Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|9039
Gene name
LocationContig_63:21835..23644
Strand-
Gene length (bp)1809
Transcript length (bp)1671
Coding sequence length (bp)1671
Protein length (aa) 557

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07690 MFS_1 Major Facilitator Superfamily 5.8E-33 113 481

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9P6J0|YHDC_SCHPO Uncharacterized transporter C1683.12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1683.12 PE=3 SV=1 93 527 5.0E-63
sp|Q9US44|YIZG_SCHPO Uncharacterized transporter C1002.16c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1002.16c PE=3 SV=1 96 546 2.0E-58
sp|P53322|TNA1_YEAST High-affinity nicotinic acid transporter OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TNA1 PE=1 SV=1 66 554 8.0E-56
sp|Q9US37|YFZ4_SCHPO Uncharacterized transporter C1039.04 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1039.04 PE=3 SV=1 93 554 1.0E-55
sp|Q10097|YAOI_SCHPO Uncharacterized transporter C11D3.18C OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC11D3.18c PE=3 SV=1 68 545 2.0E-54
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9P6J0|YHDC_SCHPO Uncharacterized transporter C1683.12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1683.12 PE=3 SV=1 93 527 5.0E-63
sp|Q9US44|YIZG_SCHPO Uncharacterized transporter C1002.16c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1002.16c PE=3 SV=1 96 546 2.0E-58
sp|P53322|TNA1_YEAST High-affinity nicotinic acid transporter OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TNA1 PE=1 SV=1 66 554 8.0E-56
sp|Q9US37|YFZ4_SCHPO Uncharacterized transporter C1039.04 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1039.04 PE=3 SV=1 93 554 1.0E-55
sp|Q10097|YAOI_SCHPO Uncharacterized transporter C11D3.18C OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC11D3.18c PE=3 SV=1 68 545 2.0E-54
sp|O94491|YC7A_SCHPO Uncharacterized transporter C417.10 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC417.10 PE=3 SV=1 93 554 5.0E-37
sp|Q44470|TUB4_AGRVI Putative tartrate transporter OS=Agrobacterium vitis GN=ttuB PE=2 SV=1 97 533 9.0E-35
sp|O74923|YJ7D_SCHPO Uncharacterized transporter C757.13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC757.13 PE=3 SV=1 54 555 3.0E-34
sp|P76470|RHMT_ECOLI Inner membrane transport protein RhmT OS=Escherichia coli (strain K12) GN=rhmT PE=1 SV=2 108 481 3.0E-33
sp|P70786|TUB3_AGRVI Putative tartrate transporter OS=Agrobacterium vitis GN=ttuB PE=2 SV=1 97 317 4.0E-33
sp|O94572|YGDF_SCHPO Uncharacterized transporter C1773.15 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1773.15 PE=3 SV=1 66 554 6.0E-32
sp|P15365|DAL5_YEAST Allantoate permease OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DAL5 PE=1 SV=1 53 554 2.0E-30
sp|P40445|YIQ6_YEAST Uncharacterized transporter YIL166C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YIL166C PE=1 SV=1 53 546 8.0E-28
sp|Q88FY6|NICT_PSEPK Putative metabolite transport protein NicT OS=Pseudomonas putida (strain KT2440) GN=nicT PE=2 SV=1 98 304 9.0E-27
sp|P39709|SEO1_YEAST Probable transporter SEO1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SEO1 PE=1 SV=1 72 529 5.0E-26
sp|O43000|LIZ1_SCHPO Pantothenate transporter liz1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=liz1 PE=2 SV=2 97 311 1.0E-25
sp|B5BP49|YP55_SCHPO Uncharacterized transporter C460.05 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC460.05 PE=3 SV=1 53 527 3.0E-25
sp|P25621|FEN2_YEAST Pantothenate transporter FEN2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FEN2 PE=1 SV=1 94 527 6.0E-22
sp|Q05181|PHT1_PSEPU Phthalate transporter OS=Pseudomonas putida GN=pht1 PE=3 SV=1 80 422 2.0E-19
sp|Q07904|THI73_YEAST Thiamine pathway transporter THI73 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=THI73 PE=1 SV=1 65 549 3.0E-17
sp|P53241|VHT1_YEAST Vitamin H transporter OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VHT1 PE=1 SV=1 96 330 3.0E-17
sp|Q9C0V8|YHJ1_SCHPO Uncharacterized transporter PB10D8.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBPB10D8.01 PE=3 SV=1 58 354 3.0E-15
sp|O13880|VHT1_SCHPO Vitamin H transporter 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=vht1 PE=2 SV=1 98 283 3.0E-14
sp|Q9C0U9|YQD3_SCHPO Uncharacterized transporter PB1C11.03 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCPB1C11.03 PE=1 SV=1 97 354 9.0E-14
sp|O13879|YE1F_SCHPO Uncharacterized transporter C1B3.15C OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1B3.15c PE=3 SV=1 99 525 2.0E-12
sp|Q12235|YCT1_YEAST High affinity cysteine transporter OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YCT1 PE=1 SV=1 53 313 6.0E-10
sp|P0CF20|YO163_YEAST Putative uncharacterized transporter YOL163W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YOL163W PE=5 SV=1 203 311 4.0E-09
sp|Q0K843|SAUU_CUPNH Probable sulfoacetate transporter SauU OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=sauU PE=2 SV=1 99 303 2.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0016021 integral component of membrane Yes
GO:0055085 transmembrane transport Yes
GO:0031224 intrinsic component of membrane No
GO:0008150 biological_process No
GO:0006810 transport No
GO:0051179 localization No
GO:0051234 establishment of localization No
GO:0044425 membrane part No
GO:0005575 cellular_component No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 32 0.45

Transmembrane Domains

Domain # Start End Length
1 106 125 19
2 145 167 22
3 174 196 22
4 200 222 22
5 234 256 22
6 266 288 22
7 335 357 22
8 377 399 22
9 406 425 19
10 429 451 22
11 464 486 22
12 501 518 17

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|9039
LRSNSTLLKADDGGGGGGGGGASPSLLPLPPPAAPGCRLGAAAVMAKPGRRPSEAELPIGSVEALDDASSLHRAA
ERGRAATDKYGEPLLRYDAAAERRLRFKIDLCIIPTVSILYLFCFIDRANLGNAKIAGLDKDLGLKGYDYNSVIS
VFYISYILFEIPCNILCKWMGPGWFLPLTAVLFGLTSLGTAFVRSLPQAMGVRFLLGVFEAGMMPGIAYYLSRWY
RRAELAFRLSLYIVMAPLAGAFGGLLASAILSLEHFGGLRTWRMIFAIEGIITVGLGLVSLLTLTDRPATARWLT
AREKDLAIARVKSERIGATALLDKIDRTKLLRGILCPVTLGTSFIFLLNNVTVQGLAFFAPTIVKTIYADETLVK
QQLYTVPPYAVGAFFTLLFPLLSWRTDRRQIFIILSTPLVIVGYCMFLGSHNPSVRYAAAFLVASSTFTMGPLTN
AQVSANVVSDTARSAAIGTNIMMGNIGGLISGWSFLPWDAPDYRIGNGLNLATASTILIVSILIMCWLHRDNERR
RRHDADTQLQGLTPDQIEDLDWKHPAFQWKT*
Coding >Hirsu2|9039
CTGCGCAGCAACAGCACCTTGCTCAAGGCCGACGACGGCGGCGGCGGCGGCGGCGGCGGCGGCGCGTCCCCCTCG
CTCCTCCCCCTCCCGCCCCCGGCTGCCCCCGGCTGCCGCCTCGGCGCAGCAGCCGTGATGGCCAAGCCCGGCCGC
CGGCCGTCCGAGGCCGAGCTGCCGATCGGCAGCGTCGAGGCGCTCGACGACGCCTCGTCGCTGCACCGCGCGGCC
GAGCGCGGCCGCGCCGCGACCGATAAATACGGCGAGCCGCTGCTGCGGTACGACGCCGCGGCCGAGAGACGGCTC
CGGTTCAAGATCGACCTGTGCATCATCCCCACCGTCTCCATCCTCTACCTCTTCTGCTTCATCGACCGCGCCAAT
CTGGGCAACGCCAAGATCGCCGGGCTCGACAAGGACCTCGGCCTGAAGGGCTACGACTACAACAGCGTCATCTCC
GTCTTCTACATCTCCTACATCCTCTTCGAGATCCCCTGCAACATCCTGTGCAAGTGGATGGGCCCCGGCTGGTTT
CTGCCGCTGACGGCCGTCCTCTTCGGCCTCACCTCGCTCGGGACCGCCTTCGTCCGCAGCCTGCCGCAGGCCATG
GGCGTGCGCTTCCTGCTCGGCGTCTTCGAGGCCGGCATGATGCCCGGAATCGCCTACTACCTGTCGCGCTGGTAC
CGGCGCGCCGAGCTGGCCTTCCGCCTGTCGCTGTACATCGTCATGGCGCCCCTGGCCGGCGCCTTCGGCGGCCTG
CTGGCCTCGGCCATCCTGAGCCTCGAGCACTTCGGCGGCCTGCGCACCTGGCGCATGATCTTCGCCATCGAGGGC
ATCATCACCGTCGGCCTCGGCCTCGTCTCGCTCCTGACCCTGACCGACCGGCCCGCCACGGCCCGCTGGCTGACG
GCCCGGGAGAAGGACCTGGCCATCGCCCGCGTCAAGTCGGAGCGCATCGGCGCCACCGCCCTGCTCGACAAGATC
GACCGCACCAAGCTGCTCCGCGGCATCCTGTGCCCCGTCACCCTCGGCACCTCCTTCATCTTCCTCCTCAACAAC
GTCACCGTCCAGGGGCTGGCCTTCTTCGCGCCCACCATCGTCAAGACCATCTACGCCGACGAGACGCTCGTCAAG
CAGCAGCTCTACACGGTGCCGCCCTACGCCGTCGGCGCCTTCTTCACCCTGCTCTTCCCCCTCCTCAGCTGGCGC
ACCGACCGCCGCCAGATCTTCATCATCCTCTCCACGCCCCTCGTCATCGTCGGCTACTGCATGTTCCTCGGCTCG
CACAACCCGTCCGTCCGCTACGCCGCCGCCTTCCTCGTCGCCTCCTCCACCTTCACCATGGGGCCGCTCACCAAC
GCCCAGGTGTCGGCCAACGTCGTCAGCGACACGGCCCGCAGCGCCGCCATCGGCACCAACATCATGATGGGCAAC
ATCGGCGGCCTCATCAGCGGTTGGTCCTTCCTGCCTTGGGACGCCCCGGACTATCGCATCGGCAACGGCCTCAAC
CTGGCGACGGCCAGCACCATCCTCATCGTCAGCATCCTCATCATGTGCTGGCTGCACAGGGACAACGAGAGGCGC
CGCCGCCACGACGCCGACACGCAGCTGCAGGGCCTGACCCCGGACCAGATCGAGGACCTCGACTGGAAGCATCCC
GCCTTCCAGTGGAAAACGTAA
Transcript >Hirsu2|9039
CTGCGCAGCAACAGCACCTTGCTCAAGGCCGACGACGGCGGCGGCGGCGGCGGCGGCGGCGGCGCGTCCCCCTCG
CTCCTCCCCCTCCCGCCCCCGGCTGCCCCCGGCTGCCGCCTCGGCGCAGCAGCCGTGATGGCCAAGCCCGGCCGC
CGGCCGTCCGAGGCCGAGCTGCCGATCGGCAGCGTCGAGGCGCTCGACGACGCCTCGTCGCTGCACCGCGCGGCC
GAGCGCGGCCGCGCCGCGACCGATAAATACGGCGAGCCGCTGCTGCGGTACGACGCCGCGGCCGAGAGACGGCTC
CGGTTCAAGATCGACCTGTGCATCATCCCCACCGTCTCCATCCTCTACCTCTTCTGCTTCATCGACCGCGCCAAT
CTGGGCAACGCCAAGATCGCCGGGCTCGACAAGGACCTCGGCCTGAAGGGCTACGACTACAACAGCGTCATCTCC
GTCTTCTACATCTCCTACATCCTCTTCGAGATCCCCTGCAACATCCTGTGCAAGTGGATGGGCCCCGGCTGGTTT
CTGCCGCTGACGGCCGTCCTCTTCGGCCTCACCTCGCTCGGGACCGCCTTCGTCCGCAGCCTGCCGCAGGCCATG
GGCGTGCGCTTCCTGCTCGGCGTCTTCGAGGCCGGCATGATGCCCGGAATCGCCTACTACCTGTCGCGCTGGTAC
CGGCGCGCCGAGCTGGCCTTCCGCCTGTCGCTGTACATCGTCATGGCGCCCCTGGCCGGCGCCTTCGGCGGCCTG
CTGGCCTCGGCCATCCTGAGCCTCGAGCACTTCGGCGGCCTGCGCACCTGGCGCATGATCTTCGCCATCGAGGGC
ATCATCACCGTCGGCCTCGGCCTCGTCTCGCTCCTGACCCTGACCGACCGGCCCGCCACGGCCCGCTGGCTGACG
GCCCGGGAGAAGGACCTGGCCATCGCCCGCGTCAAGTCGGAGCGCATCGGCGCCACCGCCCTGCTCGACAAGATC
GACCGCACCAAGCTGCTCCGCGGCATCCTGTGCCCCGTCACCCTCGGCACCTCCTTCATCTTCCTCCTCAACAAC
GTCACCGTCCAGGGGCTGGCCTTCTTCGCGCCCACCATCGTCAAGACCATCTACGCCGACGAGACGCTCGTCAAG
CAGCAGCTCTACACGGTGCCGCCCTACGCCGTCGGCGCCTTCTTCACCCTGCTCTTCCCCCTCCTCAGCTGGCGC
ACCGACCGCCGCCAGATCTTCATCATCCTCTCCACGCCCCTCGTCATCGTCGGCTACTGCATGTTCCTCGGCTCG
CACAACCCGTCCGTCCGCTACGCCGCCGCCTTCCTCGTCGCCTCCTCCACCTTCACCATGGGGCCGCTCACCAAC
GCCCAGGTGTCGGCCAACGTCGTCAGCGACACGGCCCGCAGCGCCGCCATCGGCACCAACATCATGATGGGCAAC
ATCGGCGGCCTCATCAGCGGTTGGTCCTTCCTGCCTTGGGACGCCCCGGACTATCGCATCGGCAACGGCCTCAAC
CTGGCGACGGCCAGCACCATCCTCATCGTCAGCATCCTCATCATGTGCTGGCTGCACAGGGACAACGAGAGGCGC
CGCCGCCACGACGCCGACACGCAGCTGCAGGGCCTGACCCCGGACCAGATCGAGGACCTCGACTGGAAGCATCCC
GCCTTCCAGTGGAAAACGTAA
Gene >Hirsu2|9039
CTGCGCAGCAACAGCACCTTGCTCAAGGCCGACGACGGCGGCGGCGGCGGCGGCGGCGGCGGCGCGTCCCCCTCG
CTCCTCCCCCTCCCGCCCCCGGCTGCCCCCGGCTGCCGCCTCGGCGCAGCAGCCGTGATGGCCAAGCCCGGCCGC
CGGCCGTCCGAGGCCGAGCTGCCGATCGGCAGCGTCGAGGCGCTCGACGACGCCTCGTCGCTGCACCGCGCGGCC
GAGCGCGGCCGCGCCGCGACCGATAAGTACGGGGCCGAGATGCCGGCCGGGCTGAGCGATGGCTGACCTGCCGGC
TCCCTTCTGCGCAGATACGGCGAGCCGCTGCTGCGGTACGACGCCGCGGCCGAGAGACGGCTCCGGTTCAAGATC
GACCTGTGCATCATCCCCACCGTCTCCATCCTCTACCTCTTCTGCTTCATCGACCGCGCCAATCTGGGTAGGCAG
CTCGGTCCGGGACGGAGTGGGTGGGTGAGTGGGCGAGCGACTTGACTGACTGACGCCTCTCGTGCAGGCAACGCC
AAGATCGCCGGGCTCGACAAGGACCTCGGCCTGAAGGGCTACGACTACAACAGCGTCATCTCCGTCTTCTACATC
TCCTACATCCTCTTCGAGATCCCCTGCAACATCCTGTGCAAGTGGATGGGCCCCGGCTGGTTTCTGCCGCTGACG
GCCGTCCTCTTCGGCCTCACCTCGCTCGGGACCGCCTTCGTCCGCAGCCTGCCGCAGGCCATGGGCGTGCGCTTC
CTGCTCGGCGTCTTCGAGGCCGGCATGATGCCCGGAATCGCCTACTACCTGTCGCGCTGGTACCGGCGCGCCGAG
CTGGCCTTCCGCCTGTCGCTGTACATCGTCATGGCGCCCCTGGCCGGCGCCTTCGGCGGCCTGCTGGCCTCGGCC
ATCCTGAGCCTCGAGCACTTCGGCGGCCTGCGCACCTGGCGCATGATCTTCGCCATCGAGGGCATCATCACCGTC
GGCCTCGGCCTCGTCTCGCTCCTGACCCTGACCGACCGGCCCGCCACGGCCCGCTGGCTGACGGCCCGGGAGAAG
GACCTGGCCATCGCCCGCGTCAAGTCGGAGCGCATCGGCGCCACCGCCCTGCTCGACAAGATCGACCGCACCAAG
CTGCTCCGCGGCATCCTGTGCCCCGTCACCCTCGGCACCTCCTTCATCTTCCTCCTCAACAACGTCACCGTCCAG
GGGCTGGCCTTCTTCGCGCCCACCATCGTCAAGACCATCTACGCCGACGAGACGCTCGTCAAGCAGCAGCTCTAC
ACGGTGCCGCCCTACGCCGTCGGCGCCTTCTTCACCCTGCTCTTCCCCCTCCTCAGCTGGCGCACCGACCGCCGC
CAGATCTTCATCATCCTCTCCACGCCCCTCGTCATCGTCGGCTACTGCATGTTCCTCGGCTCGCACAACCCGTCC
GTCCGCTACGCCGCCGCCTTCCTCGTCGCCTCCTCCACCTTCACCATGGGGCCGCTCACCAACGCCCAGGTGTCG
GCCAACGTCGTCAGCGACACGGCCCGCAGCGCCGCCATCGGCACCAACATCATGATGGGCAACATCGGCGGCCTC
ATCAGCGGTTGGTCCTTCCTGCCTTGGGACGCCCCGGACTATCGCATCGGCAACGGCCTCAACCTGGCGACGGCC
AGCACCATCCTCATCGTCAGCATCCTCATCATGTGCTGGCTGCACAGGGACAACGAGAGGCGCCGCCGCCACGAC
GCCGACACGCAGCTGCAGGGCCTGACCCCGGACCAGATCGAGGACCTCGACTGGAAGCATCCCGCCTTCCAGTGG
AAAACGTAA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail