Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|9025
Gene name
LocationContig_628:4760..7079
Strand-
Gene length (bp)2319
Transcript length (bp)2319
Coding sequence length (bp)2319
Protein length (aa) 773

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00930 DPPIV_N Dipeptidyl peptidase IV (DPP IV) N-terminal region 8.1E-97 111 468
PF00326 Peptidase_S9 Prolyl oligopeptidase family 1.5E-35 564 749

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|A1CX29|DPP4_NEOFI Probable dipeptidyl peptidase 4 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=dpp4 PE=3 SV=1 13 772 0.0E+00
sp|Q5J6J3|DPP4_TRIRU Dipeptidyl peptidase 4 OS=Trichophyton rubrum GN=DPP4 PE=1 SV=1 13 772 0.0E+00
sp|Q4WPH9|DPP4_ASPFU Probable dipeptidyl peptidase 4 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=dpp4 PE=3 SV=1 13 772 0.0E+00
sp|B0Y6C5|DPP4_ASPFC Probable dipeptidyl peptidase 4 OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=dpp4 PE=1 SV=1 13 772 0.0E+00
sp|Q2UH35|DPP4_ASPOR Dipeptidyl peptidase 4 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=dpp4 PE=1 SV=1 18 772 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|A1CX29|DPP4_NEOFI Probable dipeptidyl peptidase 4 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=dpp4 PE=3 SV=1 13 772 0.0E+00
sp|Q5J6J3|DPP4_TRIRU Dipeptidyl peptidase 4 OS=Trichophyton rubrum GN=DPP4 PE=1 SV=1 13 772 0.0E+00
sp|Q4WPH9|DPP4_ASPFU Probable dipeptidyl peptidase 4 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=dpp4 PE=3 SV=1 13 772 0.0E+00
sp|B0Y6C5|DPP4_ASPFC Probable dipeptidyl peptidase 4 OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=dpp4 PE=1 SV=1 13 772 0.0E+00
sp|Q2UH35|DPP4_ASPOR Dipeptidyl peptidase 4 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=dpp4 PE=1 SV=1 18 772 0.0E+00
sp|B8N970|DPP4_ASPFN Probable dipeptidyl peptidase 4 OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=dpp4 PE=3 SV=1 18 772 0.0E+00
sp|D4APE2|DPP4_ARTBC Probable dipeptidyl peptidase 4 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=DPP4 PE=1 SV=1 13 772 0.0E+00
sp|B6V868|DPP4_TRITO Dipeptidyl peptidase 4 OS=Trichophyton tonsurans GN=DPP4 PE=3 SV=1 13 772 0.0E+00
sp|A7UKV8|DPP4_TRIEQ Dipeptidyl peptidase 4 OS=Trichophyton equinum GN=DPP4 PE=3 SV=1 13 772 0.0E+00
sp|A1CHP1|DPP4_ASPCL Probable dipeptidyl peptidase 4 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=dpp4 PE=3 SV=1 13 772 0.0E+00
sp|A0S5V9|DPP4_ARTOT Dipeptidyl peptidase 4 OS=Arthroderma otae GN=DPP4 PE=3 SV=1 13 772 0.0E+00
sp|C5FJE3|DPP4_ARTOC Dipeptidyl peptidase 4 OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=DPP4 PE=3 SV=2 13 772 0.0E+00
sp|Q5AZ42|DPP4_EMENI Probable dipeptidyl peptidase 4 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=dpp4 PE=3 SV=1 22 772 0.0E+00
sp|D4CZ59|DPP4_TRIVH Probable dipeptidyl peptidase 4 OS=Trichophyton verrucosum (strain HKI 0517) GN=DPP4 PE=3 SV=1 13 772 0.0E+00
sp|C4JHY5|DAPB_UNCRE Probable dipeptidyl-aminopeptidase B OS=Uncinocarpus reesii (strain UAMH 1704) GN=DAPB PE=3 SV=1 104 756 1.0E-132
sp|B6QVW4|DAPB_TALMQ Probable dipeptidyl-aminopeptidase B OS=Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333) GN=dapB PE=3 SV=1 104 756 4.0E-131
sp|Q5B934|DAPB_EMENI Probable dipeptidyl-aminopeptidase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=dapB PE=3 SV=2 44 756 5.0E-128
sp|B0XYK8|DAPB_ASPFC Probable dipeptidyl-aminopeptidase B OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=dapB PE=3 SV=1 103 756 5.0E-125
sp|Q0CXB1|DAPB_ASPTN Probable dipeptidyl-aminopeptidase B OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=dapB PE=3 SV=1 102 756 7.0E-125
sp|B8MTH6|DAPB_TALSN Probable dipeptidyl-aminopeptidase B OS=Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006) GN=dapB PE=3 SV=1 73 756 1.0E-124
sp|E9ETL5|DAPB_METRA Probable dipeptidyl-aminopeptidase B OS=Metarhizium robertsii (strain ARSEF 23 / ATCC MYA-3075) GN=DAPB PE=3 SV=2 59 756 2.0E-124
sp|E4UYL6|DAPB_ARTGP Probable dipeptidyl-aminopeptidase B OS=Arthroderma gypseum (strain ATCC MYA-4604 / CBS 118893) GN=DAPB PE=3 SV=1 104 756 2.0E-124
sp|Q4WX13|DAPB_ASPFU Probable dipeptidyl-aminopeptidase B OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=dapB PE=3 SV=2 103 756 4.0E-124
sp|A2QEK7|DAPB_ASPNC Probable dipeptidyl-aminopeptidase B OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=dapB PE=3 SV=1 103 756 8.0E-124
sp|Q96VT7|DAPB_ASPNG Dipeptidyl-aminopeptidase B OS=Aspergillus niger GN=dapB PE=3 SV=1 103 756 1.0E-123
sp|C5FYZ3|DAPB_ARTOC Probable dipeptidyl-aminopeptidase B OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=DAPB PE=3 SV=1 68 756 6.0E-123
sp|O14073|YEA8_SCHPO Putative dipeptidyl aminopeptidase C2E11.08 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC2E11.08 PE=3 SV=1 106 771 1.0E-122
sp|D5GM60|DAPB_TUBMM Probable dipeptidyl-aminopeptidase B OS=Tuber melanosporum (strain Mel28) GN=DAPB PE=3 SV=1 65 756 7.0E-122
sp|E9ED72|DAPB_METAQ Probable dipeptidyl-aminopeptidase B OS=Metarhizium acridum (strain CQMa 102) GN=DAPB PE=3 SV=1 109 749 7.0E-122
sp|D4AQT0|DAPB_ARTBC Probable dipeptidyl-aminopeptidase B OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=DAPB PE=3 SV=1 104 750 8.0E-122
sp|A1D7R6|DAPB_NEOFI Probable dipeptidyl-aminopeptidase B OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=dapB PE=3 SV=1 103 758 1.0E-121
sp|Q0UVK7|DAPB_PHANO Probable dipeptidyl-aminopeptidase B OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=DAPB PE=3 SV=1 34 756 1.0E-121
sp|D4DCG0|DAPB_TRIVH Probable dipeptidyl-aminopeptidase B OS=Trichophyton verrucosum (strain HKI 0517) GN=DAPB PE=3 SV=1 104 750 7.0E-120
sp|B6HFS8|DAPB_PENRW Probable dipeptidyl-aminopeptidase B OS=Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255) GN=dapB PE=3 SV=1 104 756 2.0E-119
sp|C1GT79|DAPB_PARBA Probable dipeptidyl-aminopeptidase B OS=Paracoccidioides lutzii (strain ATCC MYA-826 / Pb01) GN=DAPB PE=3 SV=1 104 758 2.0E-118
sp|E3S9K3|DAPB_PYRTT Probable dipeptidyl-aminopeptidase B OS=Pyrenophora teres f. teres (strain 0-1) GN=dapB PE=3 SV=1 104 757 2.0E-118
sp|E3QKD2|DAPB_COLGM Probable dipeptidyl-aminopeptidase B OS=Colletotrichum graminicola (strain M1.001 / M2 / FGSC 10212) GN=DAPB PE=3 SV=1 101 756 5.0E-118
sp|A4QYQ5|DAPB_MAGO7 Probable dipeptidyl-aminopeptidase B OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=DAPB PE=3 SV=1 86 756 7.0E-118
sp|E9CUF4|DAPB_COCPS Probable dipeptidyl-aminopeptidase B OS=Coccidioides posadasii (strain RMSCC 757 / Silveira) GN=DAPB PE=3 SV=1 104 756 7.0E-118
sp|C5P334|DAPB_COCP7 Probable dipeptidyl-aminopeptidase B OS=Coccidioides posadasii (strain C735) GN=DAPB PE=3 SV=1 104 756 7.0E-118
sp|C0S7H1|DAPB_PARBP Probable dipeptidyl-aminopeptidase B OS=Paracoccidioides brasiliensis (strain Pb03) GN=DAPB PE=3 SV=2 104 758 8.0E-118
sp|C1FZL3|DAPB_PARBD Probable dipeptidyl-aminopeptidase B OS=Paracoccidioides brasiliensis (strain Pb18) GN=DAPB PE=3 SV=1 104 758 8.0E-118
sp|Q7SHU8|DAPB_NEUCR Probable dipeptidyl-aminopeptidase B OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=dapB PE=3 SV=2 107 756 1.0E-117
sp|D1Z9B4|DAPB_SORMK Probable dipeptidyl-aminopeptidase B OS=Sordaria macrospora (strain ATCC MYA-333 / DSM 997 / K(L3346) / K-hell) GN=DAPB PE=3 SV=1 107 756 2.0E-117
sp|B2A951|DAPB_PODAN Probable dipeptidyl-aminopeptidase B OS=Podospora anserina (strain S / ATCC MYA-4624 / DSM 980 / FGSC 10383) GN=DAPB PE=3 SV=1 104 756 2.0E-116
sp|C5JC30|DAPB_AJEDS Probable dipeptidyl-aminopeptidase B OS=Ajellomyces dermatitidis (strain SLH14081) GN=DAPB PE=3 SV=1 104 758 6.0E-115
sp|C5GVF3|DAPB_AJEDR Probable dipeptidyl-aminopeptidase B OS=Ajellomyces dermatitidis (strain ER-3 / ATCC MYA-2586) GN=DAPB PE=3 SV=1 104 758 6.0E-115
sp|A1CJQ1|DAPB_ASPCL Probable dipeptidyl-aminopeptidase B OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=dapB PE=3 SV=1 103 756 6.0E-115
sp|Q2UPW4|DAPB_ASPOR Probable dipeptidyl-aminopeptidase B OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=dapB PE=3 SV=1 104 756 1.0E-114
sp|Q2HF90|DAPB_CHAGB Probable dipeptidyl-aminopeptidase B OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=DAPB PE=3 SV=1 107 756 1.0E-114
sp|B8N076|DAPB_ASPFN Probable dipeptidyl-aminopeptidase B OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=dapB PE=3 SV=1 104 756 1.0E-114
sp|A7EQZ1|DAPB_SCLS1 Probable dipeptidyl-aminopeptidase B OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=dapB PE=3 SV=1 24 756 5.0E-114
sp|C7YYG9|DAPB_NECH7 Probable dipeptidyl-aminopeptidase B OS=Nectria haematococca (strain 77-13-4 / ATCC MYA-4622 / FGSC 9596 / MPVI) GN=DAPB PE=3 SV=1 109 756 2.0E-113
sp|B2WC36|DAPB_PYRTR Probable dipeptidyl-aminopeptidase B OS=Pyrenophora tritici-repentis (strain Pt-1C-BFP) GN=dapB PE=3 SV=1 146 757 4.0E-113
sp|C0NUQ8|DAPB_AJECG Probable dipeptidyl-aminopeptidase B OS=Ajellomyces capsulatus (strain G186AR / H82 / ATCC MYA-2454 / RMSCC 2432) GN=DAPB PE=3 SV=1 104 758 1.0E-112
sp|C6HRC7|DAPB_AJECH Probable dipeptidyl-aminopeptidase B OS=Ajellomyces capsulatus (strain H143) GN=DAPB PE=3 SV=1 104 758 3.0E-112
sp|F0U7H7|DAPB_AJEC8 Probable dipeptidyl-aminopeptidase B OS=Ajellomyces capsulatus (strain H88) GN=DAPB PE=3 SV=1 104 758 3.0E-112
sp|A6SL49|DAPB_BOTFB Probable dipeptidyl-aminopeptidase B OS=Botryotinia fuckeliana (strain B05.10) GN=dapB PE=3 SV=1 76 756 2.0E-111
sp|A6RBI0|DAPB_AJECN Probable dipeptidyl-aminopeptidase B OS=Ajellomyces capsulatus (strain NAm1 / WU24) GN=DAPB PE=3 SV=1 104 758 8.0E-109
sp|F0XS04|DAPB_GROCL Probable dipeptidyl-aminopeptidase B OS=Grosmannia clavigera (strain kw1407 / UAMH 11150) GN=DAPB PE=3 SV=1 29 756 2.0E-100
sp|P18962|DAP2_YEAST Dipeptidyl aminopeptidase B OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DAP2 PE=1 SV=2 12 745 2.0E-98
sp|C9SJ15|DAPB_VERA1 Probable dipeptidyl-aminopeptidase B OS=Verticillium alfalfae (strain VaMs.102 / ATCC MYA-4576 / FGSC 10136) GN=DAPB PE=3 SV=1 99 756 1.0E-94
sp|P97321|SEPR_MOUSE Prolyl endopeptidase FAP OS=Mus musculus GN=Fap PE=1 SV=1 3 756 7.0E-86
sp|Q12884|SEPR_HUMAN Prolyl endopeptidase FAP OS=Homo sapiens GN=FAP PE=1 SV=5 5 752 6.0E-82
sp|P22411|DPP4_PIG Dipeptidyl peptidase 4 OS=Sus scrofa GN=DPP4 PE=1 SV=3 45 756 3.0E-80
sp|P81425|DPP4_BOVIN Dipeptidyl peptidase 4 OS=Bos taurus GN=DPP4 PE=1 SV=3 49 756 8.0E-80
sp|P28843|DPP4_MOUSE Dipeptidyl peptidase 4 OS=Mus musculus GN=Dpp4 PE=1 SV=3 25 756 4.0E-79
sp|P14740|DPP4_RAT Dipeptidyl peptidase 4 OS=Rattus norvegicus GN=Dpp4 PE=1 SV=2 25 756 7.0E-79
sp|P33894|STE13_YEAST Dipeptidyl aminopeptidase A OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=STE13 PE=1 SV=1 21 744 3.0E-78
sp|Q9N2I7|DPP4_FELCA Dipeptidyl peptidase 4 OS=Felis catus GN=DPP4 PE=2 SV=1 45 753 3.0E-78
sp|A5D7B7|SEPR_BOVIN Prolyl endopeptidase FAP OS=Bos taurus GN=FAP PE=1 SV=1 5 752 3.0E-78
sp|P27487|DPP4_HUMAN Dipeptidyl peptidase 4 OS=Homo sapiens GN=DPP4 PE=1 SV=2 45 753 8.0E-77
sp|B1A4F7|VDDP4_VESVU Venom dipeptidyl peptidase 4 OS=Vespula vulgaris PE=1 SV=1 111 759 4.0E-73
sp|B2D0J4|VDPP4_APIME Venom dipeptidyl peptidase 4 OS=Apis mellifera PE=1 SV=1 158 757 4.0E-72
sp|Q8N608|DPP10_HUMAN Inactive dipeptidyl peptidase 10 OS=Homo sapiens GN=DPP10 PE=1 SV=2 106 760 8.0E-69
sp|P42659|DPP6_BOVIN Dipeptidyl aminopeptidase-like protein 6 OS=Bos taurus GN=DPP6 PE=1 SV=1 37 750 1.0E-66
sp|Q6Q629|DPP10_RAT Inactive dipeptidyl peptidase 10 OS=Rattus norvegicus GN=Dpp10 PE=1 SV=1 109 760 1.0E-64
sp|Q6NXK7|DPP10_MOUSE Inactive dipeptidyl peptidase 10 OS=Mus musculus GN=Dpp10 PE=1 SV=1 57 760 4.0E-64
sp|Q9Z218|DPP6_MOUSE Dipeptidyl aminopeptidase-like protein 6 OS=Mus musculus GN=Dpp6 PE=1 SV=1 29 719 1.0E-63
sp|P46101|DPP6_RAT Dipeptidyl aminopeptidase-like protein 6 OS=Rattus norvegicus GN=Dpp6 PE=1 SV=1 29 750 3.0E-62
sp|Q5IS50|DPP6_PANTR Dipeptidyl aminopeptidase-like protein 6 OS=Pan troglodytes GN=DPP6 PE=2 SV=1 37 754 7.0E-62
sp|P42658|DPP6_HUMAN Dipeptidyl aminopeptidase-like protein 6 OS=Homo sapiens GN=DPP6 PE=1 SV=2 37 754 2.0E-61
sp|B2RJX3|PTP_PORG3 Prolyl tripeptidyl peptidase OS=Porphyromonas gingivalis (strain ATCC 33277 / DSM 20709 / JCM 12257) GN=ptpA PE=3 SV=1 134 760 1.0E-55
sp|Q7MUW6|PTP_PORGI Prolyl tripeptidyl peptidase OS=Porphyromonas gingivalis (strain ATCC BAA-308 / W83) GN=ptpA PE=1 SV=1 134 760 6.0E-55
sp|Q6F3I7|DAP4_PSEMX Dipeptidyl aminopeptidase 4 OS=Pseudoxanthomonas mexicana GN=dap4 PE=1 SV=1 156 751 1.0E-54
sp|Q6V1X1|DPP8_HUMAN Dipeptidyl peptidase 8 OS=Homo sapiens GN=DPP8 PE=1 SV=1 162 723 2.0E-42
sp|Q80YA7|DPP8_MOUSE Dipeptidyl peptidase 8 OS=Mus musculus GN=Dpp8 PE=1 SV=1 162 723 1.0E-41
sp|Q9P7E9|YDZF_SCHPO Putative dipeptidyl aminopeptidase C14C4.15c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC14C4.15c PE=3 SV=2 48 722 1.0E-39
sp|Q7JKY3|DPF1_CAEEL Dipeptidyl peptidase family member 1 OS=Caenorhabditis elegans GN=dpf-1 PE=1 SV=1 164 739 2.0E-38
sp|Q8BVG4|DPP9_MOUSE Dipeptidyl peptidase 9 OS=Mus musculus GN=Dpp9 PE=1 SV=2 256 756 7.0E-34
sp|Q86TI2|DPP9_HUMAN Dipeptidyl peptidase 9 OS=Homo sapiens GN=DPP9 PE=1 SV=3 256 723 1.0E-31
sp|Q18253|DPF2_CAEEL Dipeptidyl peptidase family member 2 OS=Caenorhabditis elegans GN=dpf-2 PE=1 SV=1 499 762 3.0E-29
sp|Q18253|DPF2_CAEEL Dipeptidyl peptidase family member 2 OS=Caenorhabditis elegans GN=dpf-2 PE=1 SV=1 164 266 1.0E-09
sp|B0XRV0|DPP5_ASPFC Dipeptidyl-peptidase 5 OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=AFUB_024920 PE=1 SV=1 504 737 3.0E-08
sp|P0C959|DPP5_ASPFU Dipeptidyl-peptidase 5 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=AFUA_2G09030 PE=2 SV=1 504 737 3.0E-08
sp|P39839|YUXL_BACSU Uncharacterized peptidase YuxL OS=Bacillus subtilis (strain 168) GN=yuxL PE=3 SV=3 447 654 5.0E-08
sp|Q9Y8E3|DPP5_ASPOR Dipeptidyl-peptidase 5 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=AO090011000795-A PE=3 SV=2 522 737 1.0E-07
sp|B8NBM3|DPP5_ASPFN Probable dipeptidyl-peptidase 5 OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=dpp5 PE=3 SV=2 522 737 2.0E-07
sp|Q0C8V9|DPP5_ASPTN Probable dipeptidyl-peptidase 5 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=dpp5 PE=3 SV=1 511 737 2.0E-07
sp|A1CSW4|DPP5_ASPCL Probable dipeptidyl-peptidase 5 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=dpp5 PE=3 SV=1 504 737 3.0E-06
sp|Q5BA58|DPP5_EMENI Probable dipeptidyl-peptidase 5 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=dpp5 PE=1 SV=1 522 737 4.0E-06
sp|Q9P778|DPP5_SCHPO Dipeptidyl-peptidase 5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1711.12 PE=3 SV=1 487 630 6.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0006508 proteolysis Yes
GO:0008236 serine-type peptidase activity Yes
GO:0071704 organic substance metabolic process No
GO:0016787 hydrolase activity No
GO:0044238 primary metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0003824 catalytic activity No
GO:0070011 peptidase activity, acting on L-amino acid peptides No
GO:0003674 molecular_function No
GO:0008152 metabolic process No
GO:0008233 peptidase activity No
GO:0019538 protein metabolic process No
GO:0043170 macromolecule metabolic process No
GO:0008150 biological_process No
GO:0017171 serine hydrolase activity No
GO:0140096 catalytic activity, acting on a protein No
GO:1901564 organonitrogen compound metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 23 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|9025
MRLSVLCAPSALVLSLWSPVSAIEPPRLPRQPTGNGDRLMTYREAVTDDAFRPFKLKPNWVAAKRDGLYTVRSDD
GGLALESVDANGEVAIAPAAQVPQGIRNCWVNRDWGVVLMVGNKTRRHRHSYTADYFVFDRRSGRTSPLVDEQAG
DVQYAELAPRGDAIAFVRNNNLFLRHGGGKVLQVTTSGGPDMAHGVPDWVYEEEVLSGPSALWFSPDGESVAFLS
FNDTGVDTFDVPRYMAGRDEAPPYPNWLEQRYPKVGSPNPTAGLSILDVRTGKVDSVPLEAFAPDDTIVGEVAWL
TEGHSALLYRAFNRVQDRDKHVVVNPQIREARVVRERDAGDCWLDNTRSIRYAGAATGSNKTYYADLSDESGWTH
IYLYPVDGRGEPVQLTSGEWEVRSILHVDRSRRLVHYTASKRHSTESHVYSVSYETGKSEPLVDDEVPAVWSADF
SPGGGFYILSYEGPDVPYQEIFALNDGQEPLAIGEDNSKVLRRISEVRLPNITYFELRHPDGHTVNVMQQLPPDF
DESRKYPVLLKLYGGPVSQSVVKTFHPPRWSAYVSSDPELQYVVYAVDGRGTTNRGRAFRCAVSRRLGRLETEDQ
TWAMRELLSTRRFLDADHVGIYGESYGGFLAAKAIEADSGVFTFGISVSPVTDWRLYDSIFTERHMKALGTNADG
YREAAIRNSVGFKKLAGVFSLAHGTGDVNVHYQNTAALLDRLVREGVPPHKVRMMAFTDSDHTLDFHGADHHLHK
FLTDRLWDEIERKSSSSHHQWS*
Coding >Hirsu2|9025
ATGCGTCTCTCTGTCCTCTGCGCACCATCAGCGCTCGTGCTGTCTCTGTGGTCGCCCGTGTCTGCCATCGAGCCG
CCCCGGCTTCCCCGTCAGCCCACCGGCAACGGAGACCGCCTGATGACCTACCGCGAGGCCGTGACTGATGATGCC
TTCAGGCCTTTCAAGCTCAAACCGAACTGGGTTGCGGCAAAGCGGGATGGCCTGTACACGGTCAGGTCCGACGAC
GGCGGGCTTGCCCTCGAAAGCGTTGACGCGAATGGAGAGGTGGCCATCGCGCCGGCCGCTCAGGTGCCTCAAGGA
ATTAGGAACTGCTGGGTCAATCGCGATTGGGGCGTCGTGCTCATGGTCGGAAACAAGACGAGACGCCACCGGCAC
TCGTACACGGCCGACTACTTCGTCTTCGACAGGCGAAGCGGGCGGACGAGTCCCCTCGTCGACGAGCAGGCGGGC
GACGTTCAGTACGCCGAGCTGGCGCCCCGGGGCGACGCCATCGCCTTCGTCCGCAACAACAACCTCTTCCTCCGC
CACGGCGGCGGGAAGGTCCTCCAGGTGACGACGAGCGGCGGACCGGACATGGCGCACGGAGTGCCGGACTGGGTG
TACGAGGAAGAGGTGCTGTCTGGCCCCTCGGCCCTCTGGTTCTCGCCCGACGGCGAGTCGGTCGCCTTCCTCAGC
TTCAACGACACGGGCGTCGACACTTTCGACGTTCCCCGATACATGGCCGGTCGAGACGAGGCGCCGCCGTATCCC
AACTGGCTTGAGCAGCGCTACCCCAAGGTCGGGTCGCCCAACCCGACCGCTGGGCTCTCCATCCTCGACGTGCGG
ACCGGCAAGGTTGACTCGGTGCCGCTCGAGGCCTTTGCTCCCGATGACACCATCGTCGGCGAGGTGGCCTGGCTG
ACGGAGGGCCACTCGGCTCTCCTCTATCGAGCCTTCAACCGCGTCCAGGACAGGGACAAGCATGTCGTCGTCAAC
CCGCAGATCAGAGAGGCCAGGGTCGTCCGCGAGCGCGACGCCGGAGACTGTTGGCTGGACAACACGCGGAGCATC
CGCTACGCCGGCGCGGCCACCGGAAGCAACAAGACGTACTATGCCGACCTGTCAGACGAGTCCGGCTGGACGCAC
ATCTACCTCTATCCCGTCGACGGCCGCGGTGAGCCCGTCCAGCTCACGTCGGGCGAGTGGGAGGTGCGGTCGATC
CTCCACGTCGACCGGAGCCGCCGTCTCGTCCACTACACTGCCTCGAAGCGCCATAGCACCGAGAGCCACGTGTAC
AGCGTCTCGTACGAGACAGGCAAGTCGGAGCCGCTGGTCGACGACGAGGTCCCGGCCGTCTGGTCGGCCGACTTC
TCGCCCGGCGGAGGCTTCTATATCCTGAGCTACGAAGGCCCGGACGTGCCGTACCAGGAGATCTTCGCGCTCAAC
GACGGCCAGGAGCCGCTGGCGATCGGGGAGGACAACAGCAAGGTTCTGCGGCGAATAAGCGAGGTCCGCCTGCCC
AACATCACGTACTTCGAGCTCCGGCACCCGGACGGGCACACCGTCAACGTGATGCAGCAGCTGCCGCCGGATTTC
GACGAGTCGCGCAAATACCCGGTCCTTCTCAAGCTGTACGGTGGCCCGGTCTCGCAGTCCGTGGTCAAGACATTC
CACCCGCCCCGCTGGAGCGCATACGTGTCGTCGGATCCGGAGCTTCAGTACGTCGTCTACGCCGTCGACGGCCGG
GGTACGACCAACCGGGGTCGGGCTTTCCGCTGCGCCGTTTCGCGCCGCCTGGGCCGGCTCGAGACCGAGGACCAG
ACCTGGGCGATGCGCGAGTTGCTGTCGACGCGCCGCTTCCTCGATGCCGACCACGTCGGCATCTACGGGGAGTCG
TACGGCGGCTTCCTGGCGGCCAAGGCCATCGAGGCCGACTCGGGCGTCTTCACCTTCGGCATAAGCGTCTCGCCC
GTGACGGACTGGCGCTTGTACGACTCCATCTTCACCGAGCGTCATATGAAGGCGCTCGGGACCAACGCGGACGGC
TACCGAGAGGCCGCCATCCGCAACTCGGTCGGCTTCAAGAAGTTGGCCGGTGTCTTCTCCCTCGCCCACGGGACC
GGCGACGTCAACGTTCATTACCAGAACACGGCAGCGCTGCTGGACCGGCTCGTCCGCGAGGGCGTGCCGCCGCAC
AAGGTCAGGATGATGGCCTTCACCGACAGCGACCACACGCTCGACTTCCACGGCGCCGACCATCACCTGCACAAA
TTCCTCACAGACCGCCTGTGGGACGAGATCGAGAGAAAGTCCAGCTCGTCGCATCACCAGTGGAGCTGA
Transcript >Hirsu2|9025
ATGCGTCTCTCTGTCCTCTGCGCACCATCAGCGCTCGTGCTGTCTCTGTGGTCGCCCGTGTCTGCCATCGAGCCG
CCCCGGCTTCCCCGTCAGCCCACCGGCAACGGAGACCGCCTGATGACCTACCGCGAGGCCGTGACTGATGATGCC
TTCAGGCCTTTCAAGCTCAAACCGAACTGGGTTGCGGCAAAGCGGGATGGCCTGTACACGGTCAGGTCCGACGAC
GGCGGGCTTGCCCTCGAAAGCGTTGACGCGAATGGAGAGGTGGCCATCGCGCCGGCCGCTCAGGTGCCTCAAGGA
ATTAGGAACTGCTGGGTCAATCGCGATTGGGGCGTCGTGCTCATGGTCGGAAACAAGACGAGACGCCACCGGCAC
TCGTACACGGCCGACTACTTCGTCTTCGACAGGCGAAGCGGGCGGACGAGTCCCCTCGTCGACGAGCAGGCGGGC
GACGTTCAGTACGCCGAGCTGGCGCCCCGGGGCGACGCCATCGCCTTCGTCCGCAACAACAACCTCTTCCTCCGC
CACGGCGGCGGGAAGGTCCTCCAGGTGACGACGAGCGGCGGACCGGACATGGCGCACGGAGTGCCGGACTGGGTG
TACGAGGAAGAGGTGCTGTCTGGCCCCTCGGCCCTCTGGTTCTCGCCCGACGGCGAGTCGGTCGCCTTCCTCAGC
TTCAACGACACGGGCGTCGACACTTTCGACGTTCCCCGATACATGGCCGGTCGAGACGAGGCGCCGCCGTATCCC
AACTGGCTTGAGCAGCGCTACCCCAAGGTCGGGTCGCCCAACCCGACCGCTGGGCTCTCCATCCTCGACGTGCGG
ACCGGCAAGGTTGACTCGGTGCCGCTCGAGGCCTTTGCTCCCGATGACACCATCGTCGGCGAGGTGGCCTGGCTG
ACGGAGGGCCACTCGGCTCTCCTCTATCGAGCCTTCAACCGCGTCCAGGACAGGGACAAGCATGTCGTCGTCAAC
CCGCAGATCAGAGAGGCCAGGGTCGTCCGCGAGCGCGACGCCGGAGACTGTTGGCTGGACAACACGCGGAGCATC
CGCTACGCCGGCGCGGCCACCGGAAGCAACAAGACGTACTATGCCGACCTGTCAGACGAGTCCGGCTGGACGCAC
ATCTACCTCTATCCCGTCGACGGCCGCGGTGAGCCCGTCCAGCTCACGTCGGGCGAGTGGGAGGTGCGGTCGATC
CTCCACGTCGACCGGAGCCGCCGTCTCGTCCACTACACTGCCTCGAAGCGCCATAGCACCGAGAGCCACGTGTAC
AGCGTCTCGTACGAGACAGGCAAGTCGGAGCCGCTGGTCGACGACGAGGTCCCGGCCGTCTGGTCGGCCGACTTC
TCGCCCGGCGGAGGCTTCTATATCCTGAGCTACGAAGGCCCGGACGTGCCGTACCAGGAGATCTTCGCGCTCAAC
GACGGCCAGGAGCCGCTGGCGATCGGGGAGGACAACAGCAAGGTTCTGCGGCGAATAAGCGAGGTCCGCCTGCCC
AACATCACGTACTTCGAGCTCCGGCACCCGGACGGGCACACCGTCAACGTGATGCAGCAGCTGCCGCCGGATTTC
GACGAGTCGCGCAAATACCCGGTCCTTCTCAAGCTGTACGGTGGCCCGGTCTCGCAGTCCGTGGTCAAGACATTC
CACCCGCCCCGCTGGAGCGCATACGTGTCGTCGGATCCGGAGCTTCAGTACGTCGTCTACGCCGTCGACGGCCGG
GGTACGACCAACCGGGGTCGGGCTTTCCGCTGCGCCGTTTCGCGCCGCCTGGGCCGGCTCGAGACCGAGGACCAG
ACCTGGGCGATGCGCGAGTTGCTGTCGACGCGCCGCTTCCTCGATGCCGACCACGTCGGCATCTACGGGGAGTCG
TACGGCGGCTTCCTGGCGGCCAAGGCCATCGAGGCCGACTCGGGCGTCTTCACCTTCGGCATAAGCGTCTCGCCC
GTGACGGACTGGCGCTTGTACGACTCCATCTTCACCGAGCGTCATATGAAGGCGCTCGGGACCAACGCGGACGGC
TACCGAGAGGCCGCCATCCGCAACTCGGTCGGCTTCAAGAAGTTGGCCGGTGTCTTCTCCCTCGCCCACGGGACC
GGCGACGTCAACGTTCATTACCAGAACACGGCAGCGCTGCTGGACCGGCTCGTCCGCGAGGGCGTGCCGCCGCAC
AAGGTCAGGATGATGGCCTTCACCGACAGCGACCACACGCTCGACTTCCACGGCGCCGACCATCACCTGCACAAA
TTCCTCACAGACCGCCTGTGGGACGAGATCGAGAGAAAGTCCAGCTCGTCGCATCACCAGTGGAGCTGA
Gene >Hirsu2|9025
ATGCGTCTCTCTGTCCTCTGCGCACCATCAGCGCTCGTGCTGTCTCTGTGGTCGCCCGTGTCTGCCATCGAGCCG
CCCCGGCTTCCCCGTCAGCCCACCGGCAACGGAGACCGCCTGATGACCTACCGCGAGGCCGTGACTGATGATGCC
TTCAGGCCTTTCAAGCTCAAACCGAACTGGGTTGCGGCAAAGCGGGATGGCCTGTACACGGTCAGGTCCGACGAC
GGCGGGCTTGCCCTCGAAAGCGTTGACGCGAATGGAGAGGTGGCCATCGCGCCGGCCGCTCAGGTGCCTCAAGGA
ATTAGGAACTGCTGGGTCAATCGCGATTGGGGCGTCGTGCTCATGGTCGGAAACAAGACGAGACGCCACCGGCAC
TCGTACACGGCCGACTACTTCGTCTTCGACAGGCGAAGCGGGCGGACGAGTCCCCTCGTCGACGAGCAGGCGGGC
GACGTTCAGTACGCCGAGCTGGCGCCCCGGGGCGACGCCATCGCCTTCGTCCGCAACAACAACCTCTTCCTCCGC
CACGGCGGCGGGAAGGTCCTCCAGGTGACGACGAGCGGCGGACCGGACATGGCGCACGGAGTGCCGGACTGGGTG
TACGAGGAAGAGGTGCTGTCTGGCCCCTCGGCCCTCTGGTTCTCGCCCGACGGCGAGTCGGTCGCCTTCCTCAGC
TTCAACGACACGGGCGTCGACACTTTCGACGTTCCCCGATACATGGCCGGTCGAGACGAGGCGCCGCCGTATCCC
AACTGGCTTGAGCAGCGCTACCCCAAGGTCGGGTCGCCCAACCCGACCGCTGGGCTCTCCATCCTCGACGTGCGG
ACCGGCAAGGTTGACTCGGTGCCGCTCGAGGCCTTTGCTCCCGATGACACCATCGTCGGCGAGGTGGCCTGGCTG
ACGGAGGGCCACTCGGCTCTCCTCTATCGAGCCTTCAACCGCGTCCAGGACAGGGACAAGCATGTCGTCGTCAAC
CCGCAGATCAGAGAGGCCAGGGTCGTCCGCGAGCGCGACGCCGGAGACTGTTGGCTGGACAACACGCGGAGCATC
CGCTACGCCGGCGCGGCCACCGGAAGCAACAAGACGTACTATGCCGACCTGTCAGACGAGTCCGGCTGGACGCAC
ATCTACCTCTATCCCGTCGACGGCCGCGGTGAGCCCGTCCAGCTCACGTCGGGCGAGTGGGAGGTGCGGTCGATC
CTCCACGTCGACCGGAGCCGCCGTCTCGTCCACTACACTGCCTCGAAGCGCCATAGCACCGAGAGCCACGTGTAC
AGCGTCTCGTACGAGACAGGCAAGTCGGAGCCGCTGGTCGACGACGAGGTCCCGGCCGTCTGGTCGGCCGACTTC
TCGCCCGGCGGAGGCTTCTATATCCTGAGCTACGAAGGCCCGGACGTGCCGTACCAGGAGATCTTCGCGCTCAAC
GACGGCCAGGAGCCGCTGGCGATCGGGGAGGACAACAGCAAGGTTCTGCGGCGAATAAGCGAGGTCCGCCTGCCC
AACATCACGTACTTCGAGCTCCGGCACCCGGACGGGCACACCGTCAACGTGATGCAGCAGCTGCCGCCGGATTTC
GACGAGTCGCGCAAATACCCGGTCCTTCTCAAGCTGTACGGTGGCCCGGTCTCGCAGTCCGTGGTCAAGACATTC
CACCCGCCCCGCTGGAGCGCATACGTGTCGTCGGATCCGGAGCTTCAGTACGTCGTCTACGCCGTCGACGGCCGG
GGTACGACCAACCGGGGTCGGGCTTTCCGCTGCGCCGTTTCGCGCCGCCTGGGCCGGCTCGAGACCGAGGACCAG
ACCTGGGCGATGCGCGAGTTGCTGTCGACGCGCCGCTTCCTCGATGCCGACCACGTCGGCATCTACGGGGAGTCG
TACGGCGGCTTCCTGGCGGCCAAGGCCATCGAGGCCGACTCGGGCGTCTTCACCTTCGGCATAAGCGTCTCGCCC
GTGACGGACTGGCGCTTGTACGACTCCATCTTCACCGAGCGTCATATGAAGGCGCTCGGGACCAACGCGGACGGC
TACCGAGAGGCCGCCATCCGCAACTCGGTCGGCTTCAAGAAGTTGGCCGGTGTCTTCTCCCTCGCCCACGGGACC
GGCGACGTCAACGTTCATTACCAGAACACGGCAGCGCTGCTGGACCGGCTCGTCCGCGAGGGCGTGCCGCCGCAC
AAGGTCAGGATGATGGCCTTCACCGACAGCGACCACACGCTCGACTTCCACGGCGCCGACCATCACCTGCACAAA
TTCCTCACAGACCGCCTGTGGGACGAGATCGAGAGAAAGTCCAGCTCGTCGCATCACCAGTGGAGCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail