Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|9034
Gene name
LocationContig_63:10142..10952
Strand+
Gene length (bp)810
Transcript length (bp)810
Coding sequence length (bp)810
Protein length (aa) 270

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04641 Rtf2 Rtf2 RING-finger 1.9E-50 1 258

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q10154|RTF2_SCHPO Replication termination factor 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rtf2 PE=1 SV=1 1 200 3.0E-29
sp|Q5ZJN1|RTF2_CHICK Protein RTF2 homolog OS=Gallus gallus GN=RTFDC1 PE=2 SV=1 1 178 2.0E-21
sp|Q3T1J8|RTF2_RAT Protein RTF2 homolog OS=Rattus norvegicus GN=Rtfdc1 PE=2 SV=1 1 180 4.0E-18
sp|A5GFW7|RTF2_PIG Protein RTF2 homolog OS=Sus scrofa GN=RTFDC1 PE=3 SV=1 1 180 1.0E-17
sp|Q99K95|RTF2_MOUSE Protein RTF2 homolog OS=Mus musculus GN=Rtfdc1 PE=1 SV=1 1 180 1.0E-17
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q10154|RTF2_SCHPO Replication termination factor 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rtf2 PE=1 SV=1 1 200 3.0E-29
sp|Q5ZJN1|RTF2_CHICK Protein RTF2 homolog OS=Gallus gallus GN=RTFDC1 PE=2 SV=1 1 178 2.0E-21
sp|Q3T1J8|RTF2_RAT Protein RTF2 homolog OS=Rattus norvegicus GN=Rtfdc1 PE=2 SV=1 1 180 4.0E-18
sp|A5GFW7|RTF2_PIG Protein RTF2 homolog OS=Sus scrofa GN=RTFDC1 PE=3 SV=1 1 180 1.0E-17
sp|Q99K95|RTF2_MOUSE Protein RTF2 homolog OS=Mus musculus GN=Rtfdc1 PE=1 SV=1 1 180 1.0E-17
sp|Q0VCR1|RTF2_BOVIN Protein RTF2 homolog OS=Bos taurus GN=RTFDC1 PE=2 SV=1 1 181 7.0E-17
sp|Q4R594|RTF2_MACFA Protein RTF2 homolog OS=Macaca fascicularis GN=RTFDC1 PE=2 SV=1 1 181 1.0E-16
sp|Q5R9P9|RTF2_PONAB Protein RTF2 homolog OS=Pongo abelii GN=RTFDC1 PE=2 SV=1 1 181 1.0E-16
sp|Q9BY42|RTF2_HUMAN Protein RTF2 homolog OS=Homo sapiens GN=RTFDC1 PE=1 SV=3 1 181 2.0E-16
sp|Q54IS6|RTF2_DICDI Protein RTF2 homolog OS=Dictyostelium discoideum GN=rtfdc1 PE=3 SV=1 1 174 3.0E-11
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 62 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|9034
MGNDGGSIPKRRELVKNTSRAPTVSELKANVLESLTHAWTHCALSGAPLDMDSVVSDGHGRLYNYEAILKGLVSL
EEPVEATPASIGITSLRDVAKLKFSKSGDSWACPISMKQMGPATKAVYLIPCGHVFAEIAITEIQEETCPQCTEP
FVPENIIPILPTSEKDTQRLQQRLDVLRAKGLTHTLKKDKSEKKKKKKRKVDESDEAAGCDKGDEKPARDAGKRT
GEAIDSRISGINNPMAASLTAKVLAEQDEKHKRRKLASSCTLPT*
Coding >Hirsu2|9034
ATGGGTAACGACGGCGGCTCCATCCCCAAGCGGCGGGAGCTTGTCAAAAACACTTCACGCGCACCGACTGTCTCC
GAACTCAAGGCAAACGTTCTCGAGTCCCTTACCCACGCCTGGACGCATTGCGCACTCAGTGGCGCGCCACTCGAC
ATGGATTCCGTCGTCTCCGACGGACACGGCCGGCTCTACAACTACGAAGCGATACTCAAGGGTCTCGTGTCTTTA
GAAGAGCCAGTCGAGGCCACTCCGGCCTCAATTGGAATCACCTCATTGAGAGACGTGGCGAAGCTGAAGTTCTCC
AAGAGCGGCGACAGTTGGGCTTGCCCCATTTCTATGAAGCAAATGGGCCCGGCCACCAAAGCAGTGTACTTGATC
CCATGCGGCCATGTCTTTGCCGAAATCGCCATCACTGAAATACAGGAGGAGACATGTCCGCAGTGCACAGAACCT
TTTGTCCCTGAGAATATTATTCCCATCCTACCAACTTCGGAAAAAGACACACAAAGATTGCAGCAGAGATTAGAC
GTCTTACGGGCTAAAGGTCTAACCCACACCTTGAAGAAGGACAAGTCGGAGAAAAAGAAGAAGAAGAAGCGCAAG
GTTGACGAATCGGACGAGGCTGCCGGCTGCGACAAAGGTGATGAGAAGCCAGCTAGAGATGCCGGCAAACGAACA
GGGGAGGCTATCGATTCGAGGATTAGCGGCATCAATAACCCGATGGCGGCGTCCTTGACTGCCAAGGTTCTCGCC
GAGCAAGACGAGAAGCACAAGCGGCGAAAACTGGCTTCTAGCTGCACCCTGCCAACCTGA
Transcript >Hirsu2|9034
ATGGGTAACGACGGCGGCTCCATCCCCAAGCGGCGGGAGCTTGTCAAAAACACTTCACGCGCACCGACTGTCTCC
GAACTCAAGGCAAACGTTCTCGAGTCCCTTACCCACGCCTGGACGCATTGCGCACTCAGTGGCGCGCCACTCGAC
ATGGATTCCGTCGTCTCCGACGGACACGGCCGGCTCTACAACTACGAAGCGATACTCAAGGGTCTCGTGTCTTTA
GAAGAGCCAGTCGAGGCCACTCCGGCCTCAATTGGAATCACCTCATTGAGAGACGTGGCGAAGCTGAAGTTCTCC
AAGAGCGGCGACAGTTGGGCTTGCCCCATTTCTATGAAGCAAATGGGCCCGGCCACCAAAGCAGTGTACTTGATC
CCATGCGGCCATGTCTTTGCCGAAATCGCCATCACTGAAATACAGGAGGAGACATGTCCGCAGTGCACAGAACCT
TTTGTCCCTGAGAATATTATTCCCATCCTACCAACTTCGGAAAAAGACACACAAAGATTGCAGCAGAGATTAGAC
GTCTTACGGGCTAAAGGTCTAACCCACACCTTGAAGAAGGACAAGTCGGAGAAAAAGAAGAAGAAGAAGCGCAAG
GTTGACGAATCGGACGAGGCTGCCGGCTGCGACAAAGGTGATGAGAAGCCAGCTAGAGATGCCGGCAAACGAACA
GGGGAGGCTATCGATTCGAGGATTAGCGGCATCAATAACCCGATGGCGGCGTCCTTGACTGCCAAGGTTCTCGCC
GAGCAAGACGAGAAGCACAAGCGGCGAAAACTGGCTTCTAGCTGCACCCTGCCAACCTGA
Gene >Hirsu2|9034
ATGGGTAACGACGGCGGCTCCATCCCCAAGCGGCGGGAGCTTGTCAAAAACACTTCACGCGCACCGACTGTCTCC
GAACTCAAGGCAAACGTTCTCGAGTCCCTTACCCACGCCTGGACGCATTGCGCACTCAGTGGCGCGCCACTCGAC
ATGGATTCCGTCGTCTCCGACGGACACGGCCGGCTCTACAACTACGAAGCGATACTCAAGGGTCTCGTGTCTTTA
GAAGAGCCAGTCGAGGCCACTCCGGCCTCAATTGGAATCACCTCATTGAGAGACGTGGCGAAGCTGAAGTTCTCC
AAGAGCGGCGACAGTTGGGCTTGCCCCATTTCTATGAAGCAAATGGGCCCGGCCACCAAAGCAGTGTACTTGATC
CCATGCGGCCATGTCTTTGCCGAAATCGCCATCACTGAAATACAGGAGGAGACATGTCCGCAGTGCACAGAACCT
TTTGTCCCTGAGAATATTATTCCCATCCTACCAACTTCGGAAAAAGACACACAAAGATTGCAGCAGAGATTAGAC
GTCTTACGGGCTAAAGGTCTAACCCACACCTTGAAGAAGGACAAGTCGGAGAAAAAGAAGAAGAAGAAGCGCAAG
GTTGACGAATCGGACGAGGCTGCCGGCTGCGACAAAGGTGATGAGAAGCCAGCTAGAGATGCCGGCAAACGAACA
GGGGAGGCTATCGATTCGAGGATTAGCGGCATCAATAACCCGATGGCGGCGTCCTTGACTGCCAAGGTTCTCGCC
GAGCAAGACGAGAAGCACAAGCGGCGAAAACTGGCTTCTAGCTGCACCCTGCCAACCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail