTCCATTTCGGCTACATCTACGGCCTGGCCCTCCTCGGCTCGACATCACTGCACATGATCCTG
TCGCTCATGTCGCCGTCGGAGCCGCAGAGCTCGCAGTCCTTCCACCCGCAGTACAGCGAGCCGCCCGCCCAGTCG
CATATGCAGCATGGCGGCCACTTCTCTGCGACGCTCACCTTCCCCCGCTCCGCCTCCGTGCTCGGCTACTGCCTC
CTGCCCCTCGTCGCCACCAGCCTGTTCGGCGTCGTCATGCCCATGGACACGCCCATCGGAATCGTCCTGACGACC
GCCGCCATCGTCTGGTGCACGTACAGCGCCAGCGGCATGTTCTGCGCCGTCGGCCGCATGAGGGGCATGAGGGGC
CTGGTCGCCTACCCCCTGGCCCTCTTCTACGTCGGCTTCGGCATCATCGGCATCTTCAGCAGCCGGGGCAGCGGT
TCGCTCGCCAACGCCGCCGCCAAGCTCAACACCTGA
Transcript >Hirsu2|9042
ATGTCGAGCTTCTACGGCGCGCAGGCCAACAACCCGTCCTACGGGGCACCCCCCGCCGGAGCCGGCGCCCAGAAC
CTGCAGTTCTACTCGTCGTCGTACGCCCCGGCCGTCTCCGGCTCTGCCACGCCGCACCAGGCTGCCTATGGCTAC
GGCGGCGGCGGCGGTGGCGGCGGCGGCGCCCAGGCCGGCTTCTCCTCCGCCAGCTTCGGCGTCTCCGGCCGCATG
GGCGAGCAGGGCGGGCTGCGGACCGGCTGGCTGGCAGCCTTTTCCACCGAAGGCTACGACGGGGAGCCGCCGCTG
TGGGAGGAGCTGGGCGTCAACTTTGCTCACATCCAAAAGAAGACGCTGGCTGTCCTCAACCCCTTCAGACACATC
GATCAGCACCTGATGGACGACTCCGACCTGGCCGGCCCCATCCTCTTCTTCCTGCTCTTCGGCACCTTCCTTCTG
TTTTCCGGCAAGGTCCATTTCGGCTACATCTACGGCCTGGCCCTCCTCGGCTCGACATCACTGCACATGATCCTG
TCGCTCATGTCGCCGTCGGAGCCGCAGAGCTCGCAGTCCTTCCACCCGCAGTACAGCGAGCCGCCCGCCCAGTCG
CATATGCAGCATGGCGGCCACTTCTCTGCGACGCTCACCTTCCCCCGCTCCGCCTCCGTGCTCGGCTACTGCCTC
CTGCCCCTCGTCGCCACCAGCCTGTTCGGCGTCGTCATGCCCATGGACACGCCCATCGGAATCGTCCTGACGACC
GCCGCCATCGTCTGGTGCACGTACAGCGCCAGCGGCATGTTCTGCGCCGTCGGCCGCATGAGGGGCATGAGGGGC
CTGGTCGCCTACCCCCTGGCCCTCTTCTACGTCGGCTTCGGCATCATCGGCATCTTCAGCAGCCGGGGCAGCGGT
TCGCTCGCCAACGCCGCCGCCAAGCTCAACACCTGA
Gene >Hirsu2|9042
ATGTCGAGCTTCTACGGCGCGCAGGCCAACAACCCGTCCTACGGGGCACCCCCCGCCGGAGCCGGCGCCCAGAAC
CTGCAGTTCTACTCGTCGTCGTACGCCCCGGCCGTCTCCGGCTCTGCCACGCCGCACCAGGCTGCCTATGGCTAC
GGCGGCGGCGGCGGTGGCGGCGGCGGCGCCCAGGCCGGCTTCTCCTCCGCCAGCTTCGGCGTCTCCGGCCGCATG
GGCGAGCAGGGCGGGCTGCGGACCGGCTGGCTGGCAGCCTTTTCCACCGAAGGCTACGACGGGGAGCCGCCGCTG
TGGGAGGAGCTGGGCGTCAACTTTGCTCACATCCAAAAGAAGGTCGGCATGACTCCTCTGGCTGGCTCGGACTCT
TCCCCCCTTTCGATGTCCCTTCGGGCACCTCCAGCTCCATCGAAAAGTTGCTGCTGCTAACCGGATGTTGCTGCG
CAGACGCTGGCTGTCCTCAACCCCTTCAGACACATCGATCAGCACCTGATGGACGACTCCGACCTGGCCGGCCCC
ATCCTCTTCTTCCTGCTCTTCGGCACCTTCCTTCTGTTTTCCGGCAAGGTCCATTTCGGCTACATCTACGGCCTG
GCCCTCCTCGGCTCGACATCACTGCACATGATCCTGTCGCTCATGTCGCCGTCGGAGCCGCAGAGCTCGCAGTCC
TTCCACCCGCAGTACAGCGAGCCGCCCGCCCAGTCGCATATGCAGCATGGCGGCCACTTCTCTGCGACGCTCACC
TTCCCCCGCTCCGCCTCCGTGCTCGGCTACTGCCTCCTGCCCCTCGTCGCCACCAGCCTGTTCGGCGTCGTCATG
CCCATGGACACGCCCATCGGAATCGTCCTGACGACCGCCGCCATCGTCTGGTGCACGTACAGCGCCAGCGGCATG
TTCTGCGCCGTCGGCCGCATGAGGGGCATGAGGGGCCTGGTCGCCTACCCCCTGGCCCTCTTCTACGTCGGCTTC
GGCATCATCGGCATCTTCAGCAGCCGGGGCAGCGGTTCGCTCGCCAACGCCGCCGCCAAGCTCAACACCTGA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail