Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|9024
Gene name
LocationContig_628:1949..3437
Strand-
Gene length (bp)1488
Transcript length (bp)1488
Coding sequence length (bp)1488
Protein length (aa) 496

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03372 Exo_endo_phos Endonuclease/Exonuclease/phosphatase family 1.4E-07 221 482

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q9GUC9|YFEF9_CAEEL Uncharacterized protein F14F9.5 OS=Caenorhabditis elegans GN=F14F9.5 PE=1 SV=2 218 492 7.0E-38

GO

GO Term Description Terminal node
GO:0003824 catalytic activity Yes
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 20 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|9024
MQLPRSLQALAVFAALGAADSSLSLAGGKPLFTFDYSTSEADPKNWIGVYYSFFGGPDNDTFISPSLAWAYAPEG
KGSVQVSTSNLQQGTYKAYLLAKDGYQRLAGPVEAVLPGQGPMSFLVDEFTTHNARQGDKFEAKVQGLLANAPDT
KTQFSKTASEGDGGDWVQVSGDGTLSGTPSARGETRVTVQAKGSNGSQATLKVKIPLRPTGSPLVEQIGVLSFNL
WEGGSHVNDSHRKQVKYLAGSGVDIVGFQESGGGHAARLGNALGWASWQGRDVGIISRYPVAEVLTGTDVAGGVR
IALDGEASQVIAWNAHLGFTPYGPYDFCFDHMSVDQVLEREAQSGRTPQMVEIMKLMQPHIANADRVPVLLTGDM
NAPSHLDWTDATRQQHCGVGNVRWPSSDEPIKAGLNDSYRQIHPDPAADPGNTWSPIFLDNEGRPEPMDRIDFVY
HKGLQVVDSKQEVVGQPKAEPNQQDNEWPSDHAAVRSTFKGIPRN*
Coding >Hirsu2|9024
ATGCAATTGCCACGCTCGCTTCAGGCTCTGGCCGTCTTCGCCGCTCTGGGCGCCGCCGACAGCTCTCTGTCGCTC
GCCGGCGGCAAGCCCCTGTTCACCTTTGACTATTCCACCTCGGAAGCCGATCCCAAGAACTGGATCGGCGTTTAT
TACAGCTTCTTCGGGGGGCCGGACAACGACACGTTCATCTCGCCCTCGCTGGCCTGGGCCTATGCTCCCGAGGGC
AAGGGAAGCGTCCAGGTATCGACGTCGAATCTGCAACAGGGTACGTACAAGGCGTATCTGCTCGCCAAAGATGGC
TATCAGCGCCTCGCGGGCCCCGTCGAGGCAGTTCTACCCGGCCAGGGCCCCATGTCTTTTCTCGTCGACGAATTC
ACGACGCACAACGCACGCCAGGGCGACAAGTTCGAGGCCAAGGTCCAGGGCCTGCTCGCCAACGCGCCCGACACC
AAGACGCAGTTTAGCAAGACGGCGTCCGAGGGCGACGGCGGCGACTGGGTCCAAGTATCGGGCGACGGAACACTG
TCCGGCACGCCGAGCGCTCGCGGCGAGACGCGCGTGACGGTCCAGGCCAAAGGGTCCAACGGGTCCCAGGCCACG
CTCAAGGTCAAGATCCCGCTGCGGCCGACCGGCTCCCCGCTGGTAGAACAGATCGGCGTGCTCTCCTTCAACCTG
TGGGAAGGCGGCTCGCACGTCAACGACTCCCACCGCAAGCAAGTCAAGTACCTGGCCGGCAGCGGCGTCGACATC
GTCGGCTTCCAGGAGAGCGGGGGCGGGCACGCAGCACGCCTGGGCAACGCCCTGGGCTGGGCGTCGTGGCAGGGC
CGGGACGTGGGCATCATCAGCCGCTACCCCGTCGCCGAGGTGCTCACCGGCACGGACGTGGCGGGCGGGGTGCGC
ATCGCGCTCGACGGCGAGGCGAGCCAAGTCATTGCCTGGAACGCGCACCTGGGATTCACGCCGTACGGTCCGTAC
GACTTCTGCTTCGACCACATGTCCGTGGACCAGGTCCTGGAGCGCGAGGCCCAGTCCGGACGCACGCCGCAGATG
GTCGAGATCATGAAGCTCATGCAGCCGCACATCGCCAACGCCGATCGAGTGCCGGTGCTGCTCACGGGCGACATG
AATGCGCCGTCGCACCTCGACTGGACGGACGCGACTCGCCAGCAGCACTGCGGCGTGGGCAACGTGCGCTGGCCC
AGCTCGGACGAGCCGATCAAGGCAGGGCTGAACGATTCGTACCGACAAATCCACCCGGATCCCGCGGCCGACCCG
GGCAACACGTGGTCGCCCATCTTCCTCGACAACGAAGGCCGCCCTGAGCCCATGGATCGCATCGACTTCGTCTAC
CACAAAGGCCTGCAAGTCGTCGACTCGAAGCAGGAGGTCGTCGGGCAGCCCAAGGCAGAGCCGAACCAGCAGGAC
AACGAGTGGCCGTCGGACCACGCGGCCGTCAGGTCCACCTTCAAGGGCATCCCAAGAAATTGA
Transcript >Hirsu2|9024
ATGCAATTGCCACGCTCGCTTCAGGCTCTGGCCGTCTTCGCCGCTCTGGGCGCCGCCGACAGCTCTCTGTCGCTC
GCCGGCGGCAAGCCCCTGTTCACCTTTGACTATTCCACCTCGGAAGCCGATCCCAAGAACTGGATCGGCGTTTAT
TACAGCTTCTTCGGGGGGCCGGACAACGACACGTTCATCTCGCCCTCGCTGGCCTGGGCCTATGCTCCCGAGGGC
AAGGGAAGCGTCCAGGTATCGACGTCGAATCTGCAACAGGGTACGTACAAGGCGTATCTGCTCGCCAAAGATGGC
TATCAGCGCCTCGCGGGCCCCGTCGAGGCAGTTCTACCCGGCCAGGGCCCCATGTCTTTTCTCGTCGACGAATTC
ACGACGCACAACGCACGCCAGGGCGACAAGTTCGAGGCCAAGGTCCAGGGCCTGCTCGCCAACGCGCCCGACACC
AAGACGCAGTTTAGCAAGACGGCGTCCGAGGGCGACGGCGGCGACTGGGTCCAAGTATCGGGCGACGGAACACTG
TCCGGCACGCCGAGCGCTCGCGGCGAGACGCGCGTGACGGTCCAGGCCAAAGGGTCCAACGGGTCCCAGGCCACG
CTCAAGGTCAAGATCCCGCTGCGGCCGACCGGCTCCCCGCTGGTAGAACAGATCGGCGTGCTCTCCTTCAACCTG
TGGGAAGGCGGCTCGCACGTCAACGACTCCCACCGCAAGCAAGTCAAGTACCTGGCCGGCAGCGGCGTCGACATC
GTCGGCTTCCAGGAGAGCGGGGGCGGGCACGCAGCACGCCTGGGCAACGCCCTGGGCTGGGCGTCGTGGCAGGGC
CGGGACGTGGGCATCATCAGCCGCTACCCCGTCGCCGAGGTGCTCACCGGCACGGACGTGGCGGGCGGGGTGCGC
ATCGCGCTCGACGGCGAGGCGAGCCAAGTCATTGCCTGGAACGCGCACCTGGGATTCACGCCGTACGGTCCGTAC
GACTTCTGCTTCGACCACATGTCCGTGGACCAGGTCCTGGAGCGCGAGGCCCAGTCCGGACGCACGCCGCAGATG
GTCGAGATCATGAAGCTCATGCAGCCGCACATCGCCAACGCCGATCGAGTGCCGGTGCTGCTCACGGGCGACATG
AATGCGCCGTCGCACCTCGACTGGACGGACGCGACTCGCCAGCAGCACTGCGGCGTGGGCAACGTGCGCTGGCCC
AGCTCGGACGAGCCGATCAAGGCAGGGCTGAACGATTCGTACCGACAAATCCACCCGGATCCCGCGGCCGACCCG
GGCAACACGTGGTCGCCCATCTTCCTCGACAACGAAGGCCGCCCTGAGCCCATGGATCGCATCGACTTCGTCTAC
CACAAAGGCCTGCAAGTCGTCGACTCGAAGCAGGAGGTCGTCGGGCAGCCCAAGGCAGAGCCGAACCAGCAGGAC
AACGAGTGGCCGTCGGACCACGCGGCCGTCAGGTCCACCTTCAAGGGCATCCCAAGAAATTGA
Gene >Hirsu2|9024
ATGCAATTGCCACGCTCGCTTCAGGCTCTGGCCGTCTTCGCCGCTCTGGGCGCCGCCGACAGCTCTCTGTCGCTC
GCCGGCGGCAAGCCCCTGTTCACCTTTGACTATTCCACCTCGGAAGCCGATCCCAAGAACTGGATCGGCGTTTAT
TACAGCTTCTTCGGGGGGCCGGACAACGACACGTTCATCTCGCCCTCGCTGGCCTGGGCCTATGCTCCCGAGGGC
AAGGGAAGCGTCCAGGTATCGACGTCGAATCTGCAACAGGGTACGTACAAGGCGTATCTGCTCGCCAAAGATGGC
TATCAGCGCCTCGCGGGCCCCGTCGAGGCAGTTCTACCCGGCCAGGGCCCCATGTCTTTTCTCGTCGACGAATTC
ACGACGCACAACGCACGCCAGGGCGACAAGTTCGAGGCCAAGGTCCAGGGCCTGCTCGCCAACGCGCCCGACACC
AAGACGCAGTTTAGCAAGACGGCGTCCGAGGGCGACGGCGGCGACTGGGTCCAAGTATCGGGCGACGGAACACTG
TCCGGCACGCCGAGCGCTCGCGGCGAGACGCGCGTGACGGTCCAGGCCAAAGGGTCCAACGGGTCCCAGGCCACG
CTCAAGGTCAAGATCCCGCTGCGGCCGACCGGCTCCCCGCTGGTAGAACAGATCGGCGTGCTCTCCTTCAACCTG
TGGGAAGGCGGCTCGCACGTCAACGACTCCCACCGCAAGCAAGTCAAGTACCTGGCCGGCAGCGGCGTCGACATC
GTCGGCTTCCAGGAGAGCGGGGGCGGGCACGCAGCACGCCTGGGCAACGCCCTGGGCTGGGCGTCGTGGCAGGGC
CGGGACGTGGGCATCATCAGCCGCTACCCCGTCGCCGAGGTGCTCACCGGCACGGACGTGGCGGGCGGGGTGCGC
ATCGCGCTCGACGGCGAGGCGAGCCAAGTCATTGCCTGGAACGCGCACCTGGGATTCACGCCGTACGGTCCGTAC
GACTTCTGCTTCGACCACATGTCCGTGGACCAGGTCCTGGAGCGCGAGGCCCAGTCCGGACGCACGCCGCAGATG
GTCGAGATCATGAAGCTCATGCAGCCGCACATCGCCAACGCCGATCGAGTGCCGGTGCTGCTCACGGGCGACATG
AATGCGCCGTCGCACCTCGACTGGACGGACGCGACTCGCCAGCAGCACTGCGGCGTGGGCAACGTGCGCTGGCCC
AGCTCGGACGAGCCGATCAAGGCAGGGCTGAACGATTCGTACCGACAAATCCACCCGGATCCCGCGGCCGACCCG
GGCAACACGTGGTCGCCCATCTTCCTCGACAACGAAGGCCGCCCTGAGCCCATGGATCGCATCGACTTCGTCTAC
CACAAAGGCCTGCAAGTCGTCGACTCGAAGCAGGAGGTCGTCGGGCAGCCCAAGGCAGAGCCGAACCAGCAGGAC
AACGAGTGGCCGTCGGACCACGCGGCCGTCAGGTCCACCTTCAAGGGCATCCCAAGAAATTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail