Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|9020
Gene name
LocationContig_627:11796..13330
Strand+
Gene length (bp)1534
Transcript length (bp)1410
Coding sequence length (bp)1410
Protein length (aa) 470

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13692 Glyco_trans_1_4 Glycosyl transferases group 1 2.0E-06 317 432

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|D4AZD1|ALG1_ARTBC Chitobiosyldiphosphodolichol beta-mannosyltransferase OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_01551 PE=3 SV=1 33 466 2.0E-99
sp|O13933|ALG1_SCHPO Chitobiosyldiphosphodolichol beta-mannosyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=alg1 PE=3 SV=2 45 469 2.0E-86
sp|Q921Q3|ALG1_MOUSE Chitobiosyldiphosphodolichol beta-mannosyltransferase OS=Mus musculus GN=Alg1 PE=1 SV=3 51 466 6.0E-84
sp|Q9BT22|ALG1_HUMAN Chitobiosyldiphosphodolichol beta-mannosyltransferase OS=Homo sapiens GN=ALG1 PE=1 SV=2 51 466 1.0E-80
sp|Q5R7A2|ALG1_PONAB Chitobiosyldiphosphodolichol beta-mannosyltransferase OS=Pongo abelii GN=ALG1 PE=2 SV=1 51 466 8.0E-80
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|D4AZD1|ALG1_ARTBC Chitobiosyldiphosphodolichol beta-mannosyltransferase OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_01551 PE=3 SV=1 33 466 2.0E-99
sp|O13933|ALG1_SCHPO Chitobiosyldiphosphodolichol beta-mannosyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=alg1 PE=3 SV=2 45 469 2.0E-86
sp|Q921Q3|ALG1_MOUSE Chitobiosyldiphosphodolichol beta-mannosyltransferase OS=Mus musculus GN=Alg1 PE=1 SV=3 51 466 6.0E-84
sp|Q9BT22|ALG1_HUMAN Chitobiosyldiphosphodolichol beta-mannosyltransferase OS=Homo sapiens GN=ALG1 PE=1 SV=2 51 466 1.0E-80
sp|Q5R7A2|ALG1_PONAB Chitobiosyldiphosphodolichol beta-mannosyltransferase OS=Pongo abelii GN=ALG1 PE=2 SV=1 51 466 8.0E-80
sp|Q8L7M0|TUN_ARATH UDP-glycosyltransferase TURAN OS=Arabidopsis thaliana GN=TUN PE=2 SV=1 54 466 3.0E-79
sp|Q59Q79|ALG1_CANAL Chitobiosyldiphosphodolichol beta-mannosyltransferase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=ALG1 PE=3 SV=1 40 467 7.0E-79
sp|P90522|ALG1_DICDI Chitobiosyldiphosphodolichol beta-mannosyltransferase OS=Dictyostelium discoideum GN=alg1 PE=2 SV=1 52 432 4.0E-78
sp|Q6C3K2|ALG1_YARLI Chitobiosyldiphosphodolichol beta-mannosyltransferase OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=ALG1 PE=3 SV=1 54 468 8.0E-77
sp|Q6BS98|ALG1_DEBHA Chitobiosyldiphosphodolichol beta-mannosyltransferase OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=ALG1 PE=3 SV=2 52 469 2.0E-72
sp|P16661|ALG1_YEAST Chitobiosyldiphosphodolichol beta-mannosyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ALG1 PE=1 SV=1 44 465 7.0E-72
sp|Q6FLZ2|ALG1_CANGA Chitobiosyldiphosphodolichol beta-mannosyltransferase OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=ALG1 PE=3 SV=1 44 465 5.0E-70
sp|Q6CVU2|ALG1_KLULA Chitobiosyldiphosphodolichol beta-mannosyltransferase OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=ALG1 PE=3 SV=1 52 465 9.0E-64
sp|Q75BA5|ALG1_ASHGO Chitobiosyldiphosphodolichol beta-mannosyltransferase OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=ALG1 PE=3 SV=2 45 465 1.0E-52
sp|C9J202|AG1L2_HUMAN Putative glycosyltransferase ALG1L2 OS=Homo sapiens GN=ALG1L2 PE=3 SV=1 279 424 9.0E-19
sp|Q6GMV1|ALG1L_HUMAN Putative glycosyltransferase ALG1-like OS=Homo sapiens GN=ALG1L PE=2 SV=2 340 466 2.0E-16
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.5

Transmembrane Domains

Domain # Start End Length
1 5 27 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|9020
MIGPFLASVLAGILFVVGLKYGWHLLARLTRCLVRLAPTRHRPAERPEDEHIQILVLGDIGRSPRMQYHAISVAK
HGRKVDIVAYRETARHPALIGNERVAMFALAPQPEWIAWGTLPFFINLPAKVVQQFWTLFYTLMYATPPARWIII
QNPPSIPTFHVALLVSLIRGSKVVVDWHNYGYSILAQKSLYRPLVPLYRWYEIGLGRFLGHANLAVTEAMARELR
GPRFGLKSPVHTLHDRPADIFQPLRSAKDRFEFLSRLPETRGQARDIVDGAVRLVVSSTSWTADEDFGILLDALV
SYANPAASSTSEPPSPILAIITGKGPEKEAYVKRIEELQDGGRLPGIRILTAWLSNRDYASLLASADLGISLHKS
SSGVDLPMKVVDMFGAGLPVAAYSAFESFGELVREGENGCGFETSAQLAEIVGRLLSSTGERELATLRQGAVREG
SLRWDAEWDRVVAGLIQVS*
Coding >Hirsu2|9020
ATGATCGGGCCCTTTCTCGCCTCCGTCCTCGCCGGCATCCTCTTCGTCGTCGGGCTCAAGTACGGCTGGCACCTG
CTGGCCCGGCTGACCCGATGCCTCGTCCGCCTCGCCCCGACCCGCCATCGCCCGGCCGAGAGGCCCGAGGACGAG
CACATCCAGATCCTGGTCCTCGGGGACATCGGGAGGAGCCCGCGCATGCAGTACCATGCCATCAGCGTTGCCAAG
CACGGGCGCAAGGTCGACATTGTGGCCTATAGAGAGACGGCACGCCATCCCGCCCTCATCGGCAACGAGCGCGTC
GCCATGTTCGCCCTCGCGCCTCAGCCGGAGTGGATCGCCTGGGGAACGCTGCCCTTCTTCATCAATCTCCCGGCC
AAGGTCGTCCAGCAGTTCTGGACCCTCTTCTACACGCTCATGTACGCGACGCCGCCGGCGCGGTGGATCATCATC
CAGAACCCGCCATCTATCCCCACCTTCCACGTCGCTCTCCTGGTCTCCCTGATCCGCGGGAGCAAGGTTGTCGTC
GACTGGCACAATTATGGCTACTCGATCCTTGCCCAGAAGAGCTTGTATAGGCCCCTGGTCCCGCTCTACCGCTGG
TACGAGATCGGCCTCGGTCGCTTTCTGGGACACGCCAACCTGGCGGTGACGGAGGCCATGGCACGCGAGTTGCGA
GGTCCCCGCTTTGGGCTGAAGAGCCCGGTGCACACTCTGCACGACCGCCCCGCCGACATATTCCAGCCTCTCCGG
TCGGCCAAGGACAGGTTCGAATTCCTGTCCAGACTGCCGGAGACGAGAGGCCAGGCGCGGGACATTGTCGACGGC
GCGGTCCGGCTGGTCGTGAGCAGCACGTCATGGACGGCCGACGAGGACTTTGGCATACTGCTCGACGCCTTGGTT
TCGTACGCGAACCCGGCGGCGAGCTCGACGTCGGAGCCGCCGTCGCCCATCCTCGCCATCATCACCGGCAAGGGC
CCGGAAAAGGAGGCGTACGTAAAGAGGATCGAAGAACTGCAAGACGGCGGCCGGCTCCCCGGCATCCGCATCCTG
ACGGCCTGGCTGTCGAACCGTGATTACGCCTCGCTGCTGGCCTCGGCCGACCTGGGCATCTCCCTGCACAAGTCC
AGCTCGGGCGTCGACCTGCCGATGAAGGTCGTCGACATGTTCGGGGCCGGCCTGCCGGTGGCCGCCTACTCGGCC
TTCGAGAGCTTCGGCGAGCTGGTCAGGGAGGGCGAGAACGGGTGCGGCTTCGAGACGTCGGCGCAGCTGGCGGAG
ATTGTGGGGAGGCTGCTTAGCAGCACGGGCGAGCGAGAGCTGGCAACGCTGCGGCAGGGGGCCGTCCGAGAAGGC
TCGTTGCGGTGGGACGCCGAGTGGGATCGGGTCGTGGCGGGACTGATACAAGTGTCCTAA
Transcript >Hirsu2|9020
ATGATCGGGCCCTTTCTCGCCTCCGTCCTCGCCGGCATCCTCTTCGTCGTCGGGCTCAAGTACGGCTGGCACCTG
CTGGCCCGGCTGACCCGATGCCTCGTCCGCCTCGCCCCGACCCGCCATCGCCCGGCCGAGAGGCCCGAGGACGAG
CACATCCAGATCCTGGTCCTCGGGGACATCGGGAGGAGCCCGCGCATGCAGTACCATGCCATCAGCGTTGCCAAG
CACGGGCGCAAGGTCGACATTGTGGCCTATAGAGAGACGGCACGCCATCCCGCCCTCATCGGCAACGAGCGCGTC
GCCATGTTCGCCCTCGCGCCTCAGCCGGAGTGGATCGCCTGGGGAACGCTGCCCTTCTTCATCAATCTCCCGGCC
AAGGTCGTCCAGCAGTTCTGGACCCTCTTCTACACGCTCATGTACGCGACGCCGCCGGCGCGGTGGATCATCATC
CAGAACCCGCCATCTATCCCCACCTTCCACGTCGCTCTCCTGGTCTCCCTGATCCGCGGGAGCAAGGTTGTCGTC
GACTGGCACAATTATGGCTACTCGATCCTTGCCCAGAAGAGCTTGTATAGGCCCCTGGTCCCGCTCTACCGCTGG
TACGAGATCGGCCTCGGTCGCTTTCTGGGACACGCCAACCTGGCGGTGACGGAGGCCATGGCACGCGAGTTGCGA
GGTCCCCGCTTTGGGCTGAAGAGCCCGGTGCACACTCTGCACGACCGCCCCGCCGACATATTCCAGCCTCTCCGG
TCGGCCAAGGACAGGTTCGAATTCCTGTCCAGACTGCCGGAGACGAGAGGCCAGGCGCGGGACATTGTCGACGGC
GCGGTCCGGCTGGTCGTGAGCAGCACGTCATGGACGGCCGACGAGGACTTTGGCATACTGCTCGACGCCTTGGTT
TCGTACGCGAACCCGGCGGCGAGCTCGACGTCGGAGCCGCCGTCGCCCATCCTCGCCATCATCACCGGCAAGGGC
CCGGAAAAGGAGGCGTACGTAAAGAGGATCGAAGAACTGCAAGACGGCGGCCGGCTCCCCGGCATCCGCATCCTG
ACGGCCTGGCTGTCGAACCGTGATTACGCCTCGCTGCTGGCCTCGGCCGACCTGGGCATCTCCCTGCACAAGTCC
AGCTCGGGCGTCGACCTGCCGATGAAGGTCGTCGACATGTTCGGGGCCGGCCTGCCGGTGGCCGCCTACTCGGCC
TTCGAGAGCTTCGGCGAGCTGGTCAGGGAGGGCGAGAACGGGTGCGGCTTCGAGACGTCGGCGCAGCTGGCGGAG
ATTGTGGGGAGGCTGCTTAGCAGCACGGGCGAGCGAGAGCTGGCAACGCTGCGGCAGGGGGCCGTCCGAGAAGGC
TCGTTGCGGTGGGACGCCGAGTGGGATCGGGTCGTGGCGGGACTGATACAAGTGTCCTAA
Gene >Hirsu2|9020
ATGATCGGGCCCTTTCTCGCCTCCGTCCTCGCCGGCATCCTCTTCGTCGTCGGGCTCAAGTACGGCTGGCACCTG
CTGGCCCGGCTGACCCGATGCCTCGTCCGCCTCGCCCCGACCCGCCATCGCCCGGCCGAGAGGCCCGAGGACGAG
CACATCCAGATCCTGGTCCTCGGGGACATCGGGAGGAGCCCGCGCATGCAGTACCATGCCATCAGCGTTGCCAAG
CACGGGCGCAAGGTCGACATTGTGGCCTATAGAGGTGAGTGAGCCTGAGCTGCCCTGGCTGCCCTGGCCTTCCGC
GCGTTGACAGACGCCCGCTCGACGCAGAGACGGCACGCCATCCCGCCCTCATCGGCAACGAGCGCGTCGCCATGT
TCGCCCTCGCGCCTCAGCCGGAGTGGATCGCCTGGGGAACGCTGCCCTTCTTCATCAATCTCCCGGCCAAGGTCG
TCCAGCAGTTCTGGACCCTCTTCTACACGCTCATGTACGCGACGCCGCCGGCGCGGTGGATCATCATCCAGGTCA
GTCTCTGCACCGTCTTCTCGCAGCTCCGGTCCCGTTCTCAACGCGGCCGCAGAACCCGCCATCTATCCCCACCTT
CCACGTCGCTCTCCTGGTCTCCCTGATCCGCGGGAGCAAGGTTGTCGTCGACTGGCACAATTATGGCTACTCGAT
CCTTGCCCAGAAGAGCTTGTATAGGCCCCTGGTCCCGCTCTACCGCTGGTACGAGATCGGCCTCGGTCGCTTTCT
GGGACACGCCAACCTGGCGGTGACGGAGGCCATGGCACGCGAGTTGCGAGGTCCCCGCTTTGGGCTGAAGAGCCC
GGTGCACACTCTGCACGACCGCCCCGCCGACATATTCCAGCCTCTCCGGTCGGCCAAGGACAGGTTCGAATTCCT
GTCCAGACTGCCGGAGACGAGAGGCCAGGCGCGGGACATTGTCGACGGCGCGGTCCGGCTGGTCGTGAGCAGCAC
GTCATGGACGGCCGACGAGGACTTTGGCATACTGCTCGACGCCTTGGTTTCGTACGCGAACCCGGCGGCGAGCTC
GACGTCGGAGCCGCCGTCGCCCATCCTCGCCATCATCACCGGCAAGGGCCCGGAAAAGGAGGCGTACGTAAAGAG
GATCGAAGAACTGCAAGACGGCGGCCGGCTCCCCGGCATCCGCATCCTGACGGCCTGGCTGTCGAACCGTGATTA
CGCCTCGCTGCTGGCCTCGGCCGACCTGGGCATCTCCCTGCACAAGTCCAGCTCGGGCGTCGACCTGCCGATGAA
GGTCGTCGACATGTTCGGGGCCGGCCTGCCGGTGGCCGCCTACTCGGCCTTCGAGAGCTTCGGCGAGCTGGTCAG
GGAGGGCGAGAACGGGTGCGGCTTCGAGACGTCGGCGCAGCTGGCGGAGATTGTGGGGAGGCTGCTTAGCAGCAC
GGGCGAGCGAGAGCTGGCAACGCTGCGGCAGGGGGCCGTCCGAGAAGGCTCGTTGCGGTGGGACGCCGAGTGGGA
TCGGGTCGTGGCGGGACTGATACAAGTGTCCTAA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail