Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|9016
Gene name
LocationContig_627:1546..5999
Strand-
Gene length (bp)4453
Transcript length (bp)4347
Coding sequence length (bp)4347
Protein length (aa) 1449

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00005 ABC_tran ABC transporter 7.9E-17 623 758
PF00005 ABC_tran ABC transporter 2.1E-30 1228 1373
PF00664 ABC_membrane ABC transporter transmembrane region 3.6E-09 274 540
PF00664 ABC_membrane ABC transporter transmembrane region 7.2E-25 905 1157

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q92887|MRP2_HUMAN Canalicular multispecific organic anion transporter 1 OS=Homo sapiens GN=ABCC2 PE=1 SV=3 259 1445 2.0E-154
sp|O15438|MRP3_HUMAN Canalicular multispecific organic anion transporter 2 OS=Homo sapiens GN=ABCC3 PE=1 SV=3 148 1436 2.0E-153
sp|B2RX12|MRP3_MOUSE Canalicular multispecific organic anion transporter 2 OS=Mus musculus GN=Abcc3 PE=1 SV=1 160 1446 9.0E-152
sp|O88563|MRP3_RAT Canalicular multispecific organic anion transporter 2 OS=Rattus norvegicus GN=Abcc3 PE=1 SV=1 115 1446 3.0E-147
sp|Q63120|MRP2_RAT Canalicular multispecific organic anion transporter 1 OS=Rattus norvegicus GN=Abcc2 PE=1 SV=1 126 1445 1.0E-145
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q92887|MRP2_HUMAN Canalicular multispecific organic anion transporter 1 OS=Homo sapiens GN=ABCC2 PE=1 SV=3 259 1445 2.0E-154
sp|O15438|MRP3_HUMAN Canalicular multispecific organic anion transporter 2 OS=Homo sapiens GN=ABCC3 PE=1 SV=3 148 1436 2.0E-153
sp|B2RX12|MRP3_MOUSE Canalicular multispecific organic anion transporter 2 OS=Mus musculus GN=Abcc3 PE=1 SV=1 160 1446 9.0E-152
sp|O88563|MRP3_RAT Canalicular multispecific organic anion transporter 2 OS=Rattus norvegicus GN=Abcc3 PE=1 SV=1 115 1446 3.0E-147
sp|Q63120|MRP2_RAT Canalicular multispecific organic anion transporter 1 OS=Rattus norvegicus GN=Abcc2 PE=1 SV=1 126 1445 1.0E-145
sp|Q5F364|MRP1_CHICK Multidrug resistance-associated protein 1 OS=Gallus gallus GN=ABCC1 PE=2 SV=1 193 1446 2.0E-145
sp|Q864R9|MRP1_MACFA Multidrug resistance-associated protein 1 OS=Macaca fascicularis GN=ABCC1 PE=2 SV=1 193 1445 8.0E-145
sp|P39109|YCFI_YEAST Metal resistance protein YCF1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YCF1 PE=1 SV=2 170 1445 3.0E-143
sp|O35379|MRP1_MOUSE Multidrug resistance-associated protein 1 OS=Mus musculus GN=Abcc1 PE=1 SV=1 189 1445 5.0E-143
sp|Q8CG09|MRP1_RAT Multidrug resistance-associated protein 1 OS=Rattus norvegicus GN=Abcc1 PE=1 SV=2 316 1445 9.0E-143
sp|P33527|MRP1_HUMAN Multidrug resistance-associated protein 1 OS=Homo sapiens GN=ABCC1 PE=1 SV=3 317 1445 9.0E-140
sp|Q6UR05|MRP1_CANLF Multidrug resistance-associated protein 1 OS=Canis lupus familiaris GN=ABCC1 PE=2 SV=1 193 1445 1.0E-137
sp|Q10185|ABC2_SCHPO ATP-binding cassette transporter abc2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=abc2 PE=1 SV=1 183 1445 1.0E-135
sp|Q7GB25|AB5C_ARATH ABC transporter C family member 5 OS=Arabidopsis thaliana GN=ABCC5 PE=2 SV=2 192 1439 4.0E-134
sp|Q8ST87|ABCCA_DICDI ABC transporter C family member 10 OS=Dictyostelium discoideum GN=abcC10 PE=3 SV=1 191 1434 2.0E-133
sp|Q42093|AB2C_ARATH ABC transporter C family member 2 OS=Arabidopsis thaliana GN=ABCC2 PE=1 SV=2 193 1446 2.0E-133
sp|O60706|ABCC9_HUMAN ATP-binding cassette sub-family C member 9 OS=Homo sapiens GN=ABCC9 PE=1 SV=2 329 1434 5.0E-132
sp|Q9LYS2|AB10C_ARATH ABC transporter C family member 10 OS=Arabidopsis thaliana GN=ABCC10 PE=2 SV=2 196 1439 5.0E-132
sp|P82451|ABCC9_RABIT ATP-binding cassette sub-family C member 9 OS=Oryctolagus cuniculus GN=ABCC9 PE=2 SV=1 329 1439 9.0E-132
sp|Q9P5N0|ABC3_SCHPO ATP-binding cassette transporter abc3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=abc3 PE=2 SV=1 191 1445 1.0E-131
sp|Q8HXQ5|MRP1_BOVIN Multidrug resistance-associated protein 1 OS=Bos taurus GN=ABCC1 PE=2 SV=1 193 1445 2.0E-131
sp|Q8LGU1|AB8C_ARATH ABC transporter C family member 8 OS=Arabidopsis thaliana GN=ABCC8 PE=2 SV=3 197 1439 3.0E-131
sp|P70170|ABCC9_MOUSE ATP-binding cassette sub-family C member 9 OS=Mus musculus GN=Abcc9 PE=1 SV=2 329 1439 4.0E-131
sp|Q63563|ABCC9_RAT ATP-binding cassette sub-family C member 9 OS=Rattus norvegicus GN=Abcc9 PE=1 SV=1 329 1439 9.0E-131
sp|P91660|L259_DROME Probable multidrug resistance-associated protein lethal(2)03659 OS=Drosophila melanogaster GN=l(2)03659 PE=2 SV=3 211 1444 2.0E-130
sp|Q9LZJ5|AB14C_ARATH ABC transporter C family member 14 OS=Arabidopsis thaliana GN=ABCC14 PE=1 SV=1 201 1439 3.0E-129
sp|Q9C8G9|AB1C_ARATH ABC transporter C family member 1 OS=Arabidopsis thaliana GN=ABCC1 PE=1 SV=1 193 1446 1.0E-128
sp|Q54U44|ABCCC_DICDI ABC transporter C family member 12 OS=Dictyostelium discoideum GN=abcC12 PE=3 SV=1 192 1434 2.0E-128
sp|O15439|MRP4_HUMAN Multidrug resistance-associated protein 4 OS=Homo sapiens GN=ABCC4 PE=1 SV=3 192 1444 1.0E-127
sp|P32386|YBT1_YEAST ATP-dependent bile acid permease OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YBT1 PE=1 SV=2 288 1444 3.0E-126
sp|Q9C8H0|AB12C_ARATH ABC transporter C family member 12 OS=Arabidopsis thaliana GN=ABCC12 PE=2 SV=1 193 1444 3.0E-126
sp|Q7DM58|AB4C_ARATH ABC transporter C family member 4 OS=Arabidopsis thaliana GN=ABCC4 PE=2 SV=2 197 1439 7.0E-126
sp|Q9C8H1|AB11C_ARATH ABC transporter C family member 11 OS=Arabidopsis thaliana GN=ABCC11 PE=2 SV=2 174 1435 8.0E-126
sp|Q54JR2|ABCC3_DICDI ABC transporter C family member 3 OS=Dictyostelium discoideum GN=abcC3 PE=3 SV=1 191 1430 8.0E-126
sp|Q92337|ABC1_SCHPO ATP-binding cassette transporter abc1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=abc1 PE=3 SV=1 183 1447 7.0E-125
sp|Q09427|ABCC8_CRICR ATP-binding cassette sub-family C member 8 OS=Cricetus cricetus GN=ABCC8 PE=1 SV=3 198 1436 2.0E-124
sp|Q10RX7|AB13C_ORYSJ ABC transporter C family member 13 OS=Oryza sativa subsp. japonica GN=ABCC13 PE=2 SV=1 180 1439 6.0E-124
sp|A2XCD4|AB13C_ORYSI ABC transporter C family member 13 OS=Oryza sativa subsp. indica GN=ABCC13 PE=3 SV=1 180 1439 6.0E-124
sp|Q09428|ABCC8_HUMAN ATP-binding cassette sub-family C member 8 OS=Homo sapiens GN=ABCC8 PE=1 SV=6 338 1436 3.0E-123
sp|A7KVC2|AB4C_MAIZE ABC transporter C family MRP4 OS=Zea mays GN=MRP4 PE=2 SV=1 192 1436 4.0E-123
sp|P38735|VMR1_YEAST ABC transporter ATP-binding protein/permease VMR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VMR1 PE=2 SV=1 192 1444 1.0E-122
sp|Q9LK64|AB3C_ARATH ABC transporter C family member 3 OS=Arabidopsis thaliana GN=ABCC3 PE=1 SV=1 192 1439 1.0E-121
sp|Q54LE6|ABCC5_DICDI ABC transporter C family member 5 OS=Dictyostelium discoideum GN=abcC5 PE=3 SV=1 191 1444 2.0E-120
sp|O95255|MRP6_HUMAN Multidrug resistance-associated protein 6 OS=Homo sapiens GN=ABCC6 PE=1 SV=2 179 1445 3.0E-120
sp|Q8T6H3|ABCC6_DICDI ABC transporter C family member 6 OS=Dictyostelium discoideum GN=abcC6 PE=3 SV=1 193 1443 6.0E-119
sp|Q9SKX0|AB13C_ARATH ABC transporter C family member 13 OS=Arabidopsis thaliana GN=ABCC13 PE=2 SV=3 312 1435 4.0E-116
sp|Q54NL1|ABCC9_DICDI ABC transporter C family member 9 OS=Dictyostelium discoideum GN=abcC9 PE=3 SV=1 189 1443 6.0E-115
sp|A7A063|NFT1_YEAS7 ABC transporter NFT1 OS=Saccharomyces cerevisiae (strain YJM789) GN=NFT1 PE=3 SV=1 368 1444 6.0E-115
sp|Q7FB56|AB15C_ARATH Putative ABC transporter C family member 15 OS=Arabidopsis thaliana GN=ABCC15 PE=5 SV=2 369 1436 8.0E-115
sp|P0CE70|NFT1_YEASX ABC transporter NFT1 OS=Saccharomyces cerevisiae GN=NFT1 PE=3 SV=1 368 1444 1.0E-114
sp|C8ZCR2|NFT1_YEAS8 ABC transporter NFT1 OS=Saccharomyces cerevisiae (strain Lalvin EC1118 / Prise de mousse) GN=NFT1 PE=3 SV=1 368 1444 1.0E-114
sp|Q9R1S7|MRP6_MOUSE Multidrug resistance-associated protein 6 OS=Mus musculus GN=Abcc6 PE=1 SV=3 193 1446 2.0E-114
sp|O88269|MRP6_RAT Multidrug resistance-associated protein 6 OS=Rattus norvegicus GN=Abcc6 PE=1 SV=1 193 1446 5.0E-114
sp|P14772|BPT1_YEAST Bile pigment transporter 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=BPT1 PE=1 SV=2 160 1444 8.0E-114
sp|Q9QYM0|MRP5_RAT Multidrug resistance-associated protein 5 OS=Rattus norvegicus GN=Abcc5 PE=2 SV=1 325 1440 8.0E-114
sp|Q54V86|ABCCD_DICDI ABC transporter C family member 13 OS=Dictyostelium discoideum GN=abcC13 PE=3 SV=1 193 1443 2.0E-113
sp|Q9R1X5|MRP5_MOUSE Multidrug resistance-associated protein 5 OS=Mus musculus GN=Abcc5 PE=1 SV=2 325 1435 1.0E-112
sp|Q54EK2|ABCC7_DICDI ABC transporter C family member 7 OS=Dictyostelium discoideum GN=abcC7 PE=3 SV=1 192 1422 1.0E-112
sp|P53049|YOR1_YEAST Oligomycin resistance ATP-dependent permease YOR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YOR1 PE=1 SV=1 189 1445 2.0E-112
sp|Q9M1C7|AB9C_ARATH ABC transporter C family member 9 OS=Arabidopsis thaliana GN=ABCC9 PE=2 SV=2 176 1436 8.0E-112
sp|Q54VJ0|ABCC2_DICDI ABC transporter C family member 2 OS=Dictyostelium discoideum GN=abcC2 PE=3 SV=1 589 1443 1.0E-111
sp|O15440|MRP5_HUMAN Multidrug resistance-associated protein 5 OS=Homo sapiens GN=ABCC5 PE=1 SV=2 325 1435 1.0E-110
sp|Q8T6H8|ABCC1_DICDI ABC transporter C family member 1 OS=Dictyostelium discoideum GN=abcC1 PE=3 SV=1 171 1439 5.0E-110
sp|Q96J66|ABCCB_HUMAN ATP-binding cassette sub-family C member 11 OS=Homo sapiens GN=ABCC11 PE=1 SV=1 183 1432 3.0E-109
sp|Q5T3U5|MRP7_HUMAN Multidrug resistance-associated protein 7 OS=Homo sapiens GN=ABCC10 PE=1 SV=1 176 1429 5.0E-107
sp|Q8VZZ4|AB6C_ARATH ABC transporter C family member 6 OS=Arabidopsis thaliana GN=ABCC6 PE=2 SV=3 192 1439 2.0E-106
sp|Q6Y306|MRP9_RAT Multidrug resistance-associated protein 9 OS=Rattus norvegicus GN=Abcc12 PE=2 SV=1 185 1439 2.0E-105
sp|Q80WJ6|MRP9_MOUSE Multidrug resistance-associated protein 9 OS=Mus musculus GN=Abcc12 PE=2 SV=1 185 1439 7.0E-105
sp|Q9LK62|AB7C_ARATH ABC transporter C family member 7 OS=Arabidopsis thaliana GN=ABCC7 PE=1 SV=1 192 1439 2.0E-104
sp|Q9P7V2|ABC4_SCHPO ATP-binding cassette transporter abc4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=abc4 PE=3 SV=1 368 1446 8.0E-104
sp|P21441|MDR_LEITA Multidrug resistance protein OS=Leishmania tarentolae GN=PGPA PE=3 SV=2 259 1444 3.0E-100
sp|Q54K24|ABCCE_DICDI ABC transporter C family member 14 OS=Dictyostelium discoideum GN=abcC14 PE=3 SV=1 193 1443 5.0E-100
sp|Q96J65|MRP9_HUMAN Multidrug resistance-associated protein 9 OS=Homo sapiens GN=ABCC12 PE=1 SV=2 440 1439 1.0E-95
sp|Q28689|MRP2_RABIT Canalicular multispecific organic anion transporter 1 OS=Oryctolagus cuniculus GN=ABCC2 PE=2 SV=1 912 1445 3.0E-82
sp|Q54P13|ABCC8_DICDI ABC transporter C family member 8 OS=Dictyostelium discoideum GN=abcC8 PE=3 SV=1 921 1439 4.0E-76
sp|Q09429|ABCC8_RAT ATP-binding cassette sub-family C member 8 OS=Rattus norvegicus GN=Abcc8 PE=1 SV=4 931 1436 1.0E-72
sp|Q8VI47|MRP2_MOUSE Canalicular multispecific organic anion transporter 1 OS=Mus musculus GN=Abcc2 PE=1 SV=2 879 1445 1.0E-72
sp|Q54VC1|ABCCF_DICDI ABC transporter C family member 15 OS=Dictyostelium discoideum GN=abcC15 PE=3 SV=1 913 1435 2.0E-71
sp|Q5A762|MLT1_CANAL Multiple drug resistance-associated protein-like transporter 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=MLT1 PE=1 SV=1 842 1444 7.0E-67
sp|Q54P13|ABCC8_DICDI ABC transporter C family member 8 OS=Dictyostelium discoideum GN=abcC8 PE=3 SV=1 7 833 7.0E-66
sp|Q07DZ6|CFTR_ORNAN Cystic fibrosis transmembrane conductance regulator OS=Ornithorhynchus anatinus GN=CFTR PE=3 SV=1 930 1438 2.0E-64
sp|Q5U820|CFTR_CANLF Cystic fibrosis transmembrane conductance regulator OS=Canis lupus familiaris GN=CFTR PE=2 SV=2 930 1438 2.0E-64
sp|Q8R4P9|MRP7_MOUSE Multidrug resistance-associated protein 7 OS=Mus musculus GN=Abcc10 PE=1 SV=1 976 1429 1.0E-63
sp|Q5D1Z7|CFTR_TRIVU Cystic fibrosis transmembrane conductance regulator OS=Trichosurus vulpecula GN=CFTR PE=2 SV=1 869 1439 1.0E-63
sp|Q07E42|CFTR_DASNO Cystic fibrosis transmembrane conductance regulator OS=Dasypus novemcinctus GN=CFTR PE=3 SV=1 931 1438 2.0E-63
sp|Q2IBE4|CFTR_PONAB Cystic fibrosis transmembrane conductance regulator OS=Pongo abelii GN=CFTR PE=3 SV=1 930 1438 3.0E-63
sp|Q9TSP5|CFTR_PAPAN Cystic fibrosis transmembrane conductance regulator OS=Papio anubis GN=CFTR PE=3 SV=1 834 1438 4.0E-63
sp|P13569|CFTR_HUMAN Cystic fibrosis transmembrane conductance regulator OS=Homo sapiens GN=CFTR PE=1 SV=3 930 1438 4.0E-63
sp|Q07DY5|CFTR_COLGU Cystic fibrosis transmembrane conductance regulator OS=Colobus guereza GN=CFTR PE=3 SV=1 834 1438 4.0E-63
sp|Q2IBA1|CFTR_CHLAE Cystic fibrosis transmembrane conductance regulator OS=Chlorocebus aethiops GN=CFTR PE=3 SV=1 834 1438 4.0E-63
sp|Q00553|CFTR_MACMU Cystic fibrosis transmembrane conductance regulator OS=Macaca mulatta GN=CFTR PE=2 SV=2 834 1438 4.0E-63
sp|Q7JII7|CFTR_MACFU Cystic fibrosis transmembrane conductance regulator OS=Macaca fuscata fuscata GN=CFTR PE=3 SV=1 834 1438 4.0E-63
sp|Q7JII8|CFTR_MACFA Cystic fibrosis transmembrane conductance regulator OS=Macaca fascicularis GN=CFTR PE=3 SV=1 834 1438 4.0E-63
sp|Q2QLE5|CFTR_PANTR Cystic fibrosis transmembrane conductance regulator OS=Pan troglodytes GN=CFTR PE=3 SV=1 930 1438 5.0E-63
sp|Q9TUQ2|CFTR_MACNE Cystic fibrosis transmembrane conductance regulator OS=Macaca nemestrina GN=CFTR PE=3 SV=1 834 1438 6.0E-63
sp|Q2QL74|CFTR_DIDVI Cystic fibrosis transmembrane conductance regulator OS=Didelphis virginiana GN=CFTR PE=3 SV=1 926 1438 7.0E-63
sp|Q2QLA3|CFTR_HORSE Cystic fibrosis transmembrane conductance regulator OS=Equus caballus GN=CFTR PE=3 SV=1 882 1438 9.0E-63
sp|Q00552|CFTR_CAVPO Cystic fibrosis transmembrane conductance regulator OS=Cavia porcellus GN=CFTR PE=2 SV=2 930 1438 1.0E-62
sp|Q2IBF6|CFTR_GORGO Cystic fibrosis transmembrane conductance regulator OS=Gorilla gorilla gorilla GN=CFTR PE=3 SV=1 930 1438 3.0E-62
sp|Q00PJ2|CFTR_ATEAB Cystic fibrosis transmembrane conductance regulator OS=Atelerix albiventris GN=CFTR PE=3 SV=1 952 1438 8.0E-62
sp|Q07DV2|CFTR_AOTNA Cystic fibrosis transmembrane conductance regulator OS=Aotus nancymaae GN=CFTR PE=3 SV=1 834 1438 1.0E-61
sp|P26363|CFTR_XENLA Cystic fibrosis transmembrane conductance regulator OS=Xenopus laevis GN=cftr PE=2 SV=1 930 1438 1.0E-61
sp|Q00554|CFTR_RABIT Cystic fibrosis transmembrane conductance regulator OS=Oryctolagus cuniculus GN=CFTR PE=2 SV=4 834 1438 1.0E-61
sp|Q2QLB4|CFTR_CALMO Cystic fibrosis transmembrane conductance regulator OS=Callicebus moloch GN=CFTR PE=3 SV=1 834 1438 1.0E-61
sp|Q2QL83|CFTR_MICMU Cystic fibrosis transmembrane conductance regulator OS=Microcebus murinus GN=CFTR PE=3 SV=1 930 1438 2.0E-61
sp|Q09YH0|CFTR_SAIBB Cystic fibrosis transmembrane conductance regulator OS=Saimiri boliviensis boliviensis GN=CFTR PE=3 SV=1 930 1438 2.0E-61
sp|Q6PQZ2|CFTR_PIG Cystic fibrosis transmembrane conductance regulator OS=Sus scrofa GN=CFTR PE=2 SV=1 930 1438 2.0E-61
sp|Q2QLF9|CFTR_CALJA Cystic fibrosis transmembrane conductance regulator OS=Callithrix jacchus GN=CFTR PE=3 SV=1 834 1438 2.0E-61
sp|Q2IBB3|CFTR_RHIFE Cystic fibrosis transmembrane conductance regulator OS=Rhinolophus ferrumequinum GN=CFTR PE=3 SV=1 834 1438 8.0E-61
sp|Q07DX5|CFTR_NOMLE Cystic fibrosis transmembrane conductance regulator OS=Nomascus leucogenys GN=CFTR PE=3 SV=1 930 1438 1.0E-60
sp|Q108U0|CFTR_LOXAF Cystic fibrosis transmembrane conductance regulator OS=Loxodonta africana GN=CFTR PE=3 SV=1 931 1438 3.0E-60
sp|Q2QLH0|CFTR_OTOGA Cystic fibrosis transmembrane conductance regulator OS=Otolemur garnettii GN=CFTR PE=3 SV=1 930 1438 4.0E-60
sp|P34158|CFTR_RAT Cystic fibrosis transmembrane conductance regulator OS=Rattus norvegicus GN=Cftr PE=1 SV=3 930 1438 5.0E-60
sp|P26361|CFTR_MOUSE Cystic fibrosis transmembrane conductance regulator OS=Mus musculus GN=Cftr PE=1 SV=2 930 1438 1.0E-59
sp|Q09YK5|CFTR_ATEGE Cystic fibrosis transmembrane conductance regulator OS=Ateles geoffroyi GN=CFTR PE=3 SV=1 834 1438 2.0E-59
sp|P35071|CFTR_BOVIN Cystic fibrosis transmembrane conductance regulator OS=Bos taurus GN=CFTR PE=2 SV=2 930 1438 4.0E-59
sp|P26362|CFTR_SQUAC Cystic fibrosis transmembrane conductance regulator OS=Squalus acanthias GN=CFTR PE=1 SV=1 855 1439 9.0E-59
sp|Q07E16|CFTR_MUSPF Cystic fibrosis transmembrane conductance regulator OS=Mustela putorius furo GN=CFTR PE=3 SV=1 930 1438 2.0E-58
sp|Q09YJ4|CFTR_MUNMU Cystic fibrosis transmembrane conductance regulator OS=Muntiacus muntjak GN=CFTR PE=3 SV=1 930 1438 6.0E-58
sp|Q07DW5|CFTR_MUNRE Cystic fibrosis transmembrane conductance regulator OS=Muntiacus reevesi GN=CFTR PE=3 SV=1 930 1438 7.0E-58
sp|Q28689|MRP2_RABIT Canalicular multispecific organic anion transporter 1 OS=Oryctolagus cuniculus GN=ABCC2 PE=2 SV=1 259 850 2.0E-57
sp|Q8VI47|MRP2_MOUSE Canalicular multispecific organic anion transporter 1 OS=Mus musculus GN=Abcc2 PE=1 SV=2 24 823 3.0E-57
sp|Q00555|CFTR_SHEEP Cystic fibrosis transmembrane conductance regulator OS=Ovis aries GN=CFTR PE=1 SV=2 930 1438 4.0E-57
sp|Q2QLC5|CFTR_CARPS Cystic fibrosis transmembrane conductance regulator OS=Carollia perspicillata GN=CFTR PE=3 SV=1 930 1438 8.0E-56
sp|P0CE68|NFT1_YEAST ABC transporter NFT1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NFT1 PE=3 SV=1 368 1123 2.0E-53
sp|P0CE69|YK104_YEAST Putative uncharacterized protein YKR104W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YKR104W PE=5 SV=1 1174 1444 2.0E-49
sp|Q09429|ABCC8_RAT ATP-binding cassette sub-family C member 8 OS=Rattus norvegicus GN=Abcc8 PE=1 SV=4 198 876 2.0E-46
sp|Q9LSJ5|AB18B_ARATH ABC transporter B family member 18 OS=Arabidopsis thaliana GN=ABCB18 PE=3 SV=1 619 1432 2.0E-44
sp|Q9VL32|SUR_DROME ATP-binding cassette sub-family C member Sur OS=Drosophila melanogaster GN=Sur PE=1 SV=4 1200 1429 4.0E-43
sp|Q6YUU5|MDR_ORYSJ Putative multidrug resistance protein OS=Oryza sativa subsp. japonica GN=Os02g0190300 PE=3 SV=1 619 1443 5.0E-43
sp|Q9LSJ2|AB22B_ARATH ABC transporter B family member 22 OS=Arabidopsis thaliana GN=ABCB22 PE=3 SV=2 619 1435 7.0E-43
sp|A1KF14|MDREP_MYCBP Multidrug efflux ATP-binding/permease protein BCG_0231 OS=Mycobacterium bovis (strain BCG / Pasteur 1173P2) GN=BCG_0231 PE=1 SV=1 594 1439 7.0E-43
sp|O53645|MDREP_MYCTU Multidrug efflux ATP-binding/permease protein Rv0194 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv0194 PE=1 SV=1 391 1439 8.0E-43
sp|Q9LHD1|AB15B_ARATH ABC transporter B family member 15 OS=Arabidopsis thaliana GN=ABCB15 PE=3 SV=1 619 1435 2.0E-42
sp|Q65U21|MSBA_MANSM Lipid A export ATP-binding/permease protein MsbA OS=Mannheimia succiniciproducens (strain MBEL55E) GN=msbA PE=3 SV=2 934 1443 4.0E-42
sp|P44407|MSBA_HAEIN Lipid A export ATP-binding/permease protein MsbA OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=msbA PE=3 SV=1 948 1443 6.0E-42
sp|Q4QPI4|MSBA_HAEI8 Lipid A export ATP-binding/permease protein MsbA OS=Haemophilus influenzae (strain 86-028NP) GN=msbA PE=3 SV=1 948 1443 3.0E-41
sp|Q8R4P9|MRP7_MOUSE Multidrug resistance-associated protein 7 OS=Mus musculus GN=Abcc10 PE=1 SV=1 194 806 2.0E-40
sp|Q108U0|CFTR_LOXAF Cystic fibrosis transmembrane conductance regulator OS=Loxodonta africana GN=CFTR PE=3 SV=1 191 823 5.0E-40
sp|Q9LSJ8|AB16B_ARATH ABC transporter B family member 16 OS=Arabidopsis thaliana GN=ABCB16 PE=2 SV=1 619 1435 9.0E-40
sp|Q2SZW0|MSBA_BURTA Lipid A export ATP-binding/permease protein MsbA OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=msbA PE=3 SV=1 1092 1443 2.0E-39
sp|Q63VX7|MSBA_BURPS Lipid A export ATP-binding/permease protein MsbA OS=Burkholderia pseudomallei (strain K96243) GN=msbA PE=3 SV=1 1092 1443 2.0E-39
sp|Q3JUI6|MSBA_BURP1 Lipid A export ATP-binding/permease protein MsbA OS=Burkholderia pseudomallei (strain 1710b) GN=msbA PE=3 SV=2 1092 1443 2.0E-39
sp|Q62IG3|MSBA_BURMA Lipid A export ATP-binding/permease protein MsbA OS=Burkholderia mallei (strain ATCC 23344) GN=msbA PE=3 SV=2 1092 1443 2.0E-39
sp|Q1GZI0|MSBA_METFK Lipid A export ATP-binding/permease protein MsbA OS=Methylobacillus flagellatus (strain KT / ATCC 51484 / DSM 6875) GN=msbA PE=3 SV=1 914 1443 3.0E-39
sp|Q7VL52|MSBA_HAEDU Lipid A export ATP-binding/permease protein MsbA OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=msbA PE=3 SV=1 949 1443 3.0E-39
sp|Q2IBA1|CFTR_CHLAE Cystic fibrosis transmembrane conductance regulator OS=Chlorocebus aethiops GN=CFTR PE=3 SV=1 191 863 5.0E-39
sp|Q2QLF9|CFTR_CALJA Cystic fibrosis transmembrane conductance regulator OS=Callithrix jacchus GN=CFTR PE=3 SV=1 191 825 8.0E-39
sp|Q2IBE4|CFTR_PONAB Cystic fibrosis transmembrane conductance regulator OS=Pongo abelii GN=CFTR PE=3 SV=1 191 863 1.0E-38
sp|Q9TSP5|CFTR_PAPAN Cystic fibrosis transmembrane conductance regulator OS=Papio anubis GN=CFTR PE=3 SV=1 191 863 1.0E-38
sp|Q07DY5|CFTR_COLGU Cystic fibrosis transmembrane conductance regulator OS=Colobus guereza GN=CFTR PE=3 SV=1 191 863 1.0E-38
sp|Q00553|CFTR_MACMU Cystic fibrosis transmembrane conductance regulator OS=Macaca mulatta GN=CFTR PE=2 SV=2 191 863 1.0E-38
sp|Q7JII7|CFTR_MACFU Cystic fibrosis transmembrane conductance regulator OS=Macaca fuscata fuscata GN=CFTR PE=3 SV=1 191 863 1.0E-38
sp|Q7JII8|CFTR_MACFA Cystic fibrosis transmembrane conductance regulator OS=Macaca fascicularis GN=CFTR PE=3 SV=1 191 863 1.0E-38
sp|Q9TUQ2|CFTR_MACNE Cystic fibrosis transmembrane conductance regulator OS=Macaca nemestrina GN=CFTR PE=3 SV=1 191 863 1.0E-38
sp|Q07DX5|CFTR_NOMLE Cystic fibrosis transmembrane conductance regulator OS=Nomascus leucogenys GN=CFTR PE=3 SV=1 191 863 1.0E-38
sp|Q09YJ4|CFTR_MUNMU Cystic fibrosis transmembrane conductance regulator OS=Muntiacus muntjak GN=CFTR PE=3 SV=1 191 826 1.0E-38
sp|P59852|LAGD_LACLL Lactococcin-G-processing and transport ATP-binding protein LagD OS=Lactococcus lactis subsp. lactis GN=lagD PE=1 SV=1 940 1441 2.0E-38
sp|P13569|CFTR_HUMAN Cystic fibrosis transmembrane conductance regulator OS=Homo sapiens GN=CFTR PE=1 SV=3 191 863 2.0E-38
sp|Q6LPK6|MSBA_PHOPR Lipid A export ATP-binding/permease protein MsbA OS=Photobacterium profundum GN=msbA PE=3 SV=1 930 1443 3.0E-38
sp|Q2QLE5|CFTR_PANTR Cystic fibrosis transmembrane conductance regulator OS=Pan troglodytes GN=CFTR PE=3 SV=1 191 863 3.0E-38
sp|Q2IBF6|CFTR_GORGO Cystic fibrosis transmembrane conductance regulator OS=Gorilla gorilla gorilla GN=CFTR PE=3 SV=1 191 863 3.0E-38
sp|Q07DV2|CFTR_AOTNA Cystic fibrosis transmembrane conductance regulator OS=Aotus nancymaae GN=CFTR PE=3 SV=1 191 825 3.0E-38
sp|P35071|CFTR_BOVIN Cystic fibrosis transmembrane conductance regulator OS=Bos taurus GN=CFTR PE=2 SV=2 191 826 3.0E-38
sp|Q09YH0|CFTR_SAIBB Cystic fibrosis transmembrane conductance regulator OS=Saimiri boliviensis boliviensis GN=CFTR PE=3 SV=1 191 825 5.0E-38
sp|Q6PQZ2|CFTR_PIG Cystic fibrosis transmembrane conductance regulator OS=Sus scrofa GN=CFTR PE=2 SV=1 191 833 5.0E-38
sp|Q09YK5|CFTR_ATEGE Cystic fibrosis transmembrane conductance regulator OS=Ateles geoffroyi GN=CFTR PE=3 SV=1 191 825 6.0E-38
sp|Q07DW5|CFTR_MUNRE Cystic fibrosis transmembrane conductance regulator OS=Muntiacus reevesi GN=CFTR PE=3 SV=1 191 826 6.0E-38
sp|Q9KQW9|MSBA_VIBCH Lipid A export ATP-binding/permease protein MsbA OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=msbA PE=1 SV=1 969 1443 7.0E-38
sp|O07549|YHEH_BACSU Probable multidrug resistance ABC transporter ATP-binding/permease protein YheH OS=Bacillus subtilis (strain 168) GN=yheH PE=1 SV=1 944 1443 8.0E-38
sp|Q2IBB3|CFTR_RHIFE Cystic fibrosis transmembrane conductance regulator OS=Rhinolophus ferrumequinum GN=CFTR PE=3 SV=1 191 823 8.0E-38
sp|Q2QLB4|CFTR_CALMO Cystic fibrosis transmembrane conductance regulator OS=Callicebus moloch GN=CFTR PE=3 SV=1 191 825 9.0E-38
sp|Q07E42|CFTR_DASNO Cystic fibrosis transmembrane conductance regulator OS=Dasypus novemcinctus GN=CFTR PE=3 SV=1 191 825 1.0E-37
sp|P35598|EXP8_STRPN Putative ABC transporter ATP-binding protein exp8 OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=exp8 PE=3 SV=3 978 1444 2.0E-37
sp|Q00554|CFTR_RABIT Cystic fibrosis transmembrane conductance regulator OS=Oryctolagus cuniculus GN=CFTR PE=2 SV=4 191 823 4.0E-37
sp|Q2QLH0|CFTR_OTOGA Cystic fibrosis transmembrane conductance regulator OS=Otolemur garnettii GN=CFTR PE=3 SV=1 191 825 4.0E-37
sp|Q07E16|CFTR_MUSPF Cystic fibrosis transmembrane conductance regulator OS=Mustela putorius furo GN=CFTR PE=3 SV=1 191 863 5.0E-37
sp|Q00564|LCNC_LACLL Lactococcin-A transport/processing ATP-binding protein LcnC OS=Lactococcus lactis subsp. lactis GN=lcnC PE=3 SV=1 970 1439 6.0E-37
sp|Q00PJ2|CFTR_ATEAB Cystic fibrosis transmembrane conductance regulator OS=Atelerix albiventris GN=CFTR PE=3 SV=1 191 825 6.0E-37
sp|P26363|CFTR_XENLA Cystic fibrosis transmembrane conductance regulator OS=Xenopus laevis GN=cftr PE=2 SV=1 191 851 9.0E-37
sp|Q2QLA3|CFTR_HORSE Cystic fibrosis transmembrane conductance regulator OS=Equus caballus GN=CFTR PE=3 SV=1 191 825 1.0E-36
sp|Q00555|CFTR_SHEEP Cystic fibrosis transmembrane conductance regulator OS=Ovis aries GN=CFTR PE=1 SV=2 191 826 1.0E-36
sp|Q2QLC5|CFTR_CARPS Cystic fibrosis transmembrane conductance regulator OS=Carollia perspicillata GN=CFTR PE=3 SV=1 191 825 1.0E-36
sp|Q7N6C6|MSBA_PHOLL Lipid A export ATP-binding/permease protein MsbA OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=msbA PE=3 SV=1 1138 1443 2.0E-36
sp|Q2QL83|CFTR_MICMU Cystic fibrosis transmembrane conductance regulator OS=Microcebus murinus GN=CFTR PE=3 SV=1 191 825 2.0E-36
sp|P26362|CFTR_SQUAC Cystic fibrosis transmembrane conductance regulator OS=Squalus acanthias GN=CFTR PE=1 SV=1 191 827 2.0E-36
sp|Q8DAV2|MSBA_VIBVU Lipid A export ATP-binding/permease protein MsbA OS=Vibrio vulnificus (strain CMCP6) GN=msbA PE=3 SV=1 1207 1443 7.0E-36
sp|Q142P6|MSBA_BURXL Lipid A export ATP-binding/permease protein MsbA OS=Burkholderia xenovorans (strain LB400) GN=msbA PE=3 SV=1 1111 1443 8.0E-36
sp|Q2SIN5|MSBA_HAHCH Lipid A export ATP-binding/permease protein MsbA OS=Hahella chejuensis (strain KCTC 2396) GN=msbA PE=3 SV=1 1207 1443 8.0E-36
sp|Q7MJ07|MSBA_VIBVY Lipid A export ATP-binding/permease protein MsbA OS=Vibrio vulnificus (strain YJ016) GN=msbA PE=3 SV=2 1207 1443 1.0E-35
sp|Q9CMG7|MSBA_PASMU Lipid A export ATP-binding/permease protein MsbA OS=Pasteurella multocida (strain Pm70) GN=msbA PE=3 SV=1 927 1443 1.0E-35
sp|Q00552|CFTR_CAVPO Cystic fibrosis transmembrane conductance regulator OS=Cavia porcellus GN=CFTR PE=2 SV=2 191 825 1.0E-35
sp|P26361|CFTR_MOUSE Cystic fibrosis transmembrane conductance regulator OS=Mus musculus GN=Cftr PE=1 SV=2 191 823 1.0E-35
sp|Q5E0F2|MSBA_VIBF1 Lipid A export ATP-binding/permease protein MsbA OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=msbA PE=3 SV=1 974 1443 2.0E-35
sp|Q5U820|CFTR_CANLF Cystic fibrosis transmembrane conductance regulator OS=Canis lupus familiaris GN=CFTR PE=2 SV=2 191 813 2.0E-35
sp|Q5D1Z7|CFTR_TRIVU Cystic fibrosis transmembrane conductance regulator OS=Trichosurus vulpecula GN=CFTR PE=2 SV=1 191 813 2.0E-35
sp|Q9CJB8|LCNCL_LACLA Lactococcin transport/processing ATP-binding protein LcnC-like OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=lcnC PE=3 SV=1 970 1439 3.0E-35
sp|Q2NUA5|MSBA_SODGM Lipid A export ATP-binding/permease protein MsbA OS=Sodalis glossinidius (strain morsitans) GN=msbA PE=3 SV=1 969 1443 3.0E-35
sp|Q2QL74|CFTR_DIDVI Cystic fibrosis transmembrane conductance regulator OS=Didelphis virginiana GN=CFTR PE=3 SV=1 191 813 3.0E-35
sp|Q87R16|MSBA_VIBPA Lipid A export ATP-binding/permease protein MsbA OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=msbA PE=3 SV=1 1189 1443 4.0E-35
sp|Q0I4C5|MSBA_HAES1 Lipid A export ATP-binding/permease protein MsbA OS=Haemophilus somnus (strain 129Pt) GN=msbA PE=3 SV=1 1207 1443 4.0E-35
sp|P63359|MSBA_SALTY Lipid A export ATP-binding/permease protein MsbA OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=msbA PE=1 SV=1 1138 1443 6.0E-35
sp|P63360|MSBA_SALTI Lipid A export ATP-binding/permease protein MsbA OS=Salmonella typhi GN=msbA PE=3 SV=1 1138 1443 6.0E-35
sp|Q57R14|MSBA_SALCH Lipid A export ATP-binding/permease protein MsbA OS=Salmonella choleraesuis (strain SC-B67) GN=msbA PE=3 SV=1 1138 1443 6.0E-35
sp|P0AAG5|MDLB_ECOLI Multidrug resistance-like ATP-binding protein MdlB OS=Escherichia coli (strain K12) GN=mdlB PE=1 SV=1 933 1443 6.0E-35
sp|P0AAG6|MDLB_ECOL6 Multidrug resistance-like ATP-binding protein MdlB OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=mdlB PE=3 SV=1 933 1443 6.0E-35
sp|P0AAG7|MDLB_ECO57 Multidrug resistance-like ATP-binding protein MdlB OS=Escherichia coli O157:H7 GN=mdlB PE=3 SV=1 933 1443 6.0E-35
sp|Q5PGH0|MSBA_SALPA Lipid A export ATP-binding/permease protein MsbA OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=msbA PE=3 SV=1 1138 1443 7.0E-35
sp|Q48P40|MSBA_PSE14 Lipid A export ATP-binding/permease protein MsbA OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=msbA PE=3 SV=2 937 1442 7.0E-35
sp|O31708|YKNV_BACSU Uncharacterized ABC transporter ATP-binding protein YknV OS=Bacillus subtilis (strain 168) GN=yknV PE=3 SV=1 1065 1443 8.0E-35
sp|Q6D437|MSBA_PECAS Lipid A export ATP-binding/permease protein MsbA OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=msbA PE=3 SV=2 940 1443 8.0E-35
sp|Q8XXB6|MSBA_RALSO Lipid A export ATP-binding/permease protein MsbA OS=Ralstonia solanacearum (strain GMI1000) GN=msbA PE=3 SV=1 1117 1443 9.0E-35
sp|Q02592|HMT1_SCHPO Heavy metal tolerance protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=hmt1 PE=2 SV=3 1074 1445 1.0E-34
sp|Q3KJ31|MSBA_PSEPF Lipid A export ATP-binding/permease protein MsbA OS=Pseudomonas fluorescens (strain Pf0-1) GN=msbA PE=3 SV=1 937 1442 1.0E-34
sp|Q8RY46|AB26B_ARATH ABC transporter B family member 26, chloroplastic OS=Arabidopsis thaliana GN=ABCB26 PE=2 SV=1 963 1444 2.0E-34
sp|Q2KYS6|MSBA_BORA1 Lipid A export ATP-binding/permease protein MsbA OS=Bordetella avium (strain 197N) GN=msbA PE=3 SV=1 1189 1443 2.0E-34
sp|P59653|COMA_STRR6 Transport/processing ATP-binding protein ComA OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=comA PE=3 SV=1 970 1441 2.0E-34
sp|Q31FG2|MSBA_THICR Lipid A export ATP-binding/permease protein MsbA OS=Thiomicrospira crunogena (strain XCL-2) GN=msbA PE=3 SV=1 1038 1446 2.0E-34
sp|Q59R09|ATM1_CANAL Iron-sulfur clusters transporter ATM1, mitochondrial OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=ATM1 PE=3 SV=1 1207 1443 2.0E-34
sp|Q07DZ6|CFTR_ORNAN Cystic fibrosis transmembrane conductance regulator OS=Ornithorhynchus anatinus GN=CFTR PE=3 SV=1 191 813 2.0E-34
sp|Q5NIG3|MSBA_FRATT Lipid A export ATP-binding/permease protein MsbA OS=Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4) GN=msbA PE=3 SV=1 1189 1439 3.0E-34
sp|Q14JW6|MSBA_FRAT1 Lipid A export ATP-binding/permease protein MsbA OS=Francisella tularensis subsp. tularensis (strain FSC 198) GN=msbA PE=1 SV=1 1189 1439 3.0E-34
sp|Q1QX69|MSBA_CHRSD Lipid A export ATP-binding/permease protein MsbA OS=Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768) GN=msbA PE=3 SV=1 1186 1443 3.0E-34
sp|Q2G2M9|Y2003_STAA8 Putative multidrug export ATP-binding/permease protein SAOUHSC_02003 OS=Staphylococcus aureus (strain NCTC 8325) GN=SAOUHSC_02003 PE=3 SV=1 1036 1445 3.0E-34
sp|Q6GFJ1|Y1956_STAAR Putative multidrug export ATP-binding/permease protein SAR1956 OS=Staphylococcus aureus (strain MRSA252) GN=SAR1956 PE=3 SV=1 1036 1445 3.0E-34
sp|Q5HEQ8|Y1924_STAAC Putative multidrug export ATP-binding/permease protein SACOL1924 OS=Staphylococcus aureus (strain COL) GN=SACOL1924 PE=3 SV=1 1036 1445 3.0E-34
sp|Q99T13|Y1866_STAAM Putative multidrug export ATP-binding/permease protein SAV1866 OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=SAV1866 PE=1 SV=1 1036 1445 3.0E-34
sp|Q2FFM9|Y1847_STAA3 Putative multidrug export ATP-binding/permease protein SAUSA300_1847 OS=Staphylococcus aureus (strain USA300) GN=SAUSA300_1847 PE=3 SV=1 1036 1445 3.0E-34
sp|Q7A0J1|Y1806_STAAW Putative multidrug export ATP-binding/permease protein MW1806 OS=Staphylococcus aureus (strain MW2) GN=MW1806 PE=3 SV=1 1036 1445 3.0E-34
sp|Q6G868|Y1788_STAAS Putative multidrug export ATP-binding/permease protein SAS1788 OS=Staphylococcus aureus (strain MSSA476) GN=SAS1788 PE=3 SV=1 1036 1445 3.0E-34
sp|Q7A4T3|Y1683_STAAN Putative multidrug export ATP-binding/permease protein SA1683 OS=Staphylococcus aureus (strain N315) GN=SA1683 PE=1 SV=1 1036 1445 3.0E-34
sp|Q5F4X8|MSBA_NEIG1 Lipid A export ATP-binding/permease protein MsbA OS=Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) GN=msbA PE=3 SV=1 1186 1444 3.0E-34
sp|Q9HUG8|MSBA_PSEAE Lipid A export ATP-binding/permease protein MsbA OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=msbA PE=3 SV=1 937 1442 3.0E-34
sp|Q7RX59|ATM1_NEUCR Iron-sulfur clusters transporter atm1, mitochondrial OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=fes-4 PE=3 SV=1 1198 1443 4.0E-34
sp|Q0BKJ3|MSBA_FRATO Lipid A export ATP-binding/permease protein MsbA OS=Francisella tularensis subsp. holarctica (strain OSU18) GN=msbA PE=3 SV=1 1189 1439 4.0E-34
sp|Q2A1U9|MSBA_FRATH Lipid A export ATP-binding/permease protein MsbA OS=Francisella tularensis subsp. holarctica (strain LVS) GN=msbA PE=3 SV=1 1189 1439 4.0E-34
sp|Q9WYC4|Y288_THEMA Uncharacterized ABC transporter ATP-binding protein TM_0288 OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=TM_0288 PE=1 SV=1 1207 1443 4.0E-34
sp|Q1RDU4|MSBA_ECOUT Lipid A export ATP-binding/permease protein MsbA OS=Escherichia coli (strain UTI89 / UPEC) GN=msbA PE=3 SV=1 949 1443 5.0E-34
sp|Q8FJB1|MSBA_ECOL6 Lipid A export ATP-binding/permease protein MsbA OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=msbA PE=3 SV=1 949 1443 5.0E-34
sp|Q0TJD9|MSBA_ECOL5 Lipid A export ATP-binding/permease protein MsbA OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=msbA PE=3 SV=1 949 1443 5.0E-34
sp|Q8T9W2|ABCB5_DICDI ABC transporter B family member 5 OS=Dictyostelium discoideum GN=abcB5 PE=3 SV=1 1189 1439 6.0E-34
sp|Q6F9X0|MSBA_ACIAD Lipid A export ATP-binding/permease protein MsbA OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=msbA PE=3 SV=1 1052 1439 8.0E-34
sp|Q0VQP5|MSBA_ALCBS Lipid A export ATP-binding/permease protein MsbA OS=Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2) GN=msbA PE=3 SV=1 1053 1442 9.0E-34
sp|Q32E34|MSBA_SHIDS Lipid A export ATP-binding/permease protein MsbA OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=msbA PE=3 SV=1 949 1443 1.0E-33
sp|Q31YT6|MSBA_SHIBS Lipid A export ATP-binding/permease protein MsbA OS=Shigella boydii serotype 4 (strain Sb227) GN=msbA PE=3 SV=1 949 1443 1.0E-33
sp|P60752|MSBA_ECOLI Lipid A export ATP-binding/permease protein MsbA OS=Escherichia coli (strain K12) GN=msbA PE=1 SV=1 949 1443 1.0E-33
sp|P60753|MSBA_ECO57 Lipid A export ATP-binding/permease protein MsbA OS=Escherichia coli O157:H7 GN=msbA PE=3 SV=1 949 1443 1.0E-33
sp|Q3Z3K7|MSBA_SHISS Lipid A export ATP-binding/permease protein MsbA OS=Shigella sonnei (strain Ss046) GN=msbA PE=3 SV=1 949 1443 1.0E-33
sp|Q21NS8|MSBA_SACD2 Lipid A export ATP-binding/permease protein MsbA OS=Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024) GN=msbA PE=3 SV=1 977 1443 1.0E-33
sp|Q2YU20|Y1799_STAAB Putative multidrug export ATP-binding/permease protein SAB1799c OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=SAB1799c PE=3 SV=1 1036 1445 1.0E-33
sp|Q7W9N7|MSBA_BORPA Lipid A export ATP-binding/permease protein MsbA OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=msbA PE=3 SV=1 935 1443 1.0E-33
sp|Q7WH20|MSBA_BORBR Lipid A export ATP-binding/permease protein MsbA OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=msbA PE=3 SV=2 935 1443 1.0E-33
sp|Q7VWD8|MSBA_BORPE Lipid A export ATP-binding/permease protein MsbA OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=msbA PE=3 SV=1 935 1443 1.0E-33
sp|Q4ZZ16|MSBA_PSEU2 Lipid A export ATP-binding/permease protein MsbA OS=Pseudomonas syringae pv. syringae (strain B728a) GN=msbA PE=3 SV=1 937 1442 1.0E-33
sp|Q5A762|MLT1_CANAL Multiple drug resistance-associated protein-like transporter 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=MLT1 PE=1 SV=1 283 827 2.0E-33
sp|Q9JW59|MSBA_NEIMA Lipid A export ATP-binding/permease protein MsbA OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=msbA PE=3 SV=1 1186 1442 2.0E-33
sp|Q89UT8|NDVA_BRADU Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=ndvA PE=3 SV=1 1032 1443 2.0E-33
sp|Q2LVL0|MSBA_SYNAS Lipid A export ATP-binding/permease protein MsbA OS=Syntrophus aciditrophicus (strain SB) GN=msbA PE=3 SV=1 965 1443 2.0E-33
sp|Q83LP0|MSBA_SHIFL Lipid A export ATP-binding/permease protein MsbA OS=Shigella flexneri GN=msbA PE=3 SV=1 949 1443 2.0E-33
sp|Q4KJB2|MSBA_PSEF5 Lipid A export ATP-binding/permease protein MsbA OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=msbA PE=3 SV=1 1074 1442 2.0E-33
sp|Q56A55|ABCB8_DANRE ATP-binding cassette sub-family B member 8, mitochondrial OS=Danio rerio GN=abcb8 PE=2 SV=1 900 1443 3.0E-33
sp|Q6AJW3|MSBA_DESPS Lipid A export ATP-binding/permease protein MsbA OS=Desulfotalea psychrophila (strain LSv54 / DSM 12343) GN=msbA PE=3 SV=1 875 1443 3.0E-33
sp|Q5P2S7|MSBA_AROAE Lipid A export ATP-binding/permease protein MsbA OS=Aromatoleum aromaticum (strain EbN1) GN=msbA PE=3 SV=1 937 1443 3.0E-33
sp|Q6FIK3|ATM1_CANGA Iron-sulfur clusters transporter ATM1, mitochondrial OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=ATM1 PE=3 SV=1 1197 1443 4.0E-33
sp|Q5B1Q2|ATM1_EMENI Iron-sulfur clusters transporter atm1, mitochondrial OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=atm1 PE=3 SV=2 1197 1447 4.0E-33
sp|Q6BXD7|ATM1_DEBHA Iron-sulfur clusters transporter ATM1, mitochondrial OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=ATM1 PE=3 SV=2 1146 1443 4.0E-33
sp|P22638|HEPA_NOSS1 Heterocyst differentiation ATP-binding protein HepA OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=hepA PE=2 SV=3 1214 1443 4.0E-33
sp|P36619|PMD1_SCHPO Leptomycin B resistance protein pmd1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pmd1 PE=3 SV=2 1205 1446 4.0E-33
sp|Q9JXR3|MSBA_NEIMB Lipid A export ATP-binding/permease protein MsbA OS=Neisseria meningitidis serogroup B (strain MC58) GN=msbA PE=3 SV=1 1186 1442 4.0E-33
sp|Q60AA3|MSBA_METCA Lipid A export ATP-binding/permease protein MsbA OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) GN=msbA PE=3 SV=1 1189 1443 5.0E-33
sp|Q87VF3|MSBA_PSESM Lipid A export ATP-binding/permease protein MsbA OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=msbA PE=3 SV=2 937 1442 5.0E-33
sp|B2GUP8|ABCB8_XENTR ATP-binding cassette sub-family B member 8, mitochondrial OS=Xenopus tropicalis GN=abcb8 PE=2 SV=1 939 1443 6.0E-33
sp|Q0A4U4|MSBA_ALKEH Lipid A export ATP-binding/permease protein MsbA OS=Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1) GN=msbA PE=3 SV=1 915 1443 6.0E-33
sp|P34158|CFTR_RAT Cystic fibrosis transmembrane conductance regulator OS=Rattus norvegicus GN=Cftr PE=1 SV=3 191 823 7.0E-33
sp|Q47908|MSBA_FRANO Lipid A export ATP-binding/permease protein MsbA OS=Francisella novicida GN=msbA PE=3 SV=2 1189 1432 8.0E-33
sp|P71082|YGAD_BACSU Putative multidrug export ATP-binding/permease protein YgaD OS=Bacillus subtilis (strain 168) GN=ygaD PE=3 SV=2 1017 1446 9.0E-33
sp|P34713|PGP3_CAEEL Multidrug resistance protein pgp-3 OS=Caenorhabditis elegans GN=pgp-3 PE=2 SV=2 622 1443 1.0E-32
sp|P63398|Y1303_MYCBO Uncharacterized ABC transporter ATP-binding protein Mb1303c OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=Mb1303c PE=3 SV=1 977 1440 1.0E-32
sp|P9WQJ3|Y1272_MYCTU Uncharacterized ABC transporter ATP-binding protein Rv1272c OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv1272c PE=1 SV=1 977 1440 1.0E-32
sp|P9WQJ2|Y1272_MYCTO Uncharacterized ABC transporter ATP-binding protein MT1310 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT1310 PE=3 SV=1 977 1440 1.0E-32
sp|P23886|CYDC_ECOLI ATP-binding/permease protein CydC OS=Escherichia coli (strain K12) GN=cydC PE=3 SV=2 1076 1436 2.0E-32
sp|Q03727|COMA_STRPN Transport/processing ATP-binding protein ComA OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=comA PE=3 SV=3 970 1441 2.0E-32
sp|Q00449|MDR49_DROME Multidrug resistance protein homolog 49 OS=Drosophila melanogaster GN=Mdr49 PE=2 SV=2 1228 1446 2.0E-32
sp|Q9VL32|SUR_DROME ATP-binding cassette sub-family C member Sur OS=Drosophila melanogaster GN=Sur PE=1 SV=4 603 823 2.0E-32
sp|Q66CI3|MSBA_YERPS Lipid A export ATP-binding/permease protein MsbA OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=msbA PE=3 SV=1 969 1443 3.0E-32
sp|Q1CGH0|MSBA_YERPN Lipid A export ATP-binding/permease protein MsbA OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=msbA PE=3 SV=1 969 1443 3.0E-32
sp|Q8ZGA9|MSBA_YERPE Lipid A export ATP-binding/permease protein MsbA OS=Yersinia pestis GN=msbA PE=3 SV=1 969 1443 3.0E-32
sp|Q1CA68|MSBA_YERPA Lipid A export ATP-binding/permease protein MsbA OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=msbA PE=3 SV=1 969 1443 3.0E-32
sp|Q12C33|MSBA_POLSJ Lipid A export ATP-binding/permease protein MsbA OS=Polaromonas sp. (strain JS666 / ATCC BAA-500) GN=msbA PE=3 SV=1 1124 1439 3.0E-32
sp|A1USS5|NDVA_BARBK Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Bartonella bacilliformis (strain ATCC 35685 / KC583) GN=ndvA PE=3 SV=1 1068 1448 3.0E-32
sp|Q6N1Y7|NDVA_RHOPA Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=ndvA PE=3 SV=1 1206 1443 3.0E-32
sp|P70864|NDVA_BARBA Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Bartonella bacilliformis GN=ndvA PE=3 SV=2 1068 1448 3.0E-32
sp|Q54VC1|ABCCF_DICDI ABC transporter C family member 15 OS=Dictyostelium discoideum GN=abcC15 PE=3 SV=1 179 823 5.0E-32
sp|Q57180|Y1051_HAEIN Uncharacterized ABC transporter ATP-binding protein HI_1051 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=HI_1051 PE=3 SV=1 1198 1443 5.0E-32
sp|Q9M0G9|AB24B_ARATH ABC transporter B family member 24, mitochondrial OS=Arabidopsis thaliana GN=ABCB24 PE=2 SV=1 1063 1448 7.0E-32
sp|Q88D92|MSBA_PSEPK Lipid A export ATP-binding/permease protein MsbA OS=Pseudomonas putida (strain KT2440) GN=msbA PE=3 SV=1 937 1442 8.0E-32
sp|P40416|ATM1_YEAST Iron-sulfur clusters transporter ATM1, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ATM1 PE=1 SV=2 1197 1438 9.0E-32
sp|Q1BUV6|MSBA_BURCA Lipid A export ATP-binding/permease protein MsbA OS=Burkholderia cenocepacia (strain AU 1054) GN=msbA PE=3 SV=2 1111 1443 1.0E-31
sp|Q9JI39|ABCBA_MOUSE ATP-binding cassette sub-family B member 10, mitochondrial OS=Mus musculus GN=Abcb10 PE=1 SV=1 941 1443 1.0E-31
sp|Q2ULH4|ATM1_ASPOR Iron-sulfur clusters transporter atm1, mitochondrial OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=atm1 PE=3 SV=1 1197 1446 2.0E-31
sp|Q1QBW0|MSBA_PSYCK Lipid A export ATP-binding/permease protein MsbA OS=Psychrobacter cryohalolentis (strain K5) GN=msbA PE=3 SV=1 1189 1430 2.0E-31
sp|Q1QH37|NDVA_NITHX Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Nitrobacter hamburgensis (strain X14 / DSM 10229) GN=ndvA PE=3 SV=1 1047 1448 2.0E-31
sp|Q21WN9|MSBA_RHOFT Lipid A export ATP-binding/permease protein MsbA OS=Rhodoferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118) GN=msbA PE=3 SV=1 1140 1444 2.0E-31
sp|Q5QU36|MSBA_IDILO Lipid A export ATP-binding/permease protein MsbA OS=Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) GN=msbA PE=3 SV=1 1207 1443 3.0E-31
sp|Q4HVU7|ATM1_GIBZE Iron-sulfur clusters transporter ATM1, mitochondrial OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=ATM1 PE=3 SV=1 1200 1443 3.0E-31
sp|Q83D84|MSBA_COXBU Lipid A export ATP-binding/permease protein MsbA OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) GN=msbA PE=3 SV=1 1074 1443 3.0E-31
sp|Q39E73|MSBA_BURL3 Lipid A export ATP-binding/permease protein MsbA OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=msbA PE=3 SV=2 1111 1443 4.0E-31
sp|P21440|MDR3_MOUSE Phosphatidylcholine translocator ABCB4 OS=Mus musculus GN=Abcb4 PE=1 SV=2 1207 1443 4.0E-31
sp|Q492S9|MSBA_BLOPB Lipid A export ATP-binding/permease protein MsbA OS=Blochmannia pennsylvanicus (strain BPEN) GN=msbA PE=3 SV=1 969 1443 4.0E-31
sp|Q4FS42|MSBA_PSYA2 Lipid A export ATP-binding/permease protein MsbA OS=Psychrobacter arcticus (strain DSM 17307 / 273-4) GN=msbA PE=3 SV=1 1189 1430 4.0E-31
sp|Q54RU1|ABCB6_DICDI ABC transporter B family member 6 OS=Dictyostelium discoideum GN=abcB6 PE=3 SV=1 1161 1446 6.0E-31
sp|Q12M46|MSBA_SHEDO Lipid A export ATP-binding/permease protein MsbA OS=Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013) GN=msbA PE=3 SV=1 1074 1443 7.0E-31
sp|Q10418|MESD_LEUME Mesentericin-Y105 transport/processing ATP-binding protein MesD OS=Leuconostoc mesenteroides GN=mesD PE=3 SV=1 970 1430 7.0E-31
sp|Q08D64|ABCB6_XENTR ATP-binding cassette sub-family B member 6, mitochondrial OS=Xenopus tropicalis GN=abcb6 PE=2 SV=1 1200 1443 7.0E-31
sp|Q08201|MDR3_RAT Phosphatidylcholine translocator ABCB4 OS=Rattus norvegicus GN=Abcb4 PE=1 SV=1 1207 1443 8.0E-31
sp|Q9LJX0|AB19B_ARATH ABC transporter B family member 19 OS=Arabidopsis thaliana GN=ABCB19 PE=1 SV=1 1207 1443 8.0E-31
sp|P23174|MDR3_CRIGR Phosphatidylcholine translocator ABCB4 OS=Cricetulus griseus GN=ABCB4 PE=2 SV=1 1207 1443 8.0E-31
sp|Q89A96|MDLB_BUCBP Multidrug resistance-like ATP-binding protein MdlB OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=mdlB PE=3 SV=1 1207 1446 8.0E-31
sp|Q9NRK6|ABCBA_HUMAN ATP-binding cassette sub-family B member 10, mitochondrial OS=Homo sapiens GN=ABCB10 PE=1 SV=2 1207 1443 9.0E-31
sp|P21449|MDR2_CRIGR Multidrug resistance protein 2 OS=Cricetulus griseus GN=PGY2 PE=2 SV=2 930 1443 1.0E-30
sp|P45861|YWJA_BACSU Uncharacterized ABC transporter ATP-binding protein YwjA OS=Bacillus subtilis (strain 168) GN=ywjA PE=3 SV=1 1170 1443 1.0E-30
sp|P54719|YFIC_BACSU Uncharacterized ABC transporter ATP-binding protein YfiC OS=Bacillus subtilis (strain 168) GN=yfiC PE=3 SV=1 1205 1443 1.0E-30
sp|P36497|PEDD_PEDAC Pediocin PA-1 transport/processing ATP-binding protein PedD OS=Pediococcus acidilactici GN=pedD PE=3 SV=1 977 1443 1.0E-30
sp|Q20Z38|NDVA_RHOPB Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Rhodopseudomonas palustris (strain BisB18) GN=ndvA PE=3 SV=1 1196 1443 2.0E-30
sp|Q47JR8|MSBA_DECAR Lipid A export ATP-binding/permease protein MsbA OS=Dechloromonas aromatica (strain RCB) GN=msbA PE=3 SV=1 1074 1443 2.0E-30
sp|Q751N2|ATM1_ASHGO Iron-sulfur clusters transporter ATM1, mitochondrial OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=ATM1 PE=3 SV=1 1228 1443 2.0E-30
sp|Q07QX6|NDVA_RHOP5 Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Rhodopseudomonas palustris (strain BisA53) GN=ndvA PE=3 SV=1 1206 1443 3.0E-30
sp|P21439|MDR3_HUMAN Phosphatidylcholine translocator ABCB4 OS=Homo sapiens GN=ABCB4 PE=1 SV=2 1207 1443 3.0E-30
sp|O70127|ABCBB_RAT Bile salt export pump OS=Rattus norvegicus GN=Abcb11 PE=1 SV=1 619 1439 3.0E-30
sp|Q9FHF1|AB7B_ARATH ABC transporter B family member 7 OS=Arabidopsis thaliana GN=ABCB7 PE=3 SV=1 1232 1443 3.0E-30
sp|Q9C7F8|AB13B_ARATH ABC transporter B family member 13 OS=Arabidopsis thaliana GN=ABCB13 PE=3 SV=1 1207 1443 3.0E-30
sp|Q704E8|ABCB7_RAT ATP-binding cassette sub-family B member 7, mitochondrial OS=Rattus norvegicus GN=Abcb7 PE=1 SV=1 1192 1435 3.0E-30
sp|Q61102|ABCB7_MOUSE ATP-binding cassette sub-family B member 7, mitochondrial OS=Mus musculus GN=Abcb7 PE=1 SV=3 1153 1435 4.0E-30
sp|Q8D2U8|MSBA_WIGBR Lipid A export ATP-binding/permease protein MsbA OS=Wigglesworthia glossinidia brevipalpis GN=msbA PE=3 SV=1 947 1443 4.0E-30
sp|Q3IGX5|MSBA_PSEHT Lipid A export ATP-binding/permease protein MsbA OS=Pseudoalteromonas haloplanktis (strain TAC 125) GN=msbA PE=3 SV=1 880 1443 4.0E-30
sp|O31707|YKNU_BACSU Uncharacterized ABC transporter ATP-binding protein YknU OS=Bacillus subtilis (strain 168) GN=yknU PE=3 SV=3 1190 1443 4.0E-30
sp|O75027|ABCB7_HUMAN ATP-binding cassette sub-family B member 7, mitochondrial OS=Homo sapiens GN=ABCB7 PE=1 SV=2 1192 1431 5.0E-30
sp|Q2HIE9|ATM1_CHAGB Iron-sulfur clusters transporter ATM1, mitochondrial OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=ATM1 PE=3 SV=1 1197 1447 5.0E-30
sp|Q13BH6|NDVA_RHOPS Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Rhodopseudomonas palustris (strain BisB5) GN=ndvA PE=3 SV=1 1196 1443 5.0E-30
sp|Q9M0M2|AB9B_ARATH ABC transporter B family member 9 OS=Arabidopsis thaliana GN=ABCB9 PE=3 SV=2 1232 1443 5.0E-30
sp|O07550|YHEI_BACSU Probable multidrug resistance ABC transporter ATP-binding/permease protein YheI OS=Bacillus subtilis (strain 168) GN=yheI PE=1 SV=1 930 1443 5.0E-30
sp|B5X0E4|ABCB5_MOUSE ATP-binding cassette sub-family B member 5 OS=Mus musculus GN=Abcb5 PE=2 SV=1 1207 1439 6.0E-30
sp|Q0HTS8|MSBA_SHESR Lipid A export ATP-binding/permease protein MsbA OS=Shewanella sp. (strain MR-7) GN=msbA PE=3 SV=1 1037 1443 6.0E-30
sp|Q0HHH4|MSBA_SHESM Lipid A export ATP-binding/permease protein MsbA OS=Shewanella sp. (strain MR-4) GN=msbA PE=3 SV=1 1037 1443 6.0E-30
sp|P0DKX5|CYAB_BORPE Cyclolysin secretion/processing ATP-binding protein CyaB OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=cyaB PE=3 SV=1 1207 1443 7.0E-30
sp|P0DKX6|CYAB_BORP1 Cyclolysin secretion/processing ATP-binding protein CyaB OS=Bordetella pertussis (strain ATCC 9797 / DSM 5571 / NCTC 10739 / 18323) GN=cyaB PE=3 SV=1 1207 1443 7.0E-30
sp|Q9M1Q9|AB21B_ARATH ABC transporter B family member 21 OS=Arabidopsis thaliana GN=ABCB21 PE=1 SV=2 1207 1433 7.0E-30
sp|P34712|PGP1_CAEEL Multidrug resistance protein pgp-1 OS=Caenorhabditis elegans GN=pgp-1 PE=1 SV=2 1228 1443 7.0E-30
sp|Q080T2|MSBA_SHEFN Lipid A export ATP-binding/permease protein MsbA OS=Shewanella frigidimarina (strain NCIMB 400) GN=msbA PE=3 SV=1 1207 1443 8.0E-30
sp|Q3J7R8|MSBA_NITOC Lipid A export ATP-binding/permease protein MsbA OS=Nitrosococcus oceani (strain ATCC 19707 / NCIMB 11848) GN=msbA PE=3 SV=1 948 1443 1.0E-29
sp|Q5H0H0|MSBA_XANOR Lipid A export ATP-binding/permease protein MsbA OS=Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85) GN=msbA PE=3 SV=1 1124 1443 1.0E-29
sp|Q2P3E7|MSBA_XANOM Lipid A export ATP-binding/permease protein MsbA OS=Xanthomonas oryzae pv. oryzae (strain MAFF 311018) GN=msbA PE=3 SV=1 1124 1443 1.0E-29
sp|Q2M3G0|ABCB5_HUMAN ATP-binding cassette sub-family B member 5 OS=Homo sapiens GN=ABCB5 PE=1 SV=4 1194 1445 1.0E-29
sp|P55469|Y4GM_RHISN Uncharacterized ABC transporter ATP-binding protein y4gM OS=Rhizobium sp. (strain NGR234) GN=NGR_a03510 PE=3 SV=1 1188 1443 1.0E-29
sp|P9WQJ9|IRTA_MYCTU Iron import ATP-binding/permease protein IrtA OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=irtA PE=1 SV=1 1228 1441 1.0E-29
sp|P9WQJ8|IRTA_MYCTO Iron import ATP-binding/permease protein IrtA OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=irtA PE=3 SV=1 1228 1441 1.0E-29
sp|P63392|IRTA_MYCBO Iron import ATP-binding/permease protein IrtA OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=irtA PE=3 SV=1 1228 1441 1.0E-29
sp|Q6G2Z5|NDVA_BARHE Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Bartonella henselae (strain ATCC 49882 / DSM 28221 / Houston 1) GN=ndvA PE=3 SV=1 1068 1448 1.0E-29
sp|Q9QY30|ABCBB_MOUSE Bile salt export pump OS=Mus musculus GN=Abcb11 PE=1 SV=2 622 1439 1.0E-29
sp|Q9C7F2|AB14B_ARATH ABC transporter B family member 14 OS=Arabidopsis thaliana GN=ABCB14 PE=3 SV=1 1207 1443 1.0E-29
sp|P36619|PMD1_SCHPO Leptomycin B resistance protein pmd1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pmd1 PE=3 SV=2 1207 1446 1.0E-29
sp|Q7VR44|MSBA_BLOFL Lipid A export ATP-binding/permease protein MsbA OS=Blochmannia floridanus GN=msbA PE=3 SV=1 1063 1443 2.0E-29
sp|Q3SP57|NDVA_NITWN Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Nitrobacter winogradskyi (strain Nb-255 / ATCC 25391) GN=ndvA PE=3 SV=2 1196 1443 2.0E-29
sp|Q54BU4|ABCB1_DICDI ABC transporter B family member 1 OS=Dictyostelium discoideum GN=abcB1 PE=3 SV=1 1074 1448 2.0E-29
sp|Q6CX96|ATM1_KLULA Iron-sulfur clusters transporter ATM1, mitochondrial OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=ATM1 PE=3 SV=1 1119 1443 2.0E-29
sp|Q9QYJ4|ABCB9_RAT ATP-binding cassette sub-family B member 9 OS=Rattus norvegicus GN=Abcb9 PE=1 SV=1 957 1448 2.0E-29
sp|P21447|MDR1A_MOUSE Multidrug resistance protein 1A OS=Mus musculus GN=Abcb1a PE=1 SV=3 1207 1443 3.0E-29
sp|Q7NZU6|MSBA_CHRVO Lipid A export ATP-binding/permease protein MsbA OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=msbA PE=3 SV=1 1119 1443 3.0E-29
sp|Q8EDF0|MSBA_SHEON Lipid A export ATP-binding/permease protein MsbA OS=Shewanella oneidensis (strain MR-1) GN=msbA PE=3 SV=1 1074 1443 3.0E-29
sp|Q9FUT3|AB23B_ARATH ABC transporter B family member 23, mitochondrial OS=Arabidopsis thaliana GN=ABCB23 PE=2 SV=1 1185 1448 3.0E-29
sp|Q8P8W4|MSBA_XANCP Lipid A export ATP-binding/permease protein MsbA OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=msbA PE=3 SV=1 1124 1443 3.0E-29
sp|Q4UV65|MSBA_XANC8 Lipid A export ATP-binding/permease protein MsbA OS=Xanthomonas campestris pv. campestris (strain 8004) GN=msbA PE=3 SV=1 1124 1443 3.0E-29
sp|Q9CXJ4|ABCB8_MOUSE ATP-binding cassette sub-family B member 8, mitochondrial OS=Mus musculus GN=Abcb8 PE=1 SV=1 1207 1443 3.0E-29
sp|P08183|MDR1_HUMAN Multidrug resistance protein 1 OS=Homo sapiens GN=ABCB1 PE=1 SV=3 1207 1443 4.0E-29
sp|Q54W24|ABCB4_DICDI ABC transporter B family member 4 OS=Dictyostelium discoideum GN=abcB4 PE=3 SV=1 953 1440 4.0E-29
sp|B5X0E4|ABCB5_MOUSE ATP-binding cassette sub-family B member 5 OS=Mus musculus GN=Abcb5 PE=2 SV=1 1207 1445 5.0E-29
sp|Q9DC29|ABCB6_MOUSE ATP-binding cassette sub-family B member 6, mitochondrial OS=Mus musculus GN=Abcb6 PE=1 SV=1 1200 1443 5.0E-29
sp|Q9LSJ6|AB17B_ARATH ABC transporter B family member 17 OS=Arabidopsis thaliana GN=ABCB17 PE=3 SV=1 1207 1443 5.0E-29
sp|P06795|MDR1B_MOUSE Multidrug resistance protein 1B OS=Mus musculus GN=Abcb1b PE=1 SV=1 1207 1436 6.0E-29
sp|Q9NP78|ABCB9_HUMAN ATP-binding cassette sub-family B member 9 OS=Homo sapiens GN=ABCB9 PE=1 SV=1 905 1443 7.0E-29
sp|Q9NP58|ABCB6_HUMAN ATP-binding cassette sub-family B member 6, mitochondrial OS=Homo sapiens GN=ABCB6 PE=1 SV=1 1200 1443 8.0E-29
sp|P34712|PGP1_CAEEL Multidrug resistance protein pgp-1 OS=Caenorhabditis elegans GN=pgp-1 PE=1 SV=2 1228 1443 1.0E-28
sp|Q9C7F2|AB14B_ARATH ABC transporter B family member 14 OS=Arabidopsis thaliana GN=ABCB14 PE=3 SV=1 1148 1443 1.0E-28
sp|Q9FWX7|AB11B_ARATH ABC transporter B family member 11 OS=Arabidopsis thaliana GN=ABCB11 PE=2 SV=1 1207 1448 1.0E-28
sp|Q5RKI8|ABCB8_RAT ATP-binding cassette sub-family B member 8, mitochondrial OS=Rattus norvegicus GN=Abcb8 PE=2 SV=1 939 1445 1.0E-28
sp|P21448|MDR1_CRIGR Multidrug resistance protein 1 OS=Cricetulus griseus GN=ABCB1 PE=1 SV=2 1207 1443 1.0E-28
sp|Q5WVN2|MSBA_LEGPL Lipid A export ATP-binding/permease protein MsbA OS=Legionella pneumophila (strain Lens) GN=msbA PE=3 SV=1 1207 1443 1.0E-28
sp|Q6C6N0|ATM1_YARLI Iron-sulfur clusters transporter ATM1, mitochondrial OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=ATM1 PE=3 SV=1 1198 1443 1.0E-28
sp|Q9JJ59|ABCB9_MOUSE ATP-binding cassette sub-family B member 9 OS=Mus musculus GN=Abcb9 PE=2 SV=1 957 1448 1.0E-28
sp|Q9C7F8|AB13B_ARATH ABC transporter B family member 13 OS=Arabidopsis thaliana GN=ABCB13 PE=3 SV=1 1207 1445 2.0E-28
sp|Q9LVM1|AB25B_ARATH ABC transporter B family member 25, mitochondrial OS=Arabidopsis thaliana GN=ABCB25 PE=1 SV=1 1207 1448 2.0E-28
sp|P45081|CYDC_HAEIN ATP-binding/permease protein CydC OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=cydC PE=3 SV=1 1211 1441 2.0E-28
sp|Q9PEE7|MSBA_XYLFA Lipid A export ATP-binding/permease protein MsbA OS=Xylella fastidiosa (strain 9a5c) GN=msbA PE=3 SV=1 1120 1443 2.0E-28
sp|Q8YH20|NDVA_BRUME Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=ndvA PE=3 SV=1 1178 1448 2.0E-28
sp|P43245|MDR1_RAT Multidrug resistance protein 1 OS=Rattus norvegicus GN=Abcb1 PE=2 SV=1 961 1443 2.0E-28
sp|Q15UY7|MSBA_PSEA6 Lipid A export ATP-binding/permease protein MsbA OS=Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087) GN=msbA PE=3 SV=1 1207 1443 2.0E-28
sp|Q5ZUH9|MSBA_LEGPH Lipid A export ATP-binding/permease protein MsbA OS=Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) GN=msbA PE=3 SV=2 1207 1443 2.0E-28
sp|Q3SFZ6|MSBA_THIDA Lipid A export ATP-binding/permease protein MsbA OS=Thiobacillus denitrificans (strain ATCC 25259) GN=msbA PE=3 SV=1 1192 1443 2.0E-28
sp|Q08201|MDR3_RAT Phosphatidylcholine translocator ABCB4 OS=Rattus norvegicus GN=Abcb4 PE=1 SV=1 1203 1443 3.0E-28
sp|Q5X498|MSBA_LEGPA Lipid A export ATP-binding/permease protein MsbA OS=Legionella pneumophila (strain Paris) GN=msbA PE=3 SV=1 1207 1443 3.0E-28
sp|Q8LPK2|AB2B_ARATH ABC transporter B family member 2 OS=Arabidopsis thaliana GN=ABCB2 PE=1 SV=3 1207 1443 3.0E-28
sp|Q8G0T8|NDVA_BRUSU Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Brucella suis biovar 1 (strain 1330) GN=ndvA PE=3 SV=1 1178 1448 3.0E-28
sp|Q54BT3|ABCB2_DICDI ABC transporter B family member 2 OS=Dictyostelium discoideum GN=abcB2 PE=3 SV=1 1207 1443 3.0E-28
sp|Q2J0F4|NDVA_RHOP2 Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Rhodopseudomonas palustris (strain HaA2) GN=ndvA PE=3 SV=1 1196 1443 3.0E-28
sp|O14286|ATM1_SCHPO Iron-sulfur clusters transporter atm1, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=atm1 PE=3 SV=2 1207 1443 4.0E-28
sp|Q9FHF1|AB7B_ARATH ABC transporter B family member 7 OS=Arabidopsis thaliana GN=ABCB7 PE=3 SV=1 1192 1430 5.0E-28
sp|Q46Y89|MSBA_CUPPJ Lipid A export ATP-binding/permease protein MsbA OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=msbA PE=3 SV=1 1124 1443 5.0E-28
sp|Q9ZR72|AB1B_ARATH ABC transporter B family member 1 OS=Arabidopsis thaliana GN=ABCB1 PE=1 SV=1 1206 1443 5.0E-28
sp|O70595|ABCB6_RAT ATP-binding cassette sub-family B member 6, mitochondrial OS=Rattus norvegicus GN=Abcb6 PE=2 SV=1 1192 1443 5.0E-28
sp|P94366|CYDC_BACSU ATP-binding/permease protein CydC OS=Bacillus subtilis (strain 168) GN=cydC PE=3 SV=1 1022 1443 6.0E-28
sp|Q87EF0|MSBA_XYLFT Lipid A export ATP-binding/permease protein MsbA OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=msbA PE=3 SV=1 1120 1443 7.0E-28
sp|P0C529|NDVA_BRUAB Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Brucella abortus biovar 1 (strain 9-941) GN=ndvA PE=3 SV=1 1178 1448 7.0E-28
sp|Q2YQ73|NDVA_BRUA2 Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Brucella abortus (strain 2308) GN=ndvA PE=1 SV=1 1178 1448 7.0E-28
sp|Q5RFQ9|ABCB8_PONAB ATP-binding cassette sub-family B member 8, mitochondrial OS=Pongo abelii GN=ABCB8 PE=2 SV=1 1207 1445 9.0E-28
sp|O06967|BMRA_BACSU Multidrug resistance ABC transporter ATP-binding/permease protein BmrA OS=Bacillus subtilis (strain 168) GN=bmrA PE=1 SV=1 928 1443 9.0E-28
sp|Q3BTC8|MSBA_XANC5 Lipid A export ATP-binding/permease protein MsbA OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=msbA PE=3 SV=1 1124 1443 9.0E-28
sp|Q8T9W1|TAGD_DICDI Serine protease/ABC transporter B family protein tagD OS=Dictyostelium discoideum GN=tagD PE=3 SV=1 1200 1439 1.0E-27
sp|P21447|MDR1A_MOUSE Multidrug resistance protein 1A OS=Mus musculus GN=Abcb1a PE=1 SV=3 1207 1443 1.0E-27
sp|Q8PKS5|MSBA_XANAC Lipid A export ATP-binding/permease protein MsbA OS=Xanthomonas axonopodis pv. citri (strain 306) GN=msbA PE=3 SV=1 1124 1443 1.0E-27
sp|Q71ED1|NDVA_AGRVI Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Agrobacterium vitis GN=ndvA PE=3 SV=1 1182 1445 1.0E-27
sp|Q4WLN7|ATM1_ASPFU Iron-sulfur clusters transporter atm1, mitochondrial OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=atm1 PE=3 SV=1 1197 1447 1.0E-27
sp|Q9SGY1|AB10B_ARATH ABC transporter B family member 10 OS=Arabidopsis thaliana GN=ABCB10 PE=1 SV=2 1207 1443 1.0E-27
sp|Q483B6|MSBA1_COLP3 Lipid A export ATP-binding/permease protein MsbA 1 OS=Colwellia psychrerythraea (strain 34H / ATCC BAA-681) GN=msbA1 PE=3 SV=1 1160 1443 1.0E-27
sp|P78966|MAM1_SCHPO Mating factor M secretion protein mam1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mam1 PE=3 SV=1 1027 1439 1.0E-27
sp|Q9CHL8|LMRA_LACLA Multidrug resistance ABC transporter ATP-binding and permease protein OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=lmrA PE=1 SV=2 977 1443 2.0E-27
sp|O80725|AB4B_ARATH ABC transporter B family member 4 OS=Arabidopsis thaliana GN=ABCB4 PE=1 SV=1 1207 1443 2.0E-27
sp|Q9NUT2|ABCB8_HUMAN ATP-binding cassette sub-family B member 8, mitochondrial OS=Homo sapiens GN=ABCB8 PE=1 SV=3 1207 1445 2.0E-27
sp|Q2G506|ATM1_NOVAD ATM1-type heavy metal exporter OS=Novosphingobium aromaticivorans (strain DSM 12444 / F199) GN=atm1 PE=1 SV=1 1228 1443 2.0E-27
sp|P21449|MDR2_CRIGR Multidrug resistance protein 2 OS=Cricetulus griseus GN=PGY2 PE=2 SV=2 1185 1436 2.0E-27
sp|P06795|MDR1B_MOUSE Multidrug resistance protein 1B OS=Mus musculus GN=Abcb1b PE=1 SV=1 961 1443 2.0E-27
sp|P21448|MDR1_CRIGR Multidrug resistance protein 1 OS=Cricetulus griseus GN=ABCB1 PE=1 SV=2 1204 1443 2.0E-27
sp|Q480N3|MSBA2_COLP3 Lipid A export ATP-binding/permease protein MsbA 2 OS=Colwellia psychrerythraea (strain 34H / ATCC BAA-681) GN=msbA2 PE=3 SV=2 1125 1443 3.0E-27
sp|Q46717|HLYB_ECO57 Alpha-hemolysin translocation ATP-binding protein HlyB OS=Escherichia coli O157:H7 GN=hlyB PE=3 SV=2 1186 1444 3.0E-27
sp|Q68W42|Y691_RICTY Putative export ATP-binding/permease protein RT0691 OS=Rickettsia typhi (strain ATCC VR-144 / Wilmington) GN=RT0691 PE=3 SV=1 1204 1443 3.0E-27
sp|Q8K984|MDLB_BUCAP Multidrug resistance-like ATP-binding protein MdlB OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=mdlB PE=3 SV=1 944 1443 3.0E-27
sp|Q9LHD1|AB15B_ARATH ABC transporter B family member 15 OS=Arabidopsis thaliana GN=ABCB15 PE=3 SV=1 1207 1445 3.0E-27
sp|P21440|MDR3_MOUSE Phosphatidylcholine translocator ABCB4 OS=Mus musculus GN=Abcb4 PE=1 SV=2 1203 1443 3.0E-27
sp|Q9LSJ8|AB16B_ARATH ABC transporter B family member 16 OS=Arabidopsis thaliana GN=ABCB16 PE=2 SV=1 1207 1443 3.0E-27
sp|Q00449|MDR49_DROME Multidrug resistance protein homolog 49 OS=Drosophila melanogaster GN=Mdr49 PE=2 SV=2 1207 1442 4.0E-27
sp|Q00748|MDR65_DROME Multidrug resistance protein homolog 65 OS=Drosophila melanogaster GN=Mdr65 PE=1 SV=2 1228 1443 5.0E-27
sp|Q9LSJ2|AB22B_ARATH ABC transporter B family member 22 OS=Arabidopsis thaliana GN=ABCB22 PE=3 SV=2 1207 1443 5.0E-27
sp|Q9LSJ6|AB17B_ARATH ABC transporter B family member 17 OS=Arabidopsis thaliana GN=ABCB17 PE=3 SV=1 1228 1435 6.0E-27
sp|Q2M3G0|ABCB5_HUMAN ATP-binding cassette sub-family B member 5 OS=Homo sapiens GN=ABCB5 PE=1 SV=4 930 1445 7.0E-27
sp|Q9FWX7|AB11B_ARATH ABC transporter B family member 11 OS=Arabidopsis thaliana GN=ABCB11 PE=2 SV=1 1207 1430 8.0E-27
sp|Q2K342|NDVA_RHIEC Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=ndvA PE=3 SV=2 1178 1448 9.0E-27
sp|Q9M0M2|AB9B_ARATH ABC transporter B family member 9 OS=Arabidopsis thaliana GN=ABCB9 PE=3 SV=2 1206 1430 9.0E-27
sp|O80725|AB4B_ARATH ABC transporter B family member 4 OS=Arabidopsis thaliana GN=ABCB4 PE=1 SV=1 1207 1443 1.0E-26
sp|Q9SYI3|AB5B_ARATH ABC transporter B family member 5 OS=Arabidopsis thaliana GN=ABCB5 PE=3 SV=1 1192 1430 1.0E-26
sp|Q9FWX8|AB12B_ARATH ABC transporter B family member 12 OS=Arabidopsis thaliana GN=ABCB12 PE=2 SV=2 1207 1434 1.0E-26
sp|P57552|MDLB_BUCAI Multidrug resistance-like ATP-binding protein MdlB OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=mdlB PE=3 SV=1 1205 1443 1.0E-26
sp|P43245|MDR1_RAT Multidrug resistance protein 1 OS=Rattus norvegicus GN=Abcb1 PE=2 SV=1 1207 1436 1.0E-26
sp|Q9LSJ5|AB18B_ARATH ABC transporter B family member 18 OS=Arabidopsis thaliana GN=ABCB18 PE=3 SV=1 1207 1445 1.0E-26
sp|Q6YUU5|MDR_ORYSJ Putative multidrug resistance protein OS=Oryza sativa subsp. japonica GN=Os02g0190300 PE=3 SV=1 1206 1434 1.0E-26
sp|P23174|MDR3_CRIGR Phosphatidylcholine translocator ABCB4 OS=Cricetulus griseus GN=ABCB4 PE=2 SV=1 1203 1443 2.0E-26
sp|Q9SYI3|AB5B_ARATH ABC transporter B family member 5 OS=Arabidopsis thaliana GN=ABCB5 PE=3 SV=1 1207 1446 2.0E-26
sp|Q9FWX8|AB12B_ARATH ABC transporter B family member 12 OS=Arabidopsis thaliana GN=ABCB12 PE=2 SV=2 1207 1433 2.0E-26
sp|Q4UMZ3|Y214_RICFE Putative export ATP-binding/permease protein RF_0214 OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=RF_0214 PE=3 SV=2 1062 1443 2.0E-26
sp|P97046|LMRA_LACLM Multidrug resistance ABC transporter ATP-binding and permease protein OS=Lactococcus lactis subsp. cremoris (strain MG1363) GN=lmrA PE=3 SV=3 977 1443 2.0E-26
sp|Q9FNU2|AB25B_ORYSJ ABC transporter B family member 25 OS=Oryza sativa subsp. japonica GN=OsABCB25 PE=2 SV=1 1207 1443 2.0E-26
sp|P0CL93|ATM1_CRYNB Iron-sulfur clusters transporter ATM1, mitochondrial OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=ATM1 PE=3 SV=1 1193 1431 2.0E-26
sp|P0CL92|ATM1_CRYNJ Iron-sulfur clusters transporter ATM1, mitochondrial OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=ATM1 PE=3 SV=1 1193 1431 2.0E-26
sp|P08183|MDR1_HUMAN Multidrug resistance protein 1 OS=Homo sapiens GN=ABCB1 PE=1 SV=3 1228 1443 2.0E-26
sp|Q6FZF2|NDVA_BARQU Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Bartonella quintana (strain Toulouse) GN=ndvA PE=3 SV=1 1197 1448 3.0E-26
sp|P0A4W5|Y1304_MYCBO Uncharacterized ABC transporter ATP-binding protein Mb1304c OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=Mb1304c PE=3 SV=1 1206 1446 3.0E-26
sp|P9WQJ1|Y1273_MYCTU Uncharacterized ABC transporter ATP-binding protein Rv1273c OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv1273c PE=1 SV=1 1206 1446 3.0E-26
sp|O95342|ABCBB_HUMAN Bile salt export pump OS=Homo sapiens GN=ABCB11 PE=1 SV=2 1221 1439 3.0E-26
sp|P9WQJ0|Y1273_MYCTO Uncharacterized ABC transporter ATP-binding protein MT1311 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT1311 PE=3 SV=1 1206 1446 3.0E-26
sp|Q04473|RTX3B_ACTPL Toxin RTX-III translocation ATP-binding protein OS=Actinobacillus pleuropneumoniae GN=apxIIIB PE=3 SV=1 932 1434 3.0E-26
sp|Q9LHK4|AB8B_ARATH Putative ABC transporter B family member 8 OS=Arabidopsis thaliana GN=ABCB8 PE=5 SV=1 619 1440 3.0E-26
sp|Q54BT3|ABCB2_DICDI ABC transporter B family member 2 OS=Dictyostelium discoideum GN=abcB2 PE=3 SV=1 1207 1443 3.0E-26
sp|P54683|TAGB_DICDI Serine protease/ABC transporter B family protein tagB OS=Dictyostelium discoideum GN=tagB PE=3 SV=2 1207 1439 4.0E-26
sp|P0A2V1|NDVA_RHIRD Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Rhizobium radiobacter GN=ndvA PE=1 SV=1 1196 1445 4.0E-26
sp|P0A2V0|NDVA_AGRFC Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=ndvA PE=3 SV=1 1196 1445 4.0E-26
sp|P94367|CYDD_BACSU ATP-binding/permease protein CydD OS=Bacillus subtilis (strain 168) GN=cydD PE=3 SV=1 1214 1442 5.0E-26
sp|P55122|LKTB_PASSP Leukotoxin translocation ATP-binding protein LktB OS=Pasteurella haemolytica-like sp. (strain 5943B) GN=lktB PE=3 SV=1 1189 1434 5.0E-26
sp|Q9RCG7|PAXB_PASAE Exotoxin translocation ATP-binding protein PaxB OS=Pasteurella aerogenes GN=paxB PE=3 SV=1 1143 1445 5.0E-26
sp|Q983H5|NDVA_RHILO Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Rhizobium loti (strain MAFF303099) GN=ndvA PE=3 SV=1 1206 1448 5.0E-26
sp|Q1MAB5|NDVA_RHIL3 Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Rhizobium leguminosarum bv. viciae (strain 3841) GN=ndvA PE=3 SV=1 1178 1448 6.0E-26
sp|Q92GP9|Y1073_RICCN Putative export ATP-binding/permease protein RC1073 OS=Rickettsia conorii (strain ATCC VR-613 / Malish 7) GN=RC1073 PE=3 SV=1 1062 1443 7.0E-26
sp|Q9M1Q9|AB21B_ARATH ABC transporter B family member 21 OS=Arabidopsis thaliana GN=ABCB21 PE=1 SV=2 1207 1443 7.0E-26
sp|Q9LJX0|AB19B_ARATH ABC transporter B family member 19 OS=Arabidopsis thaliana GN=ABCB19 PE=1 SV=1 1226 1443 8.0E-26
sp|P26760|RTX1B_ACTPL Toxin RTX-I translocation ATP-binding protein OS=Actinobacillus pleuropneumoniae GN=apxIB PE=1 SV=2 1202 1431 8.0E-26
sp|Q9ZCM8|Y696_RICPR Putative export ATP-binding/permease protein RP696 OS=Rickettsia prowazekii (strain Madrid E) GN=RP696 PE=3 SV=1 1062 1443 9.0E-26
sp|P08716|HLYBP_ECOLX Alpha-hemolysin translocation ATP-binding protein HlyB OS=Escherichia coli GN=hlyB PE=1 SV=1 932 1443 1.0E-25
sp|Q9SYI2|AB3B_ARATH ABC transporter B family member 3 OS=Arabidopsis thaliana GN=ABCB3 PE=3 SV=1 1207 1445 1.0E-25
sp|Q8LPK2|AB2B_ARATH ABC transporter B family member 2 OS=Arabidopsis thaliana GN=ABCB2 PE=1 SV=3 1207 1443 1.0E-25
sp|Q9ZR72|AB1B_ARATH ABC transporter B family member 1 OS=Arabidopsis thaliana GN=ABCB1 PE=1 SV=1 1207 1443 1.0E-25
sp|Q8FDZ8|HLYB_ECOL6 Alpha-hemolysin translocation ATP-binding protein HlyB OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=hlyB PE=3 SV=1 932 1443 2.0E-25
sp|Q23868|TAGC_DICDI Serine protease/ABC transporter B family protein tagC OS=Dictyostelium discoideum GN=tagC PE=2 SV=2 1207 1439 2.0E-25
sp|P10089|HLYBC_ECOLX Alpha-hemolysin translocation ATP-binding protein HlyB OS=Escherichia coli GN=hlyB PE=3 SV=2 932 1443 2.0E-25
sp|P18767|NDVA_RHIME Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Rhizobium meliloti (strain 1021) GN=ndvA PE=1 SV=2 1178 1448 2.0E-25
sp|Q8K985|MDLA_BUCAP Multidrug resistance-like ATP-binding protein MdlA OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=mdlA PE=3 SV=1 422 833 2.0E-25
sp|Q93FG6|LKB2B_MANHA Leukotoxin translocation ATP-binding protein LktB OS=Mannheimia haemolytica GN=lktB PE=3 SV=1 1189 1430 2.0E-25
sp|P71355|Y663_HAEIN Uncharacterized ABC transporter ATP-binding protein HI_0663 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=HI_0663 PE=3 SV=1 1186 1443 3.0E-25
sp|Q1LQD3|MSBA_CUPMC Lipid A export ATP-binding/permease protein MsbA OS=Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34) GN=msbA PE=3 SV=1 1139 1443 3.0E-25
sp|Q933I3|LKTB_MANGL Leukotoxin translocation ATP-binding protein LktB OS=Mannheimia glucosida GN=lktB PE=3 SV=1 1189 1434 3.0E-25
sp|Q47258|HLYB3_ECOLX Alpha-hemolysin translocation ATP-binding protein HlyB OS=Escherichia coli GN=hlyB PE=1 SV=1 932 1443 3.0E-25
sp|Q9SGY1|AB10B_ARATH ABC transporter B family member 10 OS=Arabidopsis thaliana GN=ABCB10 PE=1 SV=2 1231 1443 3.0E-25
sp|Q93FH3|LKB16_MANHA Leukotoxin translocation ATP-binding protein LktB OS=Mannheimia haemolytica GN=lktB PE=3 SV=1 1189 1430 4.0E-25
sp|P16532|LKB1A_MANHA Leukotoxin translocation ATP-binding protein LktB OS=Mannheimia haemolytica GN=lktB PE=3 SV=1 1189 1430 5.0E-25
sp|Q93FH2|LKB13_MANHA Leukotoxin translocation ATP-binding protein LktB OS=Mannheimia haemolytica GN=lktB PE=3 SV=1 1189 1430 5.0E-25
sp|Q93FH6|LKB1B_MANHA Leukotoxin translocation ATP-binding protein LktB OS=Mannheimia haemolytica GN=lktB PE=3 SV=1 1189 1430 5.0E-25
sp|P21439|MDR3_HUMAN Phosphatidylcholine translocator ABCB4 OS=Homo sapiens GN=ABCB4 PE=1 SV=2 1228 1443 6.0E-25
sp|P0C086|LKTB7_MANHA Leukotoxin translocation ATP-binding protein LktB OS=Mannheimia haemolytica GN=lktB PE=3 SV=1 1189 1430 6.0E-25
sp|P0C087|LKB14_MANHA Leukotoxin translocation ATP-binding protein LktB OS=Mannheimia haemolytica GN=lktB PE=3 SV=1 1189 1430 6.0E-25
sp|Q93FH0|LKB2A_MANHA Leukotoxin translocation ATP-binding protein LktB OS=Mannheimia haemolytica GN=lktB PE=3 SV=2 1189 1430 6.0E-25
sp|Q933E0|LKTB_BIBTR Leukotoxin translocation ATP-binding protein LktB OS=Bibersteinia trehalosi GN=lktB PE=3 SV=1 1189 1430 6.0E-25
sp|Q1RJ91|Y492_RICBR Putative export ATP-binding/permease protein RBE_0492 OS=Rickettsia bellii (strain RML369-C) GN=RBE_0492 PE=3 SV=1 1062 1439 7.0E-25
sp|P75094|Y019_MYCPN Putative ABC transporter ATP-binding protein MG015 homolog OS=Mycoplasma pneumoniae (strain ATCC 29342 / M129) GN=MPN_019 PE=3 SV=1 973 1439 7.0E-25
sp|Q9GTN7|TAGA_DICDI Serine protease/ABC transporter B family protein tagA OS=Dictyostelium discoideum GN=tagA PE=1 SV=2 1207 1443 7.0E-25
sp|Q9SYI2|AB3B_ARATH ABC transporter B family member 3 OS=Arabidopsis thaliana GN=ABCB3 PE=3 SV=1 1207 1430 1.0E-24
sp|Q9N0V3|ABCBB_RABIT Bile salt export pump OS=Oryctolagus cuniculus GN=ABCB11 PE=2 SV=1 1228 1439 1.0E-24
sp|Q06034|MDR1_LEIEN Multidrug resistance protein 1 OS=Leishmania enriettii GN=MDR1 PE=3 SV=1 941 1445 1.0E-24
sp|Q8LPQ6|AB28B_ARATH ABC transporter B family member 28 OS=Arabidopsis thaliana GN=ABCB28 PE=2 SV=1 1207 1448 2.0E-24
sp|P97998|MDL1_CANAX ATP-dependent permease MDL1 OS=Candida albicans GN=MDL1 PE=3 SV=1 1206 1439 2.0E-24
sp|P77265|MDLA_ECOLI Multidrug resistance-like ATP-binding protein MdlA OS=Escherichia coli (strain K12) GN=mdlA PE=3 SV=1 1162 1438 2.0E-24
sp|Q6KHL1|ECFA1_MYCMO Energy-coupling factor transporter ATP-binding protein EcfA1 OS=Mycoplasma mobile (strain ATCC 43663 / 163K / NCTC 11711) GN=ecfA1 PE=3 SV=1 1206 1433 3.0E-24
sp|O95342|ABCBB_HUMAN Bile salt export pump OS=Homo sapiens GN=ABCB11 PE=1 SV=2 1207 1443 5.0E-24
sp|P54718|YFIB_BACSU Uncharacterized ABC transporter ATP-binding protein YfiB OS=Bacillus subtilis (strain 168) GN=yfiB PE=3 SV=1 1190 1443 5.0E-24
sp|P36372|TAP2_RAT Antigen peptide transporter 2 OS=Rattus norvegicus GN=Tap2 PE=2 SV=1 1074 1428 6.0E-24
sp|P78966|MAM1_SCHPO Mating factor M secretion protein mam1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mam1 PE=3 SV=1 1184 1430 8.0E-24
sp|P47261|Y015_MYCGE Putative ABC transporter ATP-binding protein MG015 OS=Mycoplasma genitalium (strain ATCC 33530 / G-37 / NCTC 10195) GN=MG015 PE=3 SV=1 934 1439 9.0E-24
sp|Q0WML0|AB27B_ARATH ABC transporter B family member 27 OS=Arabidopsis thaliana GN=ABCB27 PE=1 SV=1 1200 1443 9.0E-24
sp|Q4PH16|ATM1_USTMA Iron-sulfur clusters transporter ATM1, mitochondrial OS=Ustilago maydis (strain 521 / FGSC 9021) GN=ATM1 PE=3 SV=1 1192 1430 1.0E-23
sp|P34713|PGP3_CAEEL Multidrug resistance protein pgp-3 OS=Caenorhabditis elegans GN=pgp-3 PE=2 SV=2 1207 1433 1.0E-23
sp|P23702|LTXB_AGGAC Leukotoxin export ATP-binding protein LtxB OS=Aggregatibacter actinomycetemcomitans GN=ltxB PE=1 SV=1 960 1434 2.0E-23
sp|P77265|MDLA_ECOLI Multidrug resistance-like ATP-binding protein MdlA OS=Escherichia coli (strain K12) GN=mdlA PE=3 SV=1 422 852 3.0E-23
sp|P57551|MDLA_BUCAI Multidrug resistance-like ATP-binding protein MdlA OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=mdlA PE=3 SV=1 617 850 3.0E-23
sp|Q8T9W4|ABCB3_DICDI ABC transporter B family member 3 OS=Dictyostelium discoideum GN=abcB3 PE=3 SV=1 1204 1443 4.0E-23
sp|P11599|HLYB_PROVU Alpha-hemolysin translocation ATP-binding protein HlyB OS=Proteus vulgaris GN=hlyB PE=3 SV=1 949 1443 5.0E-23
sp|P12866|STE6_YEAST Alpha-factor-transporting ATPase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=STE6 PE=1 SV=1 1206 1435 5.0E-23
sp|Q9QY30|ABCBB_MOUSE Bile salt export pump OS=Mus musculus GN=Abcb11 PE=1 SV=2 929 1443 6.0E-23
sp|P36371|TAP2_MOUSE Antigen peptide transporter 2 OS=Mus musculus GN=Tap2 PE=1 SV=1 942 1428 6.0E-23
sp|Q00748|MDR65_DROME Multidrug resistance protein homolog 65 OS=Drosophila melanogaster GN=Mdr65 PE=1 SV=2 1229 1439 9.0E-23
sp|Q89A96|MDLB_BUCBP Multidrug resistance-like ATP-binding protein MdlB OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=mdlB PE=3 SV=1 540 833 1.0E-22
sp|Q8LPT1|AB6B_ARATH ABC transporter B family member 6 OS=Arabidopsis thaliana GN=ABCB6 PE=1 SV=2 1199 1439 1.0E-22
sp|Q9Y7M7|MDL1_SCHPO ATP-dependent permease MDL1, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mdl1 PE=3 SV=1 1230 1443 1.0E-22
sp|Q03518|TAP1_HUMAN Antigen peptide transporter 1 OS=Homo sapiens GN=TAP1 PE=1 SV=2 1073 1436 1.0E-22
sp|Q8K985|MDLA_BUCAP Multidrug resistance-like ATP-binding protein MdlA OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=mdlA PE=3 SV=1 1227 1448 2.0E-22
sp|Q06034|MDR1_LEIEN Multidrug resistance protein 1 OS=Leishmania enriettii GN=MDR1 PE=3 SV=1 1226 1442 2.0E-22
sp|Q1GBJ0|ECFA1_LACDA Energy-coupling factor transporter ATP-binding protein EcfA1 OS=Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC 11842 / DSM 20081 / JCM 1002 / NBRC 13953 / NCIMB 11778) GN=ecfA1 PE=3 SV=1 1227 1439 2.0E-22
sp|Q28433|TAP1_GORGO Antigen peptide transporter 1 OS=Gorilla gorilla gorilla GN=TAP1 PE=2 SV=2 965 1436 4.0E-22
sp|Q8LPT1|AB6B_ARATH ABC transporter B family member 6 OS=Arabidopsis thaliana GN=ABCB6 PE=1 SV=2 1207 1439 5.0E-22
sp|Q57538|Y664_HAEIN Probable ABC transporter ATP-binding protein HI_0664 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=HI_0664 PE=1 SV=1 1072 1420 5.0E-22
sp|P9WQJ7|IRTB_MYCTU Iron import ATP-binding/permease protein IrtB OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=irtB PE=1 SV=1 1217 1443 6.0E-22
sp|P9WQJ6|IRTB_MYCTO Iron import ATP-binding/permease protein IrtB OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=irtB PE=3 SV=1 1217 1443 6.0E-22
sp|P63394|IRTB_MYCBO Iron import ATP-binding/permease protein IrtB OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=irtB PE=3 SV=1 1217 1443 6.0E-22
sp|Q04BY7|ECFA1_LACDB Energy-coupling factor transporter ATP-binding protein EcfA1 OS=Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC BAA-365) GN=ecfA1 PE=3 SV=1 1227 1439 6.0E-22
sp|Q54U44|ABCCC_DICDI ABC transporter C family member 12 OS=Dictyostelium discoideum GN=abcC12 PE=3 SV=1 917 1445 8.0E-22
sp|Q8T9W4|ABCB3_DICDI ABC transporter B family member 3 OS=Dictyostelium discoideum GN=abcB3 PE=3 SV=1 1207 1439 8.0E-22
sp|P12866|STE6_YEAST Alpha-factor-transporting ATPase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=STE6 PE=1 SV=1 1221 1425 1.0E-21
sp|P36370|TAP1_RAT Antigen peptide transporter 1 OS=Rattus norvegicus GN=Tap1 PE=1 SV=2 1073 1441 1.0E-21
sp|Q9M3B9|AB20B_ARATH ABC transporter B family member 20 OS=Arabidopsis thaliana GN=ABCB20 PE=1 SV=1 1190 1439 1.0E-21
sp|P45171|POTA_HAEIN Spermidine/putrescine import ATP-binding protein PotA OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=potA PE=3 SV=2 1209 1429 1.0E-21
sp|O70127|ABCBB_RAT Bile salt export pump OS=Rattus norvegicus GN=Abcb11 PE=1 SV=1 929 1443 2.0E-21
sp|P57551|MDLA_BUCAI Multidrug resistance-like ATP-binding protein MdlA OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=mdlA PE=3 SV=1 1193 1448 2.0E-21
sp|Q6FAN3|METN1_ACIAD Methionine import ATP-binding protein MetN 1 OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=metN1 PE=3 SV=1 1208 1424 2.0E-21
sp|Q0P9C4|PGLK_CAMJE Protein glycosylation K OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) GN=pglK PE=1 SV=1 1192 1422 2.0E-21
sp|Q52666|BZTD_RHOCB Glutamate/glutamine/aspartate/asparagine transport ATP-binding protein BztD OS=Rhodobacter capsulatus (strain ATCC BAA-309 / NBRC 16581 / SB1003) GN=bztD PE=3 SV=2 1209 1429 2.0E-21
sp|Q4A5A5|ECFA1_MYCS5 Energy-coupling factor transporter ATP-binding protein EcfA1 OS=Mycoplasma synoviae (strain 53) GN=ecfA1 PE=3 SV=1 1209 1430 2.0E-21
sp|Q98QH5|ECFA1_MYCPU Energy-coupling factor transporter ATP-binding protein EcfA1 OS=Mycoplasma pulmonis (strain UAB CTIP) GN=ecfA1 PE=3 SV=1 1227 1430 3.0E-21
sp|Q38UT9|ECFA1_LACSS Energy-coupling factor transporter ATP-binding protein EcfA1 OS=Lactobacillus sakei subsp. sakei (strain 23K) GN=ecfA1 PE=3 SV=1 1217 1442 4.0E-21
sp|P54537|ARTM_BACSU Arginine transport ATP-binding protein ArtM OS=Bacillus subtilis (strain 168) GN=artM PE=1 SV=1 1209 1429 4.0E-21
sp|P33311|MDL2_YEAST ATP-dependent permease MDL2, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MDL2 PE=1 SV=3 1200 1435 4.0E-21
sp|Q49W48|METN_STAS1 Methionine import ATP-binding protein MetN OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=metN PE=3 SV=1 1209 1424 4.0E-21
sp|Q9LHK4|AB8B_ARATH Putative ABC transporter B family member 8 OS=Arabidopsis thaliana GN=ABCB8 PE=5 SV=1 1193 1443 5.0E-21
sp|P22638|HEPA_NOSS1 Heterocyst differentiation ATP-binding protein HepA OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=hepA PE=2 SV=3 614 826 6.0E-21
sp|Q4QK57|POTA_HAEI8 Spermidine/putrescine import ATP-binding protein PotA OS=Haemophilus influenzae (strain 86-028NP) GN=potA PE=3 SV=2 1209 1429 6.0E-21
sp|Q9M3B9|AB20B_ARATH ABC transporter B family member 20 OS=Arabidopsis thaliana GN=ABCB20 PE=1 SV=1 1207 1430 7.0E-21
sp|Q7RX59|ATM1_NEUCR Iron-sulfur clusters transporter atm1, mitochondrial OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=fes-4 PE=3 SV=1 597 827 8.0E-21
sp|Q39IE7|METN1_BURL3 Methionine import ATP-binding protein MetN 1 OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=metN1 PE=3 SV=1 1227 1424 8.0E-21
sp|O85818|POTA_AGGAC Spermidine/putrescine import ATP-binding protein PotA OS=Aggregatibacter actinomycetemcomitans GN=potA PE=3 SV=1 1209 1429 9.0E-21
sp|P33310|MDL1_YEAST ATP-dependent permease MDL1, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MDL1 PE=1 SV=2 1228 1431 1.0E-20
sp|Q7VM95|METN_HAEDU Methionine import ATP-binding protein MetN OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=metN PE=3 SV=1 1209 1435 1.0E-20
sp|P29018|CYDD_ECOLI ATP-binding/permease protein CydD OS=Escherichia coli (strain K12) GN=cydD PE=1 SV=3 1068 1440 1.0E-20
sp|Q96J66|ABCCB_HUMAN ATP-binding cassette sub-family C member 11 OS=Homo sapiens GN=ABCC11 PE=1 SV=1 1008 1439 2.0E-20
sp|Q4QMH4|METN_HAEI8 Methionine import ATP-binding protein MetN OS=Haemophilus influenzae (strain 86-028NP) GN=metN PE=3 SV=1 1209 1435 2.0E-20
sp|Q7A7E3|METN1_STAAN Methionine import ATP-binding protein MetN 1 OS=Staphylococcus aureus (strain N315) GN=metN1 PE=3 SV=1 1209 1435 3.0E-20
sp|Q99WE1|METN1_STAAM Methionine import ATP-binding protein MetN 1 OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=metN1 PE=3 SV=1 1209 1435 3.0E-20
sp|Q2K8C8|FBPC_RHIEC Fe(3+) ions import ATP-binding protein FbpC OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=fbpC PE=3 SV=1 1205 1429 4.0E-20
sp|Q6GJL2|METN1_STAAR Methionine import ATP-binding protein MetN 1 OS=Staphylococcus aureus (strain MRSA252) GN=metN1 PE=3 SV=1 1209 1435 4.0E-20
sp|Q0I5E9|METN_HAES1 Methionine import ATP-binding protein MetN OS=Haemophilus somnus (strain 129Pt) GN=metN PE=3 SV=1 1209 1436 4.0E-20
sp|Q54JR2|ABCC3_DICDI ABC transporter C family member 3 OS=Dictyostelium discoideum GN=abcC3 PE=3 SV=1 870 1445 5.0E-20
sp|Q59R09|ATM1_CANAL Iron-sulfur clusters transporter ATM1, mitochondrial OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=ATM1 PE=3 SV=1 607 826 5.0E-20
sp|Q6BXD7|ATM1_DEBHA Iron-sulfur clusters transporter ATM1, mitochondrial OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=ATM1 PE=3 SV=2 590 832 5.0E-20
sp|O31339|CYSA_BACC1 Sulfate/thiosulfate import ATP-binding protein CysA OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=cysA PE=3 SV=2 1209 1429 5.0E-20
sp|Q8CTB2|METN1_STAES Methionine import ATP-binding protein MetN 1 OS=Staphylococcus epidermidis (strain ATCC 12228) GN=metN1 PE=3 SV=1 1209 1424 6.0E-20
sp|Q4HVU7|ATM1_GIBZE Iron-sulfur clusters transporter ATM1, mitochondrial OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=ATM1 PE=3 SV=1 604 823 7.0E-20
sp|Q8NY21|METN1_STAAW Methionine import ATP-binding protein MetN 1 OS=Staphylococcus aureus (strain MW2) GN=metN1 PE=3 SV=1 1209 1435 8.0E-20
sp|Q6GC27|METN1_STAAS Methionine import ATP-binding protein MetN 1 OS=Staphylococcus aureus (strain MSSA476) GN=metN1 PE=3 SV=1 1209 1435 8.0E-20
sp|Q2HIE9|ATM1_CHAGB Iron-sulfur clusters transporter ATM1, mitochondrial OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=ATM1 PE=3 SV=1 597 825 9.0E-20
sp|Q8FRX8|METN_COREF Methionine import ATP-binding protein MetN OS=Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395) GN=metN PE=3 SV=1 1225 1435 9.0E-20
sp|Q142P6|MSBA_BURXL Lipid A export ATP-binding/permease protein MsbA OS=Burkholderia xenovorans (strain LB400) GN=msbA PE=3 SV=1 598 829 1.0E-19
sp|Q92GP9|Y1073_RICCN Putative export ATP-binding/permease protein RC1073 OS=Rickettsia conorii (strain ATCC VR-613 / Malish 7) GN=RC1073 PE=3 SV=1 600 833 1.0E-19
sp|Q65VG9|METN_MANSM Methionine import ATP-binding protein MetN OS=Mannheimia succiniciproducens (strain MBEL55E) GN=metN PE=3 SV=1 1209 1435 1.0E-19
sp|Q88XV1|ECFA2_LACPL Energy-coupling factor transporter ATP-binding protein EcfA2 OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=ecfA2 PE=3 SV=1 1227 1429 1.0E-19
sp|P44785|METN_HAEIN Methionine import ATP-binding protein MetN OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=metN PE=3 SV=1 1209 1435 1.0E-19
sp|Q8NSN2|METN_CORGL Methionine import ATP-binding protein MetN OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=metN PE=3 SV=1 1193 1435 1.0E-19
sp|Q6F9P2|METN2_ACIAD Methionine import ATP-binding protein MetN 2 OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=metN2 PE=3 SV=1 1209 1431 1.0E-19
sp|Q9FVV9|NAP5_ARATH Probable non-intrinsic ABC protein 5 OS=Arabidopsis thaliana GN=NAP5 PE=2 SV=1 698 854 1.0E-19
sp|Q74K65|POTA_LACJO Spermidine/putrescine import ATP-binding protein PotA OS=Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533) GN=potA PE=3 SV=1 1209 1429 1.0E-19
sp|Q97EK8|ECFA1_CLOAB Energy-coupling factor transporter ATP-binding protein EcfA1 OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=ecfA1 PE=3 SV=1 1225 1439 2.0E-19
sp|Q2YVT7|METN1_STAAB Methionine import ATP-binding protein MetN 1 OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=metN1 PE=3 SV=1 1209 1435 2.0E-19
sp|Q0BH79|METN1_BURCM Methionine import ATP-binding protein MetN 1 OS=Burkholderia ambifaria (strain ATCC BAA-244 / AMMD) GN=metN1 PE=3 SV=1 1227 1424 2.0E-19
sp|Q5HQQ9|METN2_STAEQ Methionine import ATP-binding protein MetN 2 OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=metN2 PE=3 SV=1 1209 1424 2.0E-19
sp|A3CMQ7|POTA_STRSV Spermidine/putrescine import ATP-binding protein PotA OS=Streptococcus sanguinis (strain SK36) GN=potA PE=3 SV=1 1209 1429 2.0E-19
sp|Q8DRR9|ECFA1_STRMU Energy-coupling factor transporter ATP-binding protein EcfA1 OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=ecfA1 PE=3 SV=1 1209 1432 2.0E-19
sp|Q839D5|ECFA1_ENTFA Energy-coupling factor transporter ATP-binding protein EcfA1 OS=Enterococcus faecalis (strain ATCC 700802 / V583) GN=ecfA1 PE=3 SV=1 1209 1431 2.0E-19
sp|Q6LPK6|MSBA_PHOPR Lipid A export ATP-binding/permease protein MsbA OS=Photobacterium profundum GN=msbA PE=3 SV=1 597 823 2.0E-19
sp|Q5HIL5|METN1_STAAC Methionine import ATP-binding protein MetN 1 OS=Staphylococcus aureus (strain COL) GN=metN1 PE=3 SV=1 1209 1435 2.0E-19
sp|Q2G0V2|METN1_STAA8 Methionine import ATP-binding protein MetN 1 OS=Staphylococcus aureus (strain NCTC 8325) GN=metN1 PE=3 SV=1 1209 1435 2.0E-19
sp|Q9N0V3|ABCBB_RABIT Bile salt export pump OS=Oryctolagus cuniculus GN=ABCB11 PE=2 SV=1 1207 1443 2.0E-19
sp|Q5B1Q2|ATM1_EMENI Iron-sulfur clusters transporter atm1, mitochondrial OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=atm1 PE=3 SV=2 597 823 2.0E-19
sp|Q1LQF6|METN_CUPMC Methionine import ATP-binding protein MetN OS=Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34) GN=metN PE=3 SV=1 1209 1424 2.0E-19
sp|Q8VNL9|ECFA_ENTFC Energy-coupling factor transporter ATP-binding protein EcfA OS=Enterococcus faecium GN=ecfA PE=3 SV=1 1227 1431 2.0E-19
sp|Q62IG3|MSBA_BURMA Lipid A export ATP-binding/permease protein MsbA OS=Burkholderia mallei (strain ATCC 23344) GN=msbA PE=3 SV=2 614 826 4.0E-19
sp|Q63VX7|MSBA_BURPS Lipid A export ATP-binding/permease protein MsbA OS=Burkholderia pseudomallei (strain K96243) GN=msbA PE=3 SV=1 614 826 4.0E-19
sp|Q3JUI6|MSBA_BURP1 Lipid A export ATP-binding/permease protein MsbA OS=Burkholderia pseudomallei (strain 1710b) GN=msbA PE=3 SV=2 614 826 4.0E-19
sp|Q8DAV2|MSBA_VIBVU Lipid A export ATP-binding/permease protein MsbA OS=Vibrio vulnificus (strain CMCP6) GN=msbA PE=3 SV=1 596 826 6.0E-19
sp|Q21NS8|MSBA_SACD2 Lipid A export ATP-binding/permease protein MsbA OS=Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024) GN=msbA PE=3 SV=1 587 823 6.0E-19
sp|Q4UMZ3|Y214_RICFE Putative export ATP-binding/permease protein RF_0214 OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=RF_0214 PE=3 SV=2 600 833 7.0E-19
sp|Q7MJ07|MSBA_VIBVY Lipid A export ATP-binding/permease protein MsbA OS=Vibrio vulnificus (strain YJ016) GN=msbA PE=3 SV=2 596 826 9.0E-19
sp|P0CL93|ATM1_CRYNB Iron-sulfur clusters transporter ATM1, mitochondrial OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=ATM1 PE=3 SV=1 598 823 1.0E-18
sp|Q4PH16|ATM1_USTMA Iron-sulfur clusters transporter ATM1, mitochondrial OS=Ustilago maydis (strain 521 / FGSC 9021) GN=ATM1 PE=3 SV=1 535 823 1.0E-18
sp|P36497|PEDD_PEDAC Pediocin PA-1 transport/processing ATP-binding protein PedD OS=Pediococcus acidilactici GN=pedD PE=3 SV=1 383 829 2.0E-18
sp|Q9CJB8|LCNCL_LACLA Lactococcin transport/processing ATP-binding protein LcnC-like OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=lcnC PE=3 SV=1 613 823 2.0E-18
sp|P0CL92|ATM1_CRYNJ Iron-sulfur clusters transporter ATM1, mitochondrial OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=ATM1 PE=3 SV=1 598 823 2.0E-18
sp|Q933I3|LKTB_MANGL Leukotoxin translocation ATP-binding protein LktB OS=Mannheimia glucosida GN=lktB PE=3 SV=1 607 832 2.0E-18
sp|O07550|YHEI_BACSU Probable multidrug resistance ABC transporter ATP-binding/permease protein YheI OS=Bacillus subtilis (strain 168) GN=yheI PE=1 SV=1 620 823 3.0E-18
sp|Q93FG6|LKB2B_MANHA Leukotoxin translocation ATP-binding protein LktB OS=Mannheimia haemolytica GN=lktB PE=3 SV=1 607 832 3.0E-18
sp|Q93FH3|LKB16_MANHA Leukotoxin translocation ATP-binding protein LktB OS=Mannheimia haemolytica GN=lktB PE=3 SV=1 607 832 3.0E-18
sp|P16532|LKB1A_MANHA Leukotoxin translocation ATP-binding protein LktB OS=Mannheimia haemolytica GN=lktB PE=3 SV=1 607 832 3.0E-18
sp|Q93FH2|LKB13_MANHA Leukotoxin translocation ATP-binding protein LktB OS=Mannheimia haemolytica GN=lktB PE=3 SV=1 607 832 3.0E-18
sp|Q93FH6|LKB1B_MANHA Leukotoxin translocation ATP-binding protein LktB OS=Mannheimia haemolytica GN=lktB PE=3 SV=1 607 832 3.0E-18
sp|P0C086|LKTB7_MANHA Leukotoxin translocation ATP-binding protein LktB OS=Mannheimia haemolytica GN=lktB PE=3 SV=1 607 832 3.0E-18
sp|P0C087|LKB14_MANHA Leukotoxin translocation ATP-binding protein LktB OS=Mannheimia haemolytica GN=lktB PE=3 SV=1 607 832 3.0E-18
sp|Q933E0|LKTB_BIBTR Leukotoxin translocation ATP-binding protein LktB OS=Bibersteinia trehalosi GN=lktB PE=3 SV=1 607 832 3.0E-18
sp|Q5PGH0|MSBA_SALPA Lipid A export ATP-binding/permease protein MsbA OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=msbA PE=3 SV=1 587 823 4.0E-18
sp|Q1RDU4|MSBA_ECOUT Lipid A export ATP-binding/permease protein MsbA OS=Escherichia coli (strain UTI89 / UPEC) GN=msbA PE=3 SV=1 592 823 4.0E-18
sp|Q8FJB1|MSBA_ECOL6 Lipid A export ATP-binding/permease protein MsbA OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=msbA PE=3 SV=1 592 823 4.0E-18
sp|Q0TJD9|MSBA_ECOL5 Lipid A export ATP-binding/permease protein MsbA OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=msbA PE=3 SV=1 592 823 4.0E-18
sp|Q0VQP5|MSBA_ALCBS Lipid A export ATP-binding/permease protein MsbA OS=Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2) GN=msbA PE=3 SV=1 602 827 4.0E-18
sp|Q32E34|MSBA_SHIDS Lipid A export ATP-binding/permease protein MsbA OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=msbA PE=3 SV=1 592 823 4.0E-18
sp|Q93FH0|LKB2A_MANHA Leukotoxin translocation ATP-binding protein LktB OS=Mannheimia haemolytica GN=lktB PE=3 SV=2 607 832 4.0E-18
sp|Q31YT6|MSBA_SHIBS Lipid A export ATP-binding/permease protein MsbA OS=Shigella boydii serotype 4 (strain Sb227) GN=msbA PE=3 SV=1 592 823 4.0E-18
sp|P60752|MSBA_ECOLI Lipid A export ATP-binding/permease protein MsbA OS=Escherichia coli (strain K12) GN=msbA PE=1 SV=1 592 823 4.0E-18
sp|P60753|MSBA_ECO57 Lipid A export ATP-binding/permease protein MsbA OS=Escherichia coli O157:H7 GN=msbA PE=3 SV=1 592 823 4.0E-18
sp|Q3Z3K7|MSBA_SHISS Lipid A export ATP-binding/permease protein MsbA OS=Shigella sonnei (strain Ss046) GN=msbA PE=3 SV=1 592 823 4.0E-18
sp|Q83LP0|MSBA_SHIFL Lipid A export ATP-binding/permease protein MsbA OS=Shigella flexneri GN=msbA PE=3 SV=1 592 823 4.0E-18
sp|Q4WLN7|ATM1_ASPFU Iron-sulfur clusters transporter atm1, mitochondrial OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=atm1 PE=3 SV=1 597 823 4.0E-18
sp|Q8ST87|ABCCA_DICDI ABC transporter C family member 10 OS=Dictyostelium discoideum GN=abcC10 PE=3 SV=1 917 1445 5.0E-18
sp|P63359|MSBA_SALTY Lipid A export ATP-binding/permease protein MsbA OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=msbA PE=1 SV=1 587 823 5.0E-18
sp|P63360|MSBA_SALTI Lipid A export ATP-binding/permease protein MsbA OS=Salmonella typhi GN=msbA PE=3 SV=1 587 823 5.0E-18
sp|Q57R14|MSBA_SALCH Lipid A export ATP-binding/permease protein MsbA OS=Salmonella choleraesuis (strain SC-B67) GN=msbA PE=3 SV=1 587 823 5.0E-18
sp|P55122|LKTB_PASSP Leukotoxin translocation ATP-binding protein LktB OS=Pasteurella haemolytica-like sp. (strain 5943B) GN=lktB PE=3 SV=1 607 828 5.0E-18
sp|Q1QX69|MSBA_CHRSD Lipid A export ATP-binding/permease protein MsbA OS=Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768) GN=msbA PE=3 SV=1 589 829 5.0E-18
sp|Q2SZW0|MSBA_BURTA Lipid A export ATP-binding/permease protein MsbA OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=msbA PE=3 SV=1 614 826 6.0E-18
sp|Q31FG2|MSBA_THICR Lipid A export ATP-binding/permease protein MsbA OS=Thiomicrospira crunogena (strain XCL-2) GN=msbA PE=3 SV=1 584 823 6.0E-18
sp|Q9VL32|SUR_DROME ATP-binding cassette sub-family C member Sur OS=Drosophila melanogaster GN=Sur PE=1 SV=4 863 1139 6.0E-18
sp|P26760|RTX1B_ACTPL Toxin RTX-I translocation ATP-binding protein OS=Actinobacillus pleuropneumoniae GN=apxIB PE=1 SV=2 583 823 8.0E-18
sp|P54718|YFIB_BACSU Uncharacterized ABC transporter ATP-binding protein YfiB OS=Bacillus subtilis (strain 168) GN=yfiB PE=3 SV=1 619 833 8.0E-18
sp|Q2ULH4|ATM1_ASPOR Iron-sulfur clusters transporter atm1, mitochondrial OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=atm1 PE=3 SV=1 594 823 8.0E-18
sp|Q9ZCM8|Y696_RICPR Putative export ATP-binding/permease protein RP696 OS=Rickettsia prowazekii (strain Madrid E) GN=RP696 PE=3 SV=1 585 833 9.0E-18
sp|P45861|YWJA_BACSU Uncharacterized ABC transporter ATP-binding protein YwjA OS=Bacillus subtilis (strain 168) GN=ywjA PE=3 SV=1 580 823 1.0E-17
sp|Q28689|MRP2_RABIT Canalicular multispecific organic anion transporter 1 OS=Oryctolagus cuniculus GN=ABCC2 PE=2 SV=1 1039 1442 1.0E-17
sp|Q8FDZ8|HLYB_ECOL6 Alpha-hemolysin translocation ATP-binding protein HlyB OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=hlyB PE=3 SV=1 583 832 1.0E-17
sp|Q8T9W2|ABCB5_DICDI ABC transporter B family member 5 OS=Dictyostelium discoideum GN=abcB5 PE=3 SV=1 598 829 1.0E-17
sp|Q47908|MSBA_FRANO Lipid A export ATP-binding/permease protein MsbA OS=Francisella novicida GN=msbA PE=3 SV=2 585 826 1.0E-17
sp|Q03727|COMA_STRPN Transport/processing ATP-binding protein ComA OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=comA PE=3 SV=3 613 823 1.0E-17
sp|Q46Y89|MSBA_CUPPJ Lipid A export ATP-binding/permease protein MsbA OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=msbA PE=3 SV=1 621 823 1.0E-17
sp|Q5E0F2|MSBA_VIBF1 Lipid A export ATP-binding/permease protein MsbA OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=msbA PE=3 SV=1 617 823 2.0E-17
sp|P59653|COMA_STRR6 Transport/processing ATP-binding protein ComA OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=comA PE=3 SV=1 613 823 2.0E-17
sp|Q9RCG7|PAXB_PASAE Exotoxin translocation ATP-binding protein PaxB OS=Pasteurella aerogenes GN=paxB PE=3 SV=1 602 828 2.0E-17
sp|Q54P13|ABCC8_DICDI ABC transporter C family member 8 OS=Dictyostelium discoideum GN=abcC8 PE=3 SV=1 1074 1439 2.0E-17
sp|Q8VI47|MRP2_MOUSE Canalicular multispecific organic anion transporter 1 OS=Mus musculus GN=Abcc2 PE=1 SV=2 1039 1438 2.0E-17
sp|Q0BKJ3|MSBA_FRATO Lipid A export ATP-binding/permease protein MsbA OS=Francisella tularensis subsp. holarctica (strain OSU18) GN=msbA PE=3 SV=1 585 826 2.0E-17
sp|Q2A1U9|MSBA_FRATH Lipid A export ATP-binding/permease protein MsbA OS=Francisella tularensis subsp. holarctica (strain LVS) GN=msbA PE=3 SV=1 585 826 2.0E-17
sp|P08716|HLYBP_ECOLX Alpha-hemolysin translocation ATP-binding protein HlyB OS=Escherichia coli GN=hlyB PE=1 SV=1 583 832 3.0E-17
sp|P55469|Y4GM_RHISN Uncharacterized ABC transporter ATP-binding protein y4gM OS=Rhizobium sp. (strain NGR234) GN=NGR_a03510 PE=3 SV=1 594 829 3.0E-17
sp|Q0P9C4|PGLK_CAMJE Protein glycosylation K OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) GN=pglK PE=1 SV=1 562 808 3.0E-17
sp|P33310|MDL1_YEAST ATP-dependent permease MDL1, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MDL1 PE=1 SV=2 622 823 3.0E-17
sp|Q5NIG3|MSBA_FRATT Lipid A export ATP-binding/permease protein MsbA OS=Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4) GN=msbA PE=3 SV=1 585 826 4.0E-17
sp|Q14JW6|MSBA_FRAT1 Lipid A export ATP-binding/permease protein MsbA OS=Francisella tularensis subsp. tularensis (strain FSC 198) GN=msbA PE=1 SV=1 585 826 4.0E-17
sp|P10089|HLYBC_ECOLX Alpha-hemolysin translocation ATP-binding protein HlyB OS=Escherichia coli GN=hlyB PE=3 SV=2 583 832 4.0E-17
sp|Q00564|LCNC_LACLL Lactococcin-A transport/processing ATP-binding protein LcnC OS=Lactococcus lactis subsp. lactis GN=lcnC PE=3 SV=1 613 833 5.0E-17
sp|Q47258|HLYB3_ECOLX Alpha-hemolysin translocation ATP-binding protein HlyB OS=Escherichia coli GN=hlyB PE=1 SV=1 583 832 5.0E-17
sp|Q7N6C6|MSBA_PHOLL Lipid A export ATP-binding/permease protein MsbA OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=msbA PE=3 SV=1 596 824 6.0E-17
sp|Q5X498|MSBA_LEGPA Lipid A export ATP-binding/permease protein MsbA OS=Legionella pneumophila (strain Paris) GN=msbA PE=3 SV=1 567 823 6.0E-17
sp|P59852|LAGD_LACLL Lactococcin-G-processing and transport ATP-binding protein LagD OS=Lactococcus lactis subsp. lactis GN=lagD PE=1 SV=1 614 826 7.0E-17
sp|Q68W42|Y691_RICTY Putative export ATP-binding/permease protein RT0691 OS=Rickettsia typhi (strain ATCC VR-144 / Wilmington) GN=RT0691 PE=3 SV=1 600 833 8.0E-17
sp|Q6D437|MSBA_PECAS Lipid A export ATP-binding/permease protein MsbA OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=msbA PE=3 SV=2 591 823 1.0E-16
sp|Q3J7R8|MSBA_NITOC Lipid A export ATP-binding/permease protein MsbA OS=Nitrosococcus oceani (strain ATCC 19707 / NCIMB 11848) GN=msbA PE=3 SV=1 621 829 1.0E-16
sp|P23702|LTXB_AGGAC Leukotoxin export ATP-binding protein LtxB OS=Aggregatibacter actinomycetemcomitans GN=ltxB PE=1 SV=1 607 835 1.0E-16
sp|P12866|STE6_YEAST Alpha-factor-transporting ATPase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=STE6 PE=1 SV=1 622 823 1.0E-16
sp|Q60AA3|MSBA_METCA Lipid A export ATP-binding/permease protein MsbA OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) GN=msbA PE=3 SV=1 618 823 1.0E-16
sp|Q5QU36|MSBA_IDILO Lipid A export ATP-binding/permease protein MsbA OS=Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) GN=msbA PE=3 SV=1 567 831 1.0E-16
sp|Q04473|RTX3B_ACTPL Toxin RTX-III translocation ATP-binding protein OS=Actinobacillus pleuropneumoniae GN=apxIIIB PE=3 SV=1 607 823 2.0E-16
sp|P97998|MDL1_CANAX ATP-dependent permease MDL1 OS=Candida albicans GN=MDL1 PE=3 SV=1 619 826 2.0E-16
sp|Q5WVN2|MSBA_LEGPL Lipid A export ATP-binding/permease protein MsbA OS=Legionella pneumophila (strain Lens) GN=msbA PE=3 SV=1 616 844 2.0E-16
sp|Q5ZUH9|MSBA_LEGPH Lipid A export ATP-binding/permease protein MsbA OS=Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) GN=msbA PE=3 SV=2 616 823 2.0E-16
sp|O06967|BMRA_BACSU Multidrug resistance ABC transporter ATP-binding/permease protein BmrA OS=Bacillus subtilis (strain 168) GN=bmrA PE=1 SV=1 614 823 2.0E-16
sp|Q6AJW3|MSBA_DESPS Lipid A export ATP-binding/permease protein MsbA OS=Desulfotalea psychrophila (strain LSv54 / DSM 12343) GN=msbA PE=3 SV=1 594 829 3.0E-16
sp|Q8LPK2|AB2B_ARATH ABC transporter B family member 2 OS=Arabidopsis thaliana GN=ABCB2 PE=1 SV=3 598 823 3.0E-16
sp|Q751N2|ATM1_ASHGO Iron-sulfur clusters transporter ATM1, mitochondrial OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=ATM1 PE=3 SV=1 607 829 4.0E-16
sp|Q87R16|MSBA_VIBPA Lipid A export ATP-binding/permease protein MsbA OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=msbA PE=3 SV=1 596 823 4.0E-16
sp|P33311|MDL2_YEAST ATP-dependent permease MDL2, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MDL2 PE=1 SV=3 603 823 4.0E-16
sp|O15438|MRP3_HUMAN Canalicular multispecific organic anion transporter 2 OS=Homo sapiens GN=ABCC3 PE=1 SV=3 1144 1441 6.0E-16
sp|Q9CMG7|MSBA_PASMU Lipid A export ATP-binding/permease protein MsbA OS=Pasteurella multocida (strain Pm70) GN=msbA PE=3 SV=1 617 823 7.0E-16
sp|Q2LVL0|MSBA_SYNAS Lipid A export ATP-binding/permease protein MsbA OS=Syntrophus aciditrophicus (strain SB) GN=msbA PE=3 SV=1 594 831 7.0E-16
sp|P36370|TAP1_RAT Antigen peptide transporter 1 OS=Rattus norvegicus GN=Tap1 PE=1 SV=2 424 844 7.0E-16
sp|P21447|MDR1A_MOUSE Multidrug resistance protein 1A OS=Mus musculus GN=Abcb1a PE=1 SV=3 598 836 9.0E-16
sp|Q4KJB2|MSBA_PSEF5 Lipid A export ATP-binding/permease protein MsbA OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=msbA PE=3 SV=1 602 833 9.0E-16
sp|Q9ZR72|AB1B_ARATH ABC transporter B family member 1 OS=Arabidopsis thaliana GN=ABCB1 PE=1 SV=1 619 857 9.0E-16
sp|Q2K342|NDVA_RHIEC Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=ndvA PE=3 SV=2 597 827 1.0E-15
sp|Q9C8H1|AB11C_ARATH ABC transporter C family member 11 OS=Arabidopsis thaliana GN=ABCC11 PE=2 SV=2 1221 1444 1.0E-15
sp|P0AAG5|MDLB_ECOLI Multidrug resistance-like ATP-binding protein MdlB OS=Escherichia coli (strain K12) GN=mdlB PE=1 SV=1 594 823 1.0E-15
sp|P0AAG6|MDLB_ECOL6 Multidrug resistance-like ATP-binding protein MdlB OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=mdlB PE=3 SV=1 594 823 1.0E-15
sp|P0AAG7|MDLB_ECO57 Multidrug resistance-like ATP-binding protein MdlB OS=Escherichia coli O157:H7 GN=mdlB PE=3 SV=1 594 823 1.0E-15
sp|Q9LSJ6|AB17B_ARATH ABC transporter B family member 17 OS=Arabidopsis thaliana GN=ABCB17 PE=3 SV=1 619 826 1.0E-15
sp|Q5RKI8|ABCB8_RAT ATP-binding cassette sub-family B member 8, mitochondrial OS=Rattus norvegicus GN=Abcb8 PE=2 SV=1 622 872 1.0E-15
sp|Q6C6N0|ATM1_YARLI Iron-sulfur clusters transporter ATM1, mitochondrial OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=ATM1 PE=3 SV=1 592 833 1.0E-15
sp|Q9ZR72|AB1B_ARATH ABC transporter B family member 1 OS=Arabidopsis thaliana GN=ABCB1 PE=1 SV=1 619 823 1.0E-15
sp|P54719|YFIC_BACSU Uncharacterized ABC transporter ATP-binding protein YfiC OS=Bacillus subtilis (strain 168) GN=yfiC PE=3 SV=1 596 833 2.0E-15
sp|Q1RJ91|Y492_RICBR Putative export ATP-binding/permease protein RBE_0492 OS=Rickettsia bellii (strain RML369-C) GN=RBE_0492 PE=3 SV=1 621 833 2.0E-15
sp|P21448|MDR1_CRIGR Multidrug resistance protein 1 OS=Cricetulus griseus GN=ABCB1 PE=1 SV=2 598 836 2.0E-15
sp|Q39E73|MSBA_BURL3 Lipid A export ATP-binding/permease protein MsbA OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=msbA PE=3 SV=2 607 823 2.0E-15
sp|Q704E8|ABCB7_RAT ATP-binding cassette sub-family B member 7, mitochondrial OS=Rattus norvegicus GN=Abcb7 PE=1 SV=1 607 844 3.0E-15
sp|Q61102|ABCB7_MOUSE ATP-binding cassette sub-family B member 7, mitochondrial OS=Mus musculus GN=Abcb7 PE=1 SV=3 607 832 3.0E-15
sp|Q8XXB6|MSBA_RALSO Lipid A export ATP-binding/permease protein MsbA OS=Ralstonia solanacearum (strain GMI1000) GN=msbA PE=3 SV=1 623 823 3.0E-15
sp|Q66CI3|MSBA_YERPS Lipid A export ATP-binding/permease protein MsbA OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=msbA PE=3 SV=1 618 823 3.0E-15
sp|Q1CGH0|MSBA_YERPN Lipid A export ATP-binding/permease protein MsbA OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=msbA PE=3 SV=1 618 823 3.0E-15
sp|Q8ZGA9|MSBA_YERPE Lipid A export ATP-binding/permease protein MsbA OS=Yersinia pestis GN=msbA PE=3 SV=1 618 823 3.0E-15
sp|Q1CA68|MSBA_YERPA Lipid A export ATP-binding/permease protein MsbA OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=msbA PE=3 SV=1 618 823 3.0E-15
sp|Q1BUV6|MSBA_BURCA Lipid A export ATP-binding/permease protein MsbA OS=Burkholderia cenocepacia (strain AU 1054) GN=msbA PE=3 SV=2 619 823 3.0E-15
sp|P0A4W5|Y1304_MYCBO Uncharacterized ABC transporter ATP-binding protein Mb1304c OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=Mb1304c PE=3 SV=1 619 823 4.0E-15
sp|P9WQJ1|Y1273_MYCTU Uncharacterized ABC transporter ATP-binding protein Rv1273c OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv1273c PE=1 SV=1 619 823 4.0E-15
sp|P9WQJ0|Y1273_MYCTO Uncharacterized ABC transporter ATP-binding protein MT1311 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT1311 PE=3 SV=1 619 823 4.0E-15
sp|P94367|CYDD_BACSU ATP-binding/permease protein CydD OS=Bacillus subtilis (strain 168) GN=cydD PE=3 SV=1 585 833 5.0E-15
sp|Q9CHL8|LMRA_LACLA Multidrug resistance ABC transporter ATP-binding and permease protein OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=lmrA PE=1 SV=2 530 823 6.0E-15
sp|O31708|YKNV_BACSU Uncharacterized ABC transporter ATP-binding protein YknV OS=Bacillus subtilis (strain 168) GN=yknV PE=3 SV=1 597 823 6.0E-15
sp|O14286|ATM1_SCHPO Iron-sulfur clusters transporter atm1, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=atm1 PE=3 SV=2 594 833 7.0E-15
sp|Q9HUG8|MSBA_PSEAE Lipid A export ATP-binding/permease protein MsbA OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=msbA PE=3 SV=1 550 831 9.0E-15
sp|Q4FS42|MSBA_PSYA2 Lipid A export ATP-binding/permease protein MsbA OS=Psychrobacter arcticus (strain DSM 17307 / 273-4) GN=msbA PE=3 SV=1 619 839 9.0E-15
sp|Q9FUT3|AB23B_ARATH ABC transporter B family member 23, mitochondrial OS=Arabidopsis thaliana GN=ABCB23 PE=2 SV=1 604 827 1.0E-14
sp|Q9CXJ4|ABCB8_MOUSE ATP-binding cassette sub-family B member 8, mitochondrial OS=Mus musculus GN=Abcb8 PE=1 SV=1 622 872 1.0E-14
sp|Q21WN9|MSBA_RHOFT Lipid A export ATP-binding/permease protein MsbA OS=Rhodoferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118) GN=msbA PE=3 SV=1 623 834 1.0E-14
sp|O75027|ABCB7_HUMAN ATP-binding cassette sub-family B member 7, mitochondrial OS=Homo sapiens GN=ABCB7 PE=1 SV=2 607 844 2.0E-14
sp|Q1MAB5|NDVA_RHIL3 Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Rhizobium leguminosarum bv. viciae (strain 3841) GN=ndvA PE=3 SV=1 597 827 2.0E-14
sp|Q1LQD3|MSBA_CUPMC Lipid A export ATP-binding/permease protein MsbA OS=Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34) GN=msbA PE=3 SV=1 623 823 2.0E-14
sp|Q9C7F2|AB14B_ARATH ABC transporter B family member 14 OS=Arabidopsis thaliana GN=ABCB14 PE=3 SV=1 607 837 2.0E-14
sp|P06795|MDR1B_MOUSE Multidrug resistance protein 1B OS=Mus musculus GN=Abcb1b PE=1 SV=1 598 823 2.0E-14
sp|Q3SFZ6|MSBA_THIDA Lipid A export ATP-binding/permease protein MsbA OS=Thiobacillus denitrificans (strain ATCC 25259) GN=msbA PE=3 SV=1 597 831 2.0E-14
sp|Q10418|MESD_LEUME Mesentericin-Y105 transport/processing ATP-binding protein MesD OS=Leuconostoc mesenteroides GN=mesD PE=3 SV=1 519 833 3.0E-14
sp|P21449|MDR2_CRIGR Multidrug resistance protein 2 OS=Cricetulus griseus GN=PGY2 PE=2 SV=2 598 823 3.0E-14
sp|Q47JR8|MSBA_DECAR Lipid A export ATP-binding/permease protein MsbA OS=Dechloromonas aromatica (strain RCB) GN=msbA PE=3 SV=1 619 823 3.0E-14
sp|B2GUP8|ABCB8_XENTR ATP-binding cassette sub-family B member 8, mitochondrial OS=Xenopus tropicalis GN=abcb8 PE=2 SV=1 607 843 3.0E-14
sp|P71082|YGAD_BACSU Putative multidrug export ATP-binding/permease protein YgaD OS=Bacillus subtilis (strain 168) GN=ygaD PE=3 SV=2 594 829 3.0E-14
sp|Q1QBW0|MSBA_PSYCK Lipid A export ATP-binding/permease protein MsbA OS=Psychrobacter cryohalolentis (strain K5) GN=msbA PE=3 SV=1 619 839 3.0E-14
sp|Q9KQW9|MSBA_VIBCH Lipid A export ATP-binding/permease protein MsbA OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=msbA PE=1 SV=1 572 829 4.0E-14
sp|P57552|MDLB_BUCAI Multidrug resistance-like ATP-binding protein MdlB OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=mdlB PE=3 SV=1 590 831 4.0E-14
sp|Q54BU4|ABCB1_DICDI ABC transporter B family member 1 OS=Dictyostelium discoideum GN=abcB1 PE=3 SV=1 585 830 4.0E-14
sp|P40416|ATM1_YEAST Iron-sulfur clusters transporter ATM1, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ATM1 PE=1 SV=2 607 823 4.0E-14
sp|Q9NRK6|ABCBA_HUMAN ATP-binding cassette sub-family B member 10, mitochondrial OS=Homo sapiens GN=ABCB10 PE=1 SV=2 619 823 5.0E-14
sp|Q02592|HMT1_SCHPO Heavy metal tolerance protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=hmt1 PE=2 SV=3 595 823 5.0E-14
sp|Q492S9|MSBA_BLOPB Lipid A export ATP-binding/permease protein MsbA OS=Blochmannia pennsylvanicus (strain BPEN) GN=msbA PE=3 SV=1 618 823 5.0E-14
sp|Q480N3|MSBA2_COLP3 Lipid A export ATP-binding/permease protein MsbA 2 OS=Colwellia psychrerythraea (strain 34H / ATCC BAA-681) GN=msbA2 PE=3 SV=2 609 833 7.0E-14
sp|Q46717|HLYB_ECO57 Alpha-hemolysin translocation ATP-binding protein HlyB OS=Escherichia coli O157:H7 GN=hlyB PE=3 SV=2 596 823 7.0E-14
sp|Q3KJ31|MSBA_PSEPF Lipid A export ATP-binding/permease protein MsbA OS=Pseudomonas fluorescens (strain Pf0-1) GN=msbA PE=3 SV=1 622 866 7.0E-14
sp|Q9JI39|ABCBA_MOUSE ATP-binding cassette sub-family B member 10, mitochondrial OS=Mus musculus GN=Abcb10 PE=1 SV=1 622 848 7.0E-14
sp|Q6CX96|ATM1_KLULA Iron-sulfur clusters transporter ATM1, mitochondrial OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=ATM1 PE=3 SV=1 607 823 9.0E-14
sp|Q9NP58|ABCB6_HUMAN ATP-binding cassette sub-family B member 6, mitochondrial OS=Homo sapiens GN=ABCB6 PE=1 SV=1 607 823 9.0E-14
sp|P36619|PMD1_SCHPO Leptomycin B resistance protein pmd1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pmd1 PE=3 SV=2 597 837 9.0E-14
sp|Q9M0G9|AB24B_ARATH ABC transporter B family member 24, mitochondrial OS=Arabidopsis thaliana GN=ABCB24 PE=2 SV=1 599 820 9.0E-14
sp|Q9FWX8|AB12B_ARATH ABC transporter B family member 12 OS=Arabidopsis thaliana GN=ABCB12 PE=2 SV=2 622 823 1.0E-13
sp|Q7FB56|AB15C_ARATH Putative ABC transporter C family member 15 OS=Arabidopsis thaliana GN=ABCC15 PE=5 SV=2 1222 1443 1.0E-13
sp|Q9C7F8|AB13B_ARATH ABC transporter B family member 13 OS=Arabidopsis thaliana GN=ABCB13 PE=3 SV=1 622 823 1.0E-13
sp|Q23868|TAGC_DICDI Serine protease/ABC transporter B family protein tagC OS=Dictyostelium discoideum GN=tagC PE=2 SV=2 619 823 1.0E-13
sp|P71355|Y663_HAEIN Uncharacterized ABC transporter ATP-binding protein HI_0663 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=HI_0663 PE=3 SV=1 584 841 1.0E-13
sp|Q7NZU6|MSBA_CHRVO Lipid A export ATP-binding/permease protein MsbA OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=msbA PE=3 SV=1 619 840 1.0E-13
sp|Q6FIK3|ATM1_CANGA Iron-sulfur clusters transporter ATM1, mitochondrial OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=ATM1 PE=3 SV=1 607 833 1.0E-13
sp|Q57180|Y1051_HAEIN Uncharacterized ABC transporter ATP-binding protein HI_1051 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=HI_1051 PE=3 SV=1 588 823 1.0E-13
sp|Q9SGY1|AB10B_ARATH ABC transporter B family member 10 OS=Arabidopsis thaliana GN=ABCB10 PE=1 SV=2 598 842 1.0E-13
sp|Q483B6|MSBA1_COLP3 Lipid A export ATP-binding/permease protein MsbA 1 OS=Colwellia psychrerythraea (strain 34H / ATCC BAA-681) GN=msbA1 PE=3 SV=1 623 823 1.0E-13
sp|Q54RU1|ABCB6_DICDI ABC transporter B family member 6 OS=Dictyostelium discoideum GN=abcB6 PE=3 SV=1 536 823 1.0E-13
sp|P21441|MDR_LEITA Multidrug resistance protein OS=Leishmania tarentolae GN=PGPA PE=3 SV=2 500 836 2.0E-13
sp|P34712|PGP1_CAEEL Multidrug resistance protein pgp-1 OS=Caenorhabditis elegans GN=pgp-1 PE=1 SV=2 622 831 2.0E-13
sp|Q080T2|MSBA_SHEFN Lipid A export ATP-binding/permease protein MsbA OS=Shewanella frigidimarina (strain NCIMB 400) GN=msbA PE=3 SV=1 618 823 2.0E-13
sp|Q2YU20|Y1799_STAAB Putative multidrug export ATP-binding/permease protein SAB1799c OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=SAB1799c PE=3 SV=1 572 823 2.0E-13
sp|P47261|Y015_MYCGE Putative ABC transporter ATP-binding protein MG015 OS=Mycoplasma genitalium (strain ATCC 33530 / G-37 / NCTC 10195) GN=MG015 PE=3 SV=1 596 839 2.0E-13
sp|P11599|HLYB_PROVU Alpha-hemolysin translocation ATP-binding protein HlyB OS=Proteus vulgaris GN=hlyB PE=3 SV=1 602 828 2.0E-13
sp|Q0A4U4|MSBA_ALKEH Lipid A export ATP-binding/permease protein MsbA OS=Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1) GN=msbA PE=3 SV=1 622 833 2.0E-13
sp|Q12C33|MSBA_POLSJ Lipid A export ATP-binding/permease protein MsbA OS=Polaromonas sp. (strain JS666 / ATCC BAA-500) GN=msbA PE=3 SV=1 623 823 2.0E-13
sp|Q2G506|ATM1_NOVAD ATM1-type heavy metal exporter OS=Novosphingobium aromaticivorans (strain DSM 12444 / F199) GN=atm1 PE=1 SV=1 594 823 3.0E-13
sp|Q2NUA5|MSBA_SODGM Lipid A export ATP-binding/permease protein MsbA OS=Sodalis glossinidius (strain morsitans) GN=msbA PE=3 SV=1 618 823 3.0E-13
sp|Q7VR44|MSBA_BLOFL Lipid A export ATP-binding/permease protein MsbA OS=Blochmannia floridanus GN=msbA PE=3 SV=1 619 823 3.0E-13
sp|P9WQJ7|IRTB_MYCTU Iron import ATP-binding/permease protein IrtB OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=irtB PE=1 SV=1 607 823 3.0E-13
sp|P9WQJ6|IRTB_MYCTO Iron import ATP-binding/permease protein IrtB OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=irtB PE=3 SV=1 607 823 3.0E-13
sp|P63394|IRTB_MYCBO Iron import ATP-binding/permease protein IrtB OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=irtB PE=3 SV=1 607 823 3.0E-13
sp|B5X0E4|ABCB5_MOUSE ATP-binding cassette sub-family B member 5 OS=Mus musculus GN=Abcb5 PE=2 SV=1 588 834 4.0E-13
sp|P43245|MDR1_RAT Multidrug resistance protein 1 OS=Rattus norvegicus GN=Abcb1 PE=2 SV=1 598 823 4.0E-13
sp|Q48P40|MSBA_PSE14 Lipid A export ATP-binding/permease protein MsbA OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=msbA PE=3 SV=2 622 833 5.0E-13
sp|Q2G2M9|Y2003_STAA8 Putative multidrug export ATP-binding/permease protein SAOUHSC_02003 OS=Staphylococcus aureus (strain NCTC 8325) GN=SAOUHSC_02003 PE=3 SV=1 572 823 5.0E-13
sp|Q6GFJ1|Y1956_STAAR Putative multidrug export ATP-binding/permease protein SAR1956 OS=Staphylococcus aureus (strain MRSA252) GN=SAR1956 PE=3 SV=1 572 823 5.0E-13
sp|Q5HEQ8|Y1924_STAAC Putative multidrug export ATP-binding/permease protein SACOL1924 OS=Staphylococcus aureus (strain COL) GN=SACOL1924 PE=3 SV=1 572 823 5.0E-13
sp|Q99T13|Y1866_STAAM Putative multidrug export ATP-binding/permease protein SAV1866 OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=SAV1866 PE=1 SV=1 572 823 5.0E-13
sp|Q2FFM9|Y1847_STAA3 Putative multidrug export ATP-binding/permease protein SAUSA300_1847 OS=Staphylococcus aureus (strain USA300) GN=SAUSA300_1847 PE=3 SV=1 572 823 5.0E-13
sp|Q7A0J1|Y1806_STAAW Putative multidrug export ATP-binding/permease protein MW1806 OS=Staphylococcus aureus (strain MW2) GN=MW1806 PE=3 SV=1 572 823 5.0E-13
sp|Q6G868|Y1788_STAAS Putative multidrug export ATP-binding/permease protein SAS1788 OS=Staphylococcus aureus (strain MSSA476) GN=SAS1788 PE=3 SV=1 572 823 5.0E-13
sp|Q7A4T3|Y1683_STAAN Putative multidrug export ATP-binding/permease protein SA1683 OS=Staphylococcus aureus (strain N315) GN=SA1683 PE=1 SV=1 572 823 5.0E-13
sp|Q9FWX7|AB11B_ARATH ABC transporter B family member 11 OS=Arabidopsis thaliana GN=ABCB11 PE=2 SV=1 619 823 5.0E-13
sp|Q2M3G0|ABCB5_HUMAN ATP-binding cassette sub-family B member 5 OS=Homo sapiens GN=ABCB5 PE=1 SV=4 588 839 6.0E-13
sp|Q6YUU5|MDR_ORYSJ Putative multidrug resistance protein OS=Oryza sativa subsp. japonica GN=Os02g0190300 PE=3 SV=1 598 823 6.0E-13
sp|P97046|LMRA_LACLM Multidrug resistance ABC transporter ATP-binding and permease protein OS=Lactococcus lactis subsp. cremoris (strain MG1363) GN=lmrA PE=3 SV=3 530 823 7.0E-13
sp|Q983H5|NDVA_RHILO Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Rhizobium loti (strain MAFF303099) GN=ndvA PE=3 SV=1 626 833 7.0E-13
sp|Q83D84|MSBA_COXBU Lipid A export ATP-binding/permease protein MsbA OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) GN=msbA PE=3 SV=1 622 823 7.0E-13
sp|Q28433|TAP1_GORGO Antigen peptide transporter 1 OS=Gorilla gorilla gorilla GN=TAP1 PE=2 SV=2 619 826 8.0E-13
sp|Q00449|MDR49_DROME Multidrug resistance protein homolog 49 OS=Drosophila melanogaster GN=Mdr49 PE=2 SV=2 421 823 8.0E-13
sp|Q87EF0|MSBA_XYLFT Lipid A export ATP-binding/permease protein MsbA OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=msbA PE=3 SV=1 618 837 8.0E-13
sp|P34712|PGP1_CAEEL Multidrug resistance protein pgp-1 OS=Caenorhabditis elegans GN=pgp-1 PE=1 SV=2 619 880 9.0E-13
sp|Q00449|MDR49_DROME Multidrug resistance protein homolog 49 OS=Drosophila melanogaster GN=Mdr49 PE=2 SV=2 590 825 9.0E-13
sp|Q65U21|MSBA_MANSM Lipid A export ATP-binding/permease protein MsbA OS=Mannheimia succiniciproducens (strain MBEL55E) GN=msbA PE=3 SV=2 607 823 9.0E-13
sp|Q8PKS5|MSBA_XANAC Lipid A export ATP-binding/permease protein MsbA OS=Xanthomonas axonopodis pv. citri (strain 306) GN=msbA PE=3 SV=1 620 840 9.0E-13
sp|Q9SYI3|AB5B_ARATH ABC transporter B family member 5 OS=Arabidopsis thaliana GN=ABCB5 PE=3 SV=1 619 842 1.0E-12
sp|P21439|MDR3_HUMAN Phosphatidylcholine translocator ABCB4 OS=Homo sapiens GN=ABCB4 PE=1 SV=2 598 836 1.0E-12
sp|Q54V86|ABCCD_DICDI ABC transporter C family member 13 OS=Dictyostelium discoideum GN=abcC13 PE=3 SV=1 1225 1448 1.0E-12
sp|Q54VJ0|ABCC2_DICDI ABC transporter C family member 2 OS=Dictyostelium discoideum GN=abcC2 PE=3 SV=1 1224 1448 1.0E-12
sp|Q8T6H8|ABCC1_DICDI ABC transporter C family member 1 OS=Dictyostelium discoideum GN=abcC1 PE=3 SV=1 1225 1448 1.0E-12
sp|Q4ZZ16|MSBA_PSEU2 Lipid A export ATP-binding/permease protein MsbA OS=Pseudomonas syringae pv. syringae (strain B728a) GN=msbA PE=3 SV=1 622 833 1.0E-12
sp|P08183|MDR1_HUMAN Multidrug resistance protein 1 OS=Homo sapiens GN=ABCB1 PE=1 SV=3 599 836 1.0E-12
sp|Q0WML0|AB27B_ARATH ABC transporter B family member 27 OS=Arabidopsis thaliana GN=ABCB27 PE=1 SV=1 587 842 1.0E-12
sp|Q87VF3|MSBA_PSESM Lipid A export ATP-binding/permease protein MsbA OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=msbA PE=3 SV=2 622 833 1.0E-12
sp|Q88D92|MSBA_PSEPK Lipid A export ATP-binding/permease protein MsbA OS=Pseudomonas putida (strain KT2440) GN=msbA PE=3 SV=1 596 867 1.0E-12
sp|Q3BTC8|MSBA_XANC5 Lipid A export ATP-binding/permease protein MsbA OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=msbA PE=3 SV=1 620 840 1.0E-12
sp|Q7DM58|AB4C_ARATH ABC transporter C family member 4 OS=Arabidopsis thaliana GN=ABCC4 PE=2 SV=2 1222 1448 2.0E-12
sp|Q8D2U8|MSBA_WIGBR Lipid A export ATP-binding/permease protein MsbA OS=Wigglesworthia glossinidia brevipalpis GN=msbA PE=3 SV=1 618 826 2.0E-12
sp|Q5H0H0|MSBA_XANOR Lipid A export ATP-binding/permease protein MsbA OS=Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85) GN=msbA PE=3 SV=1 620 840 2.0E-12
sp|Q2P3E7|MSBA_XANOM Lipid A export ATP-binding/permease protein MsbA OS=Xanthomonas oryzae pv. oryzae (strain MAFF 311018) GN=msbA PE=3 SV=1 620 840 2.0E-12
sp|Q9QYJ4|ABCB9_RAT ATP-binding cassette sub-family B member 9 OS=Rattus norvegicus GN=Abcb9 PE=1 SV=1 620 866 2.0E-12
sp|Q9DC29|ABCB6_MOUSE ATP-binding cassette sub-family B member 6, mitochondrial OS=Mus musculus GN=Abcb6 PE=1 SV=1 607 823 2.0E-12
sp|Q9LSJ6|AB17B_ARATH ABC transporter B family member 17 OS=Arabidopsis thaliana GN=ABCB17 PE=3 SV=1 619 823 2.0E-12
sp|Q9JJ59|ABCB9_MOUSE ATP-binding cassette sub-family B member 9 OS=Mus musculus GN=Abcb9 PE=2 SV=1 620 866 2.0E-12
sp|Q38UT9|ECFA1_LACSS Energy-coupling factor transporter ATP-binding protein EcfA1 OS=Lactobacillus sakei subsp. sakei (strain 23K) GN=ecfA1 PE=3 SV=1 623 823 2.0E-12
sp|Q9C7F8|AB13B_ARATH ABC transporter B family member 13 OS=Arabidopsis thaliana GN=ABCB13 PE=3 SV=1 617 823 3.0E-12
sp|O31707|YKNU_BACSU Uncharacterized ABC transporter ATP-binding protein YknU OS=Bacillus subtilis (strain 168) GN=yknU PE=3 SV=3 623 842 3.0E-12
sp|Q9M0M2|AB9B_ARATH ABC transporter B family member 9 OS=Arabidopsis thaliana GN=ABCB9 PE=3 SV=2 619 823 3.0E-12
sp|Q9PEE7|MSBA_XYLFA Lipid A export ATP-binding/permease protein MsbA OS=Xylella fastidiosa (strain 9a5c) GN=msbA PE=3 SV=1 618 837 3.0E-12
sp|Q12M46|MSBA_SHEDO Lipid A export ATP-binding/permease protein MsbA OS=Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013) GN=msbA PE=3 SV=1 621 826 4.0E-12
sp|P78966|MAM1_SCHPO Mating factor M secretion protein mam1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mam1 PE=3 SV=1 617 810 4.0E-12
sp|Q8P8W4|MSBA_XANCP Lipid A export ATP-binding/permease protein MsbA OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=msbA PE=3 SV=1 620 823 4.0E-12
sp|Q4UV65|MSBA_XANC8 Lipid A export ATP-binding/permease protein MsbA OS=Xanthomonas campestris pv. campestris (strain 8004) GN=msbA PE=3 SV=1 620 823 4.0E-12
sp|Q56A55|ABCB8_DANRE ATP-binding cassette sub-family B member 8, mitochondrial OS=Danio rerio GN=abcb8 PE=2 SV=1 622 837 4.0E-12
sp|P21440|MDR3_MOUSE Phosphatidylcholine translocator ABCB4 OS=Mus musculus GN=Abcb4 PE=1 SV=2 621 823 4.0E-12
sp|Q9LZJ5|AB14C_ARATH ABC transporter C family member 14 OS=Arabidopsis thaliana GN=ABCC14 PE=1 SV=1 1222 1448 5.0E-12
sp|Q2SIN5|MSBA_HAHCH Lipid A export ATP-binding/permease protein MsbA OS=Hahella chejuensis (strain KCTC 2396) GN=msbA PE=3 SV=1 620 826 5.0E-12
sp|P75094|Y019_MYCPN Putative ABC transporter ATP-binding protein MG015 homolog OS=Mycoplasma pneumoniae (strain ATCC 29342 / M129) GN=MPN_019 PE=3 SV=1 593 829 5.0E-12
sp|P36372|TAP2_RAT Antigen peptide transporter 2 OS=Rattus norvegicus GN=Tap2 PE=2 SV=1 619 826 5.0E-12
sp|Q5A762|MLT1_CANAL Multiple drug resistance-associated protein-like transporter 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=MLT1 PE=1 SV=1 1224 1448 6.0E-12
sp|P36371|TAP2_MOUSE Antigen peptide transporter 2 OS=Mus musculus GN=Tap2 PE=1 SV=1 593 826 6.0E-12
sp|Q71ED1|NDVA_AGRVI Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Agrobacterium vitis GN=ndvA PE=3 SV=1 607 824 6.0E-12
sp|Q08D64|ABCB6_XENTR ATP-binding cassette sub-family B member 6, mitochondrial OS=Xenopus tropicalis GN=abcb6 PE=2 SV=1 597 823 7.0E-12
sp|P0A2V1|NDVA_RHIRD Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Rhizobium radiobacter GN=ndvA PE=1 SV=1 607 833 7.0E-12
sp|P0A2V0|NDVA_AGRFC Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=ndvA PE=3 SV=1 607 833 7.0E-12
sp|Q9C7F2|AB14B_ARATH ABC transporter B family member 14 OS=Arabidopsis thaliana GN=ABCB14 PE=3 SV=1 617 823 7.0E-12
sp|Q8LPK2|AB2B_ARATH ABC transporter B family member 2 OS=Arabidopsis thaliana GN=ABCB2 PE=1 SV=3 594 839 7.0E-12
sp|Q3IGX5|MSBA_PSEHT Lipid A export ATP-binding/permease protein MsbA OS=Pseudoalteromonas haloplanktis (strain TAC 125) GN=msbA PE=3 SV=1 567 824 8.0E-12
sp|Q54EK2|ABCC7_DICDI ABC transporter C family member 7 OS=Dictyostelium discoideum GN=abcC7 PE=3 SV=1 1219 1432 8.0E-12
sp|Q6KHL1|ECFA1_MYCMO Energy-coupling factor transporter ATP-binding protein EcfA1 OS=Mycoplasma mobile (strain ATCC 43663 / 163K / NCTC 11711) GN=ecfA1 PE=3 SV=1 600 826 8.0E-12
sp|Q9LJX0|AB19B_ARATH ABC transporter B family member 19 OS=Arabidopsis thaliana GN=ABCB19 PE=1 SV=1 602 833 9.0E-12
sp|Q08201|MDR3_RAT Phosphatidylcholine translocator ABCB4 OS=Rattus norvegicus GN=Abcb4 PE=1 SV=1 621 823 1.0E-11
sp|Q9JW59|MSBA_NEIMA Lipid A export ATP-binding/permease protein MsbA OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=msbA PE=3 SV=1 599 846 1.0E-11
sp|Q9NP78|ABCB9_HUMAN ATP-binding cassette sub-family B member 9 OS=Homo sapiens GN=ABCB9 PE=1 SV=1 620 838 1.0E-11
sp|Q9Y7M7|MDL1_SCHPO ATP-dependent permease MDL1, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mdl1 PE=3 SV=1 604 825 1.0E-11
sp|Q03518|TAP1_HUMAN Antigen peptide transporter 1 OS=Homo sapiens GN=TAP1 PE=1 SV=2 619 826 1.0E-11
sp|Q5RFQ9|ABCB8_PONAB ATP-binding cassette sub-family B member 8, mitochondrial OS=Pongo abelii GN=ABCB8 PE=2 SV=1 622 837 1.0E-11
sp|Q9LJX0|AB19B_ARATH ABC transporter B family member 19 OS=Arabidopsis thaliana GN=ABCB19 PE=1 SV=1 619 828 2.0E-11
sp|P0DKX5|CYAB_BORPE Cyclolysin secretion/processing ATP-binding protein CyaB OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=cyaB PE=3 SV=1 623 823 2.0E-11
sp|P0DKX6|CYAB_BORP1 Cyclolysin secretion/processing ATP-binding protein CyaB OS=Bordetella pertussis (strain ATCC 9797 / DSM 5571 / NCTC 10739 / 18323) GN=cyaB PE=3 SV=1 623 823 2.0E-11
sp|Q9M1Q9|AB21B_ARATH ABC transporter B family member 21 OS=Arabidopsis thaliana GN=ABCB21 PE=1 SV=2 619 823 2.0E-11
sp|Q8R4P9|MRP7_MOUSE Multidrug resistance-associated protein 7 OS=Mus musculus GN=Abcc10 PE=1 SV=1 1074 1430 2.0E-11
sp|Q5P2S7|MSBA_AROAE Lipid A export ATP-binding/permease protein MsbA OS=Aromatoleum aromaticum (strain EbN1) GN=msbA PE=3 SV=1 607 823 2.0E-11
sp|Q8T9W4|ABCB3_DICDI ABC transporter B family member 3 OS=Dictyostelium discoideum GN=abcB3 PE=3 SV=1 598 823 2.0E-11
sp|P12866|STE6_YEAST Alpha-factor-transporting ATPase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=STE6 PE=1 SV=1 622 823 2.0E-11
sp|Q9NUT2|ABCB8_HUMAN ATP-binding cassette sub-family B member 8, mitochondrial OS=Homo sapiens GN=ABCB8 PE=1 SV=3 622 869 3.0E-11
sp|P23174|MDR3_CRIGR Phosphatidylcholine translocator ABCB4 OS=Cricetulus griseus GN=ABCB4 PE=2 SV=1 619 823 3.0E-11
sp|Q9FNU2|AB25B_ORYSJ ABC transporter B family member 25 OS=Oryza sativa subsp. japonica GN=OsABCB25 PE=2 SV=1 631 851 3.0E-11
sp|Q98QH5|ECFA1_MYCPU Energy-coupling factor transporter ATP-binding protein EcfA1 OS=Mycoplasma pulmonis (strain UAB CTIP) GN=ecfA1 PE=3 SV=1 623 831 3.0E-11
sp|O80725|AB4B_ARATH ABC transporter B family member 4 OS=Arabidopsis thaliana GN=ABCB4 PE=1 SV=1 619 823 4.0E-11
sp|P54683|TAGB_DICDI Serine protease/ABC transporter B family protein tagB OS=Dictyostelium discoideum GN=tagB PE=3 SV=2 584 823 4.0E-11
sp|Q9JXR3|MSBA_NEIMB Lipid A export ATP-binding/permease protein MsbA OS=Neisseria meningitidis serogroup B (strain MC58) GN=msbA PE=3 SV=1 599 846 4.0E-11
sp|Q9SGY1|AB10B_ARATH ABC transporter B family member 10 OS=Arabidopsis thaliana GN=ABCB10 PE=1 SV=2 597 839 4.0E-11
sp|B5X0E4|ABCB5_MOUSE ATP-binding cassette sub-family B member 5 OS=Mus musculus GN=Abcb5 PE=2 SV=1 599 837 5.0E-11
sp|Q8EDF0|MSBA_SHEON Lipid A export ATP-binding/permease protein MsbA OS=Shewanella oneidensis (strain MR-1) GN=msbA PE=3 SV=1 623 823 5.0E-11
sp|Q9LVM1|AB25B_ARATH ABC transporter B family member 25, mitochondrial OS=Arabidopsis thaliana GN=ABCB25 PE=1 SV=1 598 823 5.0E-11
sp|Q7GB25|AB5C_ARATH ABC transporter C family member 5 OS=Arabidopsis thaliana GN=ABCC5 PE=2 SV=2 1228 1448 6.0E-11
sp|Q9WYC4|Y288_THEMA Uncharacterized ABC transporter ATP-binding protein TM_0288 OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=TM_0288 PE=1 SV=1 593 833 6.0E-11
sp|Q9FHF1|AB7B_ARATH ABC transporter B family member 7 OS=Arabidopsis thaliana GN=ABCB7 PE=3 SV=1 619 827 7.0E-11
sp|P18767|NDVA_RHIME Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Rhizobium meliloti (strain 1021) GN=ndvA PE=1 SV=2 600 827 7.0E-11
sp|Q8G0T8|NDVA_BRUSU Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Brucella suis biovar 1 (strain 1330) GN=ndvA PE=3 SV=1 594 825 7.0E-11
sp|O70595|ABCB6_RAT ATP-binding cassette sub-family B member 6, mitochondrial OS=Rattus norvegicus GN=Abcb6 PE=2 SV=1 607 823 7.0E-11
sp|Q74K65|POTA_LACJO Spermidine/putrescine import ATP-binding protein PotA OS=Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533) GN=potA PE=3 SV=1 623 826 8.0E-11
sp|Q1GZI0|MSBA_METFK Lipid A export ATP-binding/permease protein MsbA OS=Methylobacillus flagellatus (strain KT / ATCC 51484 / DSM 6875) GN=msbA PE=3 SV=1 621 823 9.0E-11
sp|Q9M0M2|AB9B_ARATH ABC transporter B family member 9 OS=Arabidopsis thaliana GN=ABCB9 PE=3 SV=2 630 859 1.0E-10
sp|Q0HTS8|MSBA_SHESR Lipid A export ATP-binding/permease protein MsbA OS=Shewanella sp. (strain MR-7) GN=msbA PE=3 SV=1 623 823 1.0E-10
sp|Q0HHH4|MSBA_SHESM Lipid A export ATP-binding/permease protein MsbA OS=Shewanella sp. (strain MR-4) GN=msbA PE=3 SV=1 623 823 1.0E-10
sp|Q06034|MDR1_LEIEN Multidrug resistance protein 1 OS=Leishmania enriettii GN=MDR1 PE=3 SV=1 603 823 1.0E-10
sp|P63398|Y1303_MYCBO Uncharacterized ABC transporter ATP-binding protein Mb1303c OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=Mb1303c PE=3 SV=1 613 823 1.0E-10
sp|P9WQJ3|Y1272_MYCTU Uncharacterized ABC transporter ATP-binding protein Rv1272c OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv1272c PE=1 SV=1 613 823 1.0E-10
sp|P9WQJ2|Y1272_MYCTO Uncharacterized ABC transporter ATP-binding protein MT1310 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT1310 PE=3 SV=1 613 823 1.0E-10
sp|P23886|CYDC_ECOLI ATP-binding/permease protein CydC OS=Escherichia coli (strain K12) GN=cydC PE=3 SV=2 603 823 1.0E-10
sp|Q15UY7|MSBA_PSEA6 Lipid A export ATP-binding/permease protein MsbA OS=Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087) GN=msbA PE=3 SV=1 567 826 1.0E-10
sp|P29018|CYDD_ECOLI ATP-binding/permease protein CydD OS=Escherichia coli (strain K12) GN=cydD PE=1 SV=3 626 824 1.0E-10
sp|Q4QPI4|MSBA_HAEI8 Lipid A export ATP-binding/permease protein MsbA OS=Haemophilus influenzae (strain 86-028NP) GN=msbA PE=3 SV=1 597 833 1.0E-10
sp|P78966|MAM1_SCHPO Mating factor M secretion protein mam1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mam1 PE=3 SV=1 603 823 2.0E-10
sp|O80725|AB4B_ARATH ABC transporter B family member 4 OS=Arabidopsis thaliana GN=ABCB4 PE=1 SV=1 619 848 2.0E-10
sp|Q0I4C5|MSBA_HAES1 Lipid A export ATP-binding/permease protein MsbA OS=Haemophilus somnus (strain 129Pt) GN=msbA PE=3 SV=1 618 823 2.0E-10
sp|P21439|MDR3_HUMAN Phosphatidylcholine translocator ABCB4 OS=Homo sapiens GN=ABCB4 PE=1 SV=2 588 875 2.0E-10
sp|Q5F4X8|MSBA_NEIG1 Lipid A export ATP-binding/permease protein MsbA OS=Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) GN=msbA PE=3 SV=1 599 829 2.0E-10
sp|P45081|CYDC_HAEIN ATP-binding/permease protein CydC OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=cydC PE=3 SV=1 587 836 2.0E-10
sp|P0C529|NDVA_BRUAB Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Brucella abortus biovar 1 (strain 9-941) GN=ndvA PE=3 SV=1 594 825 2.0E-10
sp|Q2YQ73|NDVA_BRUA2 Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Brucella abortus (strain 2308) GN=ndvA PE=1 SV=1 594 825 2.0E-10
sp|Q9FHF1|AB7B_ARATH ABC transporter B family member 7 OS=Arabidopsis thaliana GN=ABCB7 PE=3 SV=1 607 866 3.0E-10
sp|Q2M3G0|ABCB5_HUMAN ATP-binding cassette sub-family B member 5 OS=Homo sapiens GN=ABCB5 PE=1 SV=4 598 823 4.0E-10
sp|Q9FWX7|AB11B_ARATH ABC transporter B family member 11 OS=Arabidopsis thaliana GN=ABCB11 PE=2 SV=1 607 844 4.0E-10
sp|Q839D5|ECFA1_ENTFA Energy-coupling factor transporter ATP-binding protein EcfA1 OS=Enterococcus faecalis (strain ATCC 700802 / V583) GN=ecfA1 PE=3 SV=1 607 819 5.0E-10
sp|Q5T3U5|MRP7_HUMAN Multidrug resistance-associated protein 7 OS=Homo sapiens GN=ABCC10 PE=1 SV=1 1233 1430 5.0E-10
sp|Q6F9X0|MSBA_ACIAD Lipid A export ATP-binding/permease protein MsbA OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=msbA PE=3 SV=1 623 823 5.0E-10
sp|Q8YH20|NDVA_BRUME Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=ndvA PE=3 SV=1 594 825 5.0E-10
sp|Q8K984|MDLB_BUCAP Multidrug resistance-like ATP-binding protein MdlB OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=mdlB PE=3 SV=1 631 829 6.0E-10
sp|P9WQJ9|IRTA_MYCTU Iron import ATP-binding/permease protein IrtA OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=irtA PE=1 SV=1 614 823 6.0E-10
sp|P9WQJ8|IRTA_MYCTO Iron import ATP-binding/permease protein IrtA OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=irtA PE=3 SV=1 614 823 6.0E-10
sp|P63392|IRTA_MYCBO Iron import ATP-binding/permease protein IrtA OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=irtA PE=3 SV=1 614 823 6.0E-10
sp|Q9SYI2|AB3B_ARATH ABC transporter B family member 3 OS=Arabidopsis thaliana GN=ABCB3 PE=3 SV=1 619 823 9.0E-10
sp|Q9M1C7|AB9C_ARATH ABC transporter C family member 9 OS=Arabidopsis thaliana GN=ABCC9 PE=2 SV=2 1174 1448 1.0E-09
sp|Q8RY46|AB26B_ARATH ABC transporter B family member 26, chloroplastic OS=Arabidopsis thaliana GN=ABCB26 PE=2 SV=1 617 840 1.0E-09
sp|Q54P13|ABCC8_DICDI ABC transporter C family member 8 OS=Dictyostelium discoideum GN=abcC8 PE=3 SV=1 621 850 1.0E-09
sp|Q9GTN7|TAGA_DICDI Serine protease/ABC transporter B family protein tagA OS=Dictyostelium discoideum GN=tagA PE=1 SV=2 619 823 1.0E-09
sp|P44407|MSBA_HAEIN Lipid A export ATP-binding/permease protein MsbA OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=msbA PE=3 SV=1 618 833 1.0E-09
sp|Q7VL52|MSBA_HAEDU Lipid A export ATP-binding/permease protein MsbA OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=msbA PE=3 SV=1 618 823 2.0E-09
sp|Q9SYI3|AB5B_ARATH ABC transporter B family member 5 OS=Arabidopsis thaliana GN=ABCB5 PE=3 SV=1 630 839 2.0E-09
sp|O95342|ABCBB_HUMAN Bile salt export pump OS=Homo sapiens GN=ABCB11 PE=1 SV=2 619 831 2.0E-09
sp|Q2KYS6|MSBA_BORA1 Lipid A export ATP-binding/permease protein MsbA OS=Bordetella avium (strain 197N) GN=msbA PE=3 SV=1 619 823 2.0E-09
sp|Q89UT8|NDVA_BRADU Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=ndvA PE=3 SV=1 597 834 2.0E-09
sp|P06795|MDR1B_MOUSE Multidrug resistance protein 1B OS=Mus musculus GN=Abcb1b PE=1 SV=1 598 875 2.0E-09
sp|P43245|MDR1_RAT Multidrug resistance protein 1 OS=Rattus norvegicus GN=Abcb1 PE=2 SV=1 598 875 2.0E-09
sp|P70864|NDVA_BARBA Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Bartonella bacilliformis GN=ndvA PE=3 SV=2 560 858 2.0E-09
sp|Q9VL32|SUR_DROME ATP-binding cassette sub-family C member Sur OS=Drosophila melanogaster GN=Sur PE=1 SV=4 1233 1425 2.0E-09
sp|P21440|MDR3_MOUSE Phosphatidylcholine translocator ABCB4 OS=Mus musculus GN=Abcb4 PE=1 SV=2 588 826 2.0E-09
sp|P35598|EXP8_STRPN Putative ABC transporter ATP-binding protein exp8 OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=exp8 PE=3 SV=3 614 823 3.0E-09
sp|Q4A5A5|ECFA1_MYCS5 Energy-coupling factor transporter ATP-binding protein EcfA1 OS=Mycoplasma synoviae (strain 53) GN=ecfA1 PE=3 SV=1 619 831 3.0E-09
sp|Q54BT3|ABCB2_DICDI ABC transporter B family member 2 OS=Dictyostelium discoideum GN=abcB2 PE=3 SV=1 607 823 3.0E-09
sp|Q8T9W1|TAGD_DICDI Serine protease/ABC transporter B family protein tagD OS=Dictyostelium discoideum GN=tagD PE=3 SV=1 619 837 4.0E-09
sp|P23174|MDR3_CRIGR Phosphatidylcholine translocator ABCB4 OS=Cricetulus griseus GN=ABCB4 PE=2 SV=1 588 831 4.0E-09
sp|Q54VC1|ABCCF_DICDI ABC transporter C family member 15 OS=Dictyostelium discoideum GN=abcC15 PE=3 SV=1 457 805 5.0E-09
sp|A1USS5|NDVA_BARBK Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Bartonella bacilliformis (strain ATCC 35685 / KC583) GN=ndvA PE=3 SV=1 560 833 5.0E-09
sp|Q08201|MDR3_RAT Phosphatidylcholine translocator ABCB4 OS=Rattus norvegicus GN=Abcb4 PE=1 SV=1 588 831 6.0E-09
sp|Q9M1Q9|AB21B_ARATH ABC transporter B family member 21 OS=Arabidopsis thaliana GN=ABCB21 PE=1 SV=2 619 859 7.0E-09
sp|P36619|PMD1_SCHPO Leptomycin B resistance protein pmd1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pmd1 PE=3 SV=2 622 868 1.0E-08
sp|Q54BT3|ABCB2_DICDI ABC transporter B family member 2 OS=Dictyostelium discoideum GN=abcB2 PE=3 SV=1 602 823 1.0E-08
sp|Q9VL32|SUR_DROME ATP-binding cassette sub-family C member Sur OS=Drosophila melanogaster GN=Sur PE=1 SV=4 359 566 1.0E-08
sp|Q8VNL9|ECFA_ENTFC Energy-coupling factor transporter ATP-binding protein EcfA OS=Enterococcus faecium GN=ecfA PE=3 SV=1 621 819 2.0E-08
sp|Q00748|MDR65_DROME Multidrug resistance protein homolog 65 OS=Drosophila melanogaster GN=Mdr65 PE=1 SV=2 394 831 2.0E-08
sp|Q8LPQ6|AB28B_ARATH ABC transporter B family member 28 OS=Arabidopsis thaliana GN=ABCB28 PE=2 SV=1 619 829 2.0E-08
sp|P08183|MDR1_HUMAN Multidrug resistance protein 1 OS=Homo sapiens GN=ABCB1 PE=1 SV=3 588 827 2.0E-08
sp|Q8LPT1|AB6B_ARATH ABC transporter B family member 6 OS=Arabidopsis thaliana GN=ABCB6 PE=1 SV=2 600 873 2.0E-08
sp|P26362|CFTR_SQUAC Cystic fibrosis transmembrane conductance regulator OS=Squalus acanthias GN=CFTR PE=1 SV=1 1228 1436 2.0E-08
sp|Q2J0F4|NDVA_RHOP2 Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Rhodopseudomonas palustris (strain HaA2) GN=ndvA PE=3 SV=1 597 834 2.0E-08
sp|P26362|CFTR_SQUAC Cystic fibrosis transmembrane conductance regulator OS=Squalus acanthias GN=CFTR PE=1 SV=1 678 872 3.0E-08
sp|Q8DRR9|ECFA1_STRMU Energy-coupling factor transporter ATP-binding protein EcfA1 OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=ecfA1 PE=3 SV=1 618 819 4.0E-08
sp|Q00748|MDR65_DROME Multidrug resistance protein homolog 65 OS=Drosophila melanogaster GN=Mdr65 PE=1 SV=2 622 823 4.0E-08
sp|Q3SP57|NDVA_NITWN Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Nitrobacter winogradskyi (strain Nb-255 / ATCC 25391) GN=ndvA PE=3 SV=2 597 834 4.0E-08
sp|Q9N0V3|ABCBB_RABIT Bile salt export pump OS=Oryctolagus cuniculus GN=ABCB11 PE=2 SV=1 542 831 4.0E-08
sp|Q06034|MDR1_LEIEN Multidrug resistance protein 1 OS=Leishmania enriettii GN=MDR1 PE=3 SV=1 605 823 4.0E-08
sp|Q9M3B9|AB20B_ARATH ABC transporter B family member 20 OS=Arabidopsis thaliana GN=ABCB20 PE=1 SV=1 602 823 4.0E-08
sp|P21448|MDR1_CRIGR Multidrug resistance protein 1 OS=Cricetulus griseus GN=ABCB1 PE=1 SV=2 598 845 6.0E-08
sp|P21449|MDR2_CRIGR Multidrug resistance protein 2 OS=Cricetulus griseus GN=PGY2 PE=2 SV=2 588 865 7.0E-08
sp|Q1GBJ0|ECFA1_LACDA Energy-coupling factor transporter ATP-binding protein EcfA1 OS=Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC 11842 / DSM 20081 / JCM 1002 / NBRC 13953 / NCIMB 11778) GN=ecfA1 PE=3 SV=1 621 835 7.0E-08
sp|P94366|CYDC_BACSU ATP-binding/permease protein CydC OS=Bacillus subtilis (strain 168) GN=cydC PE=3 SV=1 643 827 7.0E-08
sp|Q9FWX8|AB12B_ARATH ABC transporter B family member 12 OS=Arabidopsis thaliana GN=ABCB12 PE=2 SV=2 607 844 9.0E-08
sp|A3CMQ7|POTA_STRSV Spermidine/putrescine import ATP-binding protein PotA OS=Streptococcus sanguinis (strain SK36) GN=potA PE=3 SV=1 619 826 1.0E-07
sp|Q20Z38|NDVA_RHOPB Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Rhodopseudomonas palustris (strain BisB18) GN=ndvA PE=3 SV=1 597 857 1.0E-07
sp|Q54VC1|ABCCF_DICDI ABC transporter C family member 15 OS=Dictyostelium discoideum GN=abcC15 PE=3 SV=1 1229 1430 1.0E-07
sp|Q9QY30|ABCBB_MOUSE Bile salt export pump OS=Mus musculus GN=Abcb11 PE=1 SV=2 619 831 1.0E-07
sp|P21447|MDR1A_MOUSE Multidrug resistance protein 1A OS=Mus musculus GN=Abcb1a PE=1 SV=3 588 827 1.0E-07
sp|Q54W24|ABCB4_DICDI ABC transporter B family member 4 OS=Dictyostelium discoideum GN=abcB4 PE=3 SV=1 622 823 2.0E-07
sp|P34158|CFTR_RAT Cystic fibrosis transmembrane conductance regulator OS=Rattus norvegicus GN=Cftr PE=1 SV=3 572 853 2.0E-07
sp|Q04BY7|ECFA1_LACDB Energy-coupling factor transporter ATP-binding protein EcfA1 OS=Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC BAA-365) GN=ecfA1 PE=3 SV=1 621 835 2.0E-07
sp|Q65VG9|METN_MANSM Methionine import ATP-binding protein MetN OS=Mannheimia succiniciproducens (strain MBEL55E) GN=metN PE=3 SV=1 623 823 2.0E-07
sp|Q13BH6|NDVA_RHOPS Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Rhodopseudomonas palustris (strain BisB5) GN=ndvA PE=3 SV=1 597 834 3.0E-07
sp|P35071|CFTR_BOVIN Cystic fibrosis transmembrane conductance regulator OS=Bos taurus GN=CFTR PE=2 SV=2 1228 1436 3.0E-07
sp|Q57538|Y664_HAEIN Probable ABC transporter ATP-binding protein HI_0664 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=HI_0664 PE=1 SV=1 603 808 4.0E-07
sp|Q5A762|MLT1_CANAL Multiple drug resistance-associated protein-like transporter 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=MLT1 PE=1 SV=1 621 832 5.0E-07
sp|P26363|CFTR_XENLA Cystic fibrosis transmembrane conductance regulator OS=Xenopus laevis GN=cftr PE=2 SV=1 1228 1436 5.0E-07
sp|Q1QH37|NDVA_NITHX Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Nitrobacter hamburgensis (strain X14 / DSM 10229) GN=ndvA PE=3 SV=1 597 847 6.0E-07
sp|Q6G2Z5|NDVA_BARHE Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Bartonella henselae (strain ATCC 49882 / DSM 28221 / Houston 1) GN=ndvA PE=3 SV=1 560 823 7.0E-07
sp|Q9M3B9|AB20B_ARATH ABC transporter B family member 20 OS=Arabidopsis thaliana GN=ABCB20 PE=1 SV=1 598 848 7.0E-07
sp|Q09YJ4|CFTR_MUNMU Cystic fibrosis transmembrane conductance regulator OS=Muntiacus muntjak GN=CFTR PE=3 SV=1 1228 1436 7.0E-07
sp|Q07DW5|CFTR_MUNRE Cystic fibrosis transmembrane conductance regulator OS=Muntiacus reevesi GN=CFTR PE=3 SV=1 1228 1436 7.0E-07
sp|Q07QX6|NDVA_RHOP5 Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Rhodopseudomonas palustris (strain BisA53) GN=ndvA PE=3 SV=1 614 852 8.0E-07
sp|Q00555|CFTR_SHEEP Cystic fibrosis transmembrane conductance regulator OS=Ovis aries GN=CFTR PE=1 SV=2 1228 1436 9.0E-07
sp|Q2K8C8|FBPC_RHIEC Fe(3+) ions import ATP-binding protein FbpC OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=fbpC PE=3 SV=1 625 823 9.0E-07
sp|Q09427|ABCC8_CRICR ATP-binding cassette sub-family C member 8 OS=Cricetus cricetus GN=ABCC8 PE=1 SV=3 508 833 1.0E-06
sp|Q28689|MRP2_RABIT Canalicular multispecific organic anion transporter 1 OS=Oryctolagus cuniculus GN=ABCC2 PE=2 SV=1 622 823 1.0E-06
sp|Q09429|ABCC8_RAT ATP-binding cassette sub-family C member 8 OS=Rattus norvegicus GN=Abcc8 PE=1 SV=4 508 833 1.0E-06
sp|Q07DZ6|CFTR_ORNAN Cystic fibrosis transmembrane conductance regulator OS=Ornithorhynchus anatinus GN=CFTR PE=3 SV=1 1228 1429 1.0E-06
sp|Q07DY5|CFTR_COLGU Cystic fibrosis transmembrane conductance regulator OS=Colobus guereza GN=CFTR PE=3 SV=1 604 862 1.0E-06
sp|Q2QLB4|CFTR_CALMO Cystic fibrosis transmembrane conductance regulator OS=Callicebus moloch GN=CFTR PE=3 SV=1 1169 1429 1.0E-06
sp|Q6PQZ2|CFTR_PIG Cystic fibrosis transmembrane conductance regulator OS=Sus scrofa GN=CFTR PE=2 SV=1 1228 1436 1.0E-06
sp|Q7VM95|METN_HAEDU Methionine import ATP-binding protein MetN OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=metN PE=3 SV=1 623 823 1.0E-06
sp|Q8NSN2|METN_CORGL Methionine import ATP-binding protein MetN OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=metN PE=3 SV=1 623 819 1.0E-06
sp|Q9SYI2|AB3B_ARATH ABC transporter B family member 3 OS=Arabidopsis thaliana GN=ABCB3 PE=3 SV=1 630 828 2.0E-06
sp|Q8LPT1|AB6B_ARATH ABC transporter B family member 6 OS=Arabidopsis thaliana GN=ABCB6 PE=1 SV=2 622 825 2.0E-06
sp|Q07E16|CFTR_MUSPF Cystic fibrosis transmembrane conductance regulator OS=Mustela putorius furo GN=CFTR PE=3 SV=1 1228 1429 2.0E-06
sp|Q0I5E9|METN_HAES1 Methionine import ATP-binding protein MetN OS=Haemophilus somnus (strain 129Pt) GN=metN PE=3 SV=1 623 823 2.0E-06
sp|O31339|CYSA_BACC1 Sulfate/thiosulfate import ATP-binding protein CysA OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=cysA PE=3 SV=2 623 808 2.0E-06
sp|A7KVC2|AB4C_MAIZE ABC transporter C family MRP4 OS=Zea mays GN=MRP4 PE=2 SV=1 1228 1448 3.0E-06
sp|Q5U820|CFTR_CANLF Cystic fibrosis transmembrane conductance regulator OS=Canis lupus familiaris GN=CFTR PE=2 SV=2 1228 1436 3.0E-06
sp|Q07DY5|CFTR_COLGU Cystic fibrosis transmembrane conductance regulator OS=Colobus guereza GN=CFTR PE=3 SV=1 1228 1429 3.0E-06
sp|Q7W9N7|MSBA_BORPA Lipid A export ATP-binding/permease protein MsbA OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=msbA PE=3 SV=1 638 823 3.0E-06
sp|Q7WH20|MSBA_BORBR Lipid A export ATP-binding/permease protein MsbA OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=msbA PE=3 SV=2 638 823 3.0E-06
sp|Q7VWD8|MSBA_BORPE Lipid A export ATP-binding/permease protein MsbA OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=msbA PE=3 SV=1 638 823 3.0E-06
sp|Q09YK5|CFTR_ATEGE Cystic fibrosis transmembrane conductance regulator OS=Ateles geoffroyi GN=CFTR PE=3 SV=1 1228 1429 4.0E-06
sp|O07549|YHEH_BACSU Probable multidrug resistance ABC transporter ATP-binding/permease protein YheH OS=Bacillus subtilis (strain 168) GN=yheH PE=1 SV=1 519 839 5.0E-06
sp|Q2QL83|CFTR_MICMU Cystic fibrosis transmembrane conductance regulator OS=Microcebus murinus GN=CFTR PE=3 SV=1 1228 1429 5.0E-06
sp|Q2IBB3|CFTR_RHIFE Cystic fibrosis transmembrane conductance regulator OS=Rhinolophus ferrumequinum GN=CFTR PE=3 SV=1 1169 1430 5.0E-06
sp|Q07DX5|CFTR_NOMLE Cystic fibrosis transmembrane conductance regulator OS=Nomascus leucogenys GN=CFTR PE=3 SV=1 1228 1429 5.0E-06
sp|Q88XV1|ECFA2_LACPL Energy-coupling factor transporter ATP-binding protein EcfA2 OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=ecfA2 PE=3 SV=1 606 832 5.0E-06
sp|P13569|CFTR_HUMAN Cystic fibrosis transmembrane conductance regulator OS=Homo sapiens GN=CFTR PE=1 SV=3 1228 1436 6.0E-06
sp|Q00PJ2|CFTR_ATEAB Cystic fibrosis transmembrane conductance regulator OS=Atelerix albiventris GN=CFTR PE=3 SV=1 1228 1429 6.0E-06
sp|Q07DV2|CFTR_AOTNA Cystic fibrosis transmembrane conductance regulator OS=Aotus nancymaae GN=CFTR PE=3 SV=1 1228 1429 6.0E-06
sp|Q00554|CFTR_RABIT Cystic fibrosis transmembrane conductance regulator OS=Oryctolagus cuniculus GN=CFTR PE=2 SV=4 1228 1436 6.0E-06
sp|Q09YH0|CFTR_SAIBB Cystic fibrosis transmembrane conductance regulator OS=Saimiri boliviensis boliviensis GN=CFTR PE=3 SV=1 1228 1429 6.0E-06
sp|Q5D1Z7|CFTR_TRIVU Cystic fibrosis transmembrane conductance regulator OS=Trichosurus vulpecula GN=CFTR PE=2 SV=1 1228 1436 7.0E-06
sp|Q2QLE5|CFTR_PANTR Cystic fibrosis transmembrane conductance regulator OS=Pan troglodytes GN=CFTR PE=3 SV=1 1228 1429 7.0E-06
sp|Q2QLF9|CFTR_CALJA Cystic fibrosis transmembrane conductance regulator OS=Callithrix jacchus GN=CFTR PE=3 SV=1 1228 1429 7.0E-06
sp|Q108U0|CFTR_LOXAF Cystic fibrosis transmembrane conductance regulator OS=Loxodonta africana GN=CFTR PE=3 SV=1 1228 1429 7.0E-06
sp|Q2QLH0|CFTR_OTOGA Cystic fibrosis transmembrane conductance regulator OS=Otolemur garnettii GN=CFTR PE=3 SV=1 1228 1429 7.0E-06
sp|P34158|CFTR_RAT Cystic fibrosis transmembrane conductance regulator OS=Rattus norvegicus GN=Cftr PE=1 SV=3 1227 1431 7.0E-06
sp|Q6FAN3|METN1_ACIAD Methionine import ATP-binding protein MetN 1 OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=metN1 PE=3 SV=1 623 818 7.0E-06
sp|Q1LQF6|METN_CUPMC Methionine import ATP-binding protein MetN OS=Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34) GN=metN PE=3 SV=1 615 818 7.0E-06
sp|Q2IBE4|CFTR_PONAB Cystic fibrosis transmembrane conductance regulator OS=Pongo abelii GN=CFTR PE=3 SV=1 1228 1429 8.0E-06
sp|Q2IBA1|CFTR_CHLAE Cystic fibrosis transmembrane conductance regulator OS=Chlorocebus aethiops GN=CFTR PE=3 SV=1 1228 1429 8.0E-06
sp|Q2IBF6|CFTR_GORGO Cystic fibrosis transmembrane conductance regulator OS=Gorilla gorilla gorilla GN=CFTR PE=3 SV=1 1228 1429 8.0E-06
sp|Q8T9W4|ABCB3_DICDI ABC transporter B family member 3 OS=Dictyostelium discoideum GN=abcB3 PE=3 SV=1 604 823 8.0E-06
sp|P26361|CFTR_MOUSE Cystic fibrosis transmembrane conductance regulator OS=Mus musculus GN=Cftr PE=1 SV=2 559 853 8.0E-06
sp|Q6FZF2|NDVA_BARQU Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Bartonella quintana (strain Toulouse) GN=ndvA PE=3 SV=1 625 823 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016887 ATPase activity Yes
GO:0016021 integral component of membrane Yes
GO:0042626 ATPase activity, coupled to transmembrane movement of substances Yes
GO:0055085 transmembrane transport Yes
GO:0005524 ATP binding Yes
GO:0022857 transmembrane transporter activity No
GO:0015405 P-P-bond-hydrolysis-driven transmembrane transporter activity No
GO:0006810 transport No
GO:0005488 binding No
GO:1901265 nucleoside phosphate binding No
GO:0005215 transporter activity No
GO:0008150 biological_process No
GO:0036094 small molecule binding No
GO:0008144 drug binding No
GO:0003674 molecular_function No
GO:0016462 pyrophosphatase activity No
GO:0005575 cellular_component No
GO:0017076 purine nucleotide binding No
GO:1901363 heterocyclic compound binding No
GO:0000166 nucleotide binding No
GO:0043167 ion binding No
GO:0015399 primary active transmembrane transporter activity No
GO:0043168 anion binding No
GO:0051234 establishment of localization No
GO:0097367 carbohydrate derivative binding No
GO:0003824 catalytic activity No
GO:0016818 hydrolase activity, acting on acid anhydrides, in phosphorus-containing anhydrides No
GO:0016787 hydrolase activity No
GO:0022804 active transmembrane transporter activity No
GO:0032555 purine ribonucleotide binding No
GO:0017111 nucleoside-triphosphatase activity No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0032553 ribonucleotide binding No
GO:0016817 hydrolase activity, acting on acid anhydrides No
GO:0030554 adenyl nucleotide binding No
GO:0051179 localization No
GO:0044425 membrane part No
GO:0031224 intrinsic component of membrane No
GO:0042623 ATPase activity, coupled No
GO:0032559 adenyl ribonucleotide binding No
GO:0097159 organic cyclic compound binding No
GO:0043492 ATPase activity, coupled to movement of substances No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 64 0.5

Transmembrane Domains

Domain # Start End Length
1 33 55 22
2 68 90 22
3 100 122 22
4 129 151 22
5 310 332 22
6 489 511 22
7 535 557 22
8 892 914 22
9 929 951 22
10 967 989 22
11 1023 1045 22
12 1118 1140 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|9016
MDNTSRCDDDDFGPFIHGCRGDFDFTLLFEQSFFSITPSSLFLLLSTLRLGLLLSRGRRQVSGTWFQLGKLAAIA
CYGAVQSALLALWARTGVYETRTSLAAAVLSFADVFALGLLSWFEHAYSPRPSALINIYLLLSIVFDAVQARTLW
LKHAGDALPALFTASLAIKAALLALESIDKDSFLPPAWRARSPEERSGVFSRGLLLWLHRILFQGRKHTLHPQDL
YTLVPGLETRRLSSAFWEAWSSQAAEPSSKNIGRALLHTLKWSLLAPVIPRLAQCAFTICQPLLLGEFLRYLQGE
DNFVSGTGYGFIGAYGLLYCGLAISTCLSWRLTYKCLIKMRGCLVAAIYKKTTDIDAASCDMTAPVALMSTDMER
IIHGCKDFHEIWGNTLQVAVSVWLLYNNMGIACVAPSVVTILSSAGSFVISSYADKAQERWMEATQARVAATVKA
ITSMKFMRLLGLSDNIHAMLSDLRRAELRAAKVYRYIEVLTANLSFAPLLLSPVFTFMVFVIQAQSTGNRLDITT
AFTSLSLLQLMTNPLVWLFQSIPLFVASLGCLRRIELYLNSQPRTEMRTLRADESGWTSPSASMSSAQEMVEKPN
GVDGNAIAIRDGQFGWTRDSPVLREVNVDIPASKLTMIVGPVASGKSTFSKAIIGEIPYCTGQVHLNLSSAQIAY
CDQNAFVINGTVRDNIVGFSDFDSIRYDAVVRAVDLAKDVAAMADGHQTRVGSKGVILSGGQRQRVAIARAVYAR
TALAVFDDVLSGLDAVTKRHVFEHVFSPRGLLREQGCTVMLSTHDVDLLPEADHIIALGRDGCVADSGSYAHLSQ
ESEYIKSLAVREVQAANHDGAHQANSAPARLSMEGEEPPAEAPEDMKRRLGDASIYRYLFHHIGLRRVLLFCFYE
CGWAVFSTIGPVWLKFWAAASMAGEDRDGYYMGVFVAFQGLALVFLALIASHTLVTVAVRAGKSLHGVLLRTVMA
APMSFFGTVDAGITTNRFSQDLILIDGDLPISILETVSAGLVALVQAILIAIAAPYVAIAYPFLVLLLYAIQSFY
LRTSRQLRFLELEAKSPLYTHFLETLQGLATIRSFGWSDENNELNHQLVDASQKPLYLLYMVQRWLQLVLELLIA
VTAVILIAVAVQLHSTSAGFIGVALVNLMSISQELKMIVIEWTNLETSLSALARTKSFEEETPPEGKEDGRSEPP
SAWPQTGHVQLSSISASYGVSEQASLALRDVSMTIPNGRKVAICGRSGSGKSTLVMALARMIDLTSGSITVDGVD
LSSLPRSTVRSALNVIPQEPHFFHKTTSQNLDPSGSASAEAMRSALEKVQLWEVVDLAGGLDAELDVETLSQGQR
QLLALARALLRQGKIVVLDEATSNVDKHVEEVMQQIIREEFQGRTIIAVAHQLRTIIDFDEVMVMDAGQLVESGT
PRELMARDSTFKRLCDMQGVSID*
Coding >Hirsu2|9016
ATGGACAATACGAGTCGCTGCGACGATGACGACTTTGGCCCGTTCATCCACGGCTGTCGAGGGGACTTCGACTTC
ACTCTTCTGTTCGAACAGAGCTTCTTCTCCATCACGCCCTCCTCCCTCTTCCTCCTCCTGTCGACCCTGCGCCTA
GGCCTCCTTCTCTCTCGCGGCAGGAGGCAGGTCTCCGGCACCTGGTTCCAGCTCGGCAAGCTGGCCGCCATCGCC
TGTTACGGCGCCGTCCAGTCAGCCCTCTTGGCCCTCTGGGCCCGAACCGGCGTCTACGAGACGCGCACCAGCCTG
GCCGCCGCCGTCCTCTCCTTTGCCGACGTCTTCGCCCTCGGCCTCCTTTCCTGGTTCGAGCATGCCTACTCGCCG
CGCCCCTCGGCCCTCATCAACATCTACCTCCTGCTCTCCATCGTGTTCGATGCCGTACAAGCCCGTACCCTGTGG
CTCAAGCACGCCGGAGACGCCCTACCTGCCCTCTTCACCGCCTCGCTGGCCATCAAGGCAGCATTGCTTGCCCTC
GAAAGCATAGACAAGGACAGCTTCCTGCCTCCGGCCTGGCGAGCGCGAAGTCCGGAGGAAAGGAGCGGCGTCTTC
AGCCGCGGTCTCCTGCTGTGGCTCCACCGCATTCTGTTCCAAGGCCGCAAGCACACCCTGCATCCCCAGGACTTG
TATACCTTGGTGCCCGGCCTCGAGACTCGACGACTATCCTCCGCATTCTGGGAGGCCTGGTCGTCGCAGGCGGCA
GAACCCTCGTCCAAGAACATCGGCCGCGCCCTCCTGCACACTCTCAAGTGGTCCCTCTTGGCCCCCGTCATCCCC
CGCCTGGCCCAGTGCGCCTTTACCATTTGCCAGCCCCTTCTCCTCGGCGAGTTTCTCCGCTACCTCCAGGGCGAG
GACAACTTCGTCAGCGGCACCGGCTATGGCTTTATCGGTGCCTACGGCCTGCTGTACTGCGGCCTCGCCATCTCG
ACATGCCTCTCCTGGCGCTTGACGTACAAGTGCCTCATCAAGATGCGCGGCTGTCTGGTGGCGGCCATCTACAAG
AAGACGACCGACATCGACGCTGCCAGCTGCGACATGACCGCGCCCGTGGCCCTTATGAGCACCGACATGGAGCGC
ATCATCCACGGCTGCAAGGACTTCCACGAGATCTGGGGCAACACCCTGCAGGTGGCCGTCTCCGTCTGGCTTCTC
TACAACAACATGGGTATTGCTTGCGTCGCTCCCTCCGTCGTCACTATCCTCTCCAGTGCCGGCTCCTTCGTGATA
TCCTCGTACGCCGACAAGGCCCAGGAGAGGTGGATGGAGGCCACCCAGGCGCGCGTAGCCGCGACCGTCAAAGCC
ATAACCTCTATGAAATTCATGAGGCTTCTCGGCCTTTCCGACAACATCCACGCCATGCTCAGTGACCTACGACGG
GCCGAGCTCCGGGCAGCCAAAGTGTACCGATACATCGAGGTGCTCACGGCCAACTTGTCCTTTGCGCCCCTGCTG
CTGTCCCCGGTCTTCACCTTCATGGTCTTCGTCATACAGGCGCAAAGCACGGGCAACCGTCTGGACATCACCACC
GCTTTCACATCCCTCTCCCTCCTCCAGCTCATGACCAACCCGCTGGTCTGGCTTTTTCAATCCATACCGCTCTTC
GTCGCCTCTCTCGGCTGTCTCCGCCGCATCGAGCTGTACCTGAACTCCCAGCCCAGGACGGAGATGAGGACTTTG
AGGGCCGACGAGAGCGGTTGGACGTCACCCTCGGCCAGCATGAGCTCAGCCCAAGAGATGGTGGAAAAGCCCAAT
GGCGTTGACGGCAACGCCATCGCGATCCGTGATGGCCAGTTCGGCTGGACACGTGACAGTCCCGTGCTGCGCGAG
GTGAATGTCGACATCCCCGCCTCGAAACTGACCATGATCGTCGGACCCGTGGCCAGCGGAAAAAGTACGTTCAGC
AAGGCCATCATCGGCGAGATTCCTTACTGCACCGGCCAAGTCCACTTGAATCTGTCGTCTGCGCAAATCGCCTAC
TGCGACCAGAACGCTTTCGTCATAAACGGAACGGTCCGTGACAATATCGTCGGCTTTTCCGACTTTGACAGCATC
CGGTACGATGCTGTCGTCCGGGCAGTCGACCTCGCCAAAGATGTCGCAGCGATGGCGGATGGCCACCAGACCCGA
GTGGGCAGCAAGGGAGTCATCCTCAGCGGCGGACAACGGCAGAGAGTGGCCATAGCCCGAGCCGTTTACGCGCGG
ACCGCTCTGGCCGTTTTCGATGACGTGCTGAGCGGGCTGGACGCCGTGACCAAGAGGCACGTATTCGAACATGTC
TTCAGCCCCCGAGGGCTGCTTCGAGAGCAAGGGTGCACCGTCATGCTCTCGACGCACGACGTCGACCTCCTGCCG
GAGGCCGACCATATCATTGCCTTGGGCAGGGACGGATGCGTAGCCGACAGCGGCTCGTATGCGCACTTGAGCCAG
GAGTCTGAATACATCAAGTCGCTGGCTGTCCGCGAAGTCCAGGCTGCCAACCACGACGGGGCTCACCAGGCCAAC
AGCGCTCCGGCCAGGTTGTCCATGGAGGGCGAGGAGCCGCCGGCCGAGGCACCAGAGGACATGAAGCGCCGCCTG
GGCGATGCCTCCATCTACCGATACCTCTTCCACCACATCGGTCTGCGGCGGGTCCTGCTCTTCTGCTTCTACGAA
TGCGGATGGGCTGTCTTTTCGACAATCGGGCCGGTCTGGCTCAAGTTCTGGGCCGCTGCGAGCATGGCGGGAGAG
GACCGCGACGGATACTACATGGGCGTGTTCGTAGCCTTCCAGGGCCTGGCTCTGGTGTTTCTCGCCCTCATCGCC
AGCCACACCTTGGTCACCGTGGCCGTCAGAGCTGGAAAGTCCCTGCACGGAGTCCTGCTCAGGACCGTCATGGCC
GCACCCATGTCCTTCTTCGGCACAGTCGACGCGGGAATCACGACGAATCGCTTCTCCCAGGACCTCATCCTCATA
GACGGAGACCTCCCCATTTCCATCCTGGAGACCGTGTCAGCGGGTCTGGTCGCTCTAGTGCAGGCCATCCTCATC
GCCATAGCGGCGCCGTACGTGGCCATCGCTTACCCGTTTCTGGTCCTGCTGCTGTACGCCATCCAAAGCTTCTAC
CTGCGTACCTCTCGACAGCTCAGGTTCCTCGAGCTCGAGGCCAAGAGCCCGCTATACACGCATTTTCTGGAGACG
CTGCAGGGCCTCGCCACCATCCGCTCCTTTGGCTGGTCGGACGAAAACAACGAGCTCAACCACCAGCTGGTAGAC
GCTTCGCAGAAGCCGCTTTACCTCCTCTACATGGTGCAGAGATGGCTGCAGCTGGTGCTGGAGCTGCTGATCGCC
GTCACCGCCGTAATCCTGATTGCGGTGGCCGTCCAACTGCATTCGACCTCGGCAGGCTTCATCGGCGTGGCGCTG
GTGAATCTCATGTCCATCAGCCAGGAGCTAAAGATGATTGTGATTGAGTGGACGAACCTGGAGACGTCCCTCAGT
GCCCTCGCGCGCACCAAGTCTTTCGAAGAGGAGACGCCCCCGGAGGGCAAGGAGGACGGGCGGAGCGAACCGCCG
TCGGCGTGGCCTCAGACGGGCCATGTCCAGCTCTCTTCCATCTCGGCCAGCTACGGCGTTTCGGAGCAGGCAAGT
CTCGCCCTGCGCGACGTGTCGATGACGATCCCCAACGGTCGCAAGGTTGCCATCTGCGGACGGAGCGGCAGCGGG
AAAAGCACGCTCGTCATGGCTCTCGCGCGAATGATAGACTTGACTTCCGGATCCATCACGGTCGACGGCGTGGAC
CTCAGCAGCCTGCCCCGGTCGACGGTACGCTCTGCGCTCAACGTCATCCCACAGGAACCGCATTTCTTCCACAAG
ACGACGTCGCAGAATCTCGATCCGTCGGGATCTGCATCGGCCGAGGCCATGCGCTCGGCGCTCGAGAAGGTGCAG
CTGTGGGAGGTGGTGGACTTGGCAGGGGGGCTCGATGCCGAGCTCGACGTCGAGACGCTCAGCCAGGGCCAGCGG
CAGCTTCTCGCCTTGGCTCGCGCGCTGCTGAGGCAGGGCAAGATTGTCGTGCTGGACGAGGCGACGAGCAACGTG
GACAAGCATGTGGAGGAGGTGATGCAGCAGATCATCCGCGAAGAGTTTCAGGGGCGGACCATCATCGCCGTGGCG
CACCAGCTGCGGACCATCATCGACTTCGACGAGGTCATGGTCATGGACGCGGGCCAGCTAGTCGAGAGCGGGACG
CCGAGAGAGCTAATGGCACGCGACTCCACGTTCAAGCGGCTGTGCGACATGCAAGGGGTTTCCATTGACTAG
Transcript >Hirsu2|9016
ATGGACAATACGAGTCGCTGCGACGATGACGACTTTGGCCCGTTCATCCACGGCTGTCGAGGGGACTTCGACTTC
ACTCTTCTGTTCGAACAGAGCTTCTTCTCCATCACGCCCTCCTCCCTCTTCCTCCTCCTGTCGACCCTGCGCCTA
GGCCTCCTTCTCTCTCGCGGCAGGAGGCAGGTCTCCGGCACCTGGTTCCAGCTCGGCAAGCTGGCCGCCATCGCC
TGTTACGGCGCCGTCCAGTCAGCCCTCTTGGCCCTCTGGGCCCGAACCGGCGTCTACGAGACGCGCACCAGCCTG
GCCGCCGCCGTCCTCTCCTTTGCCGACGTCTTCGCCCTCGGCCTCCTTTCCTGGTTCGAGCATGCCTACTCGCCG
CGCCCCTCGGCCCTCATCAACATCTACCTCCTGCTCTCCATCGTGTTCGATGCCGTACAAGCCCGTACCCTGTGG
CTCAAGCACGCCGGAGACGCCCTACCTGCCCTCTTCACCGCCTCGCTGGCCATCAAGGCAGCATTGCTTGCCCTC
GAAAGCATAGACAAGGACAGCTTCCTGCCTCCGGCCTGGCGAGCGCGAAGTCCGGAGGAAAGGAGCGGCGTCTTC
AGCCGCGGTCTCCTGCTGTGGCTCCACCGCATTCTGTTCCAAGGCCGCAAGCACACCCTGCATCCCCAGGACTTG
TATACCTTGGTGCCCGGCCTCGAGACTCGACGACTATCCTCCGCATTCTGGGAGGCCTGGTCGTCGCAGGCGGCA
GAACCCTCGTCCAAGAACATCGGCCGCGCCCTCCTGCACACTCTCAAGTGGTCCCTCTTGGCCCCCGTCATCCCC
CGCCTGGCCCAGTGCGCCTTTACCATTTGCCAGCCCCTTCTCCTCGGCGAGTTTCTCCGCTACCTCCAGGGCGAG
GACAACTTCGTCAGCGGCACCGGCTATGGCTTTATCGGTGCCTACGGCCTGCTGTACTGCGGCCTCGCCATCTCG
ACATGCCTCTCCTGGCGCTTGACGTACAAGTGCCTCATCAAGATGCGCGGCTGTCTGGTGGCGGCCATCTACAAG
AAGACGACCGACATCGACGCTGCCAGCTGCGACATGACCGCGCCCGTGGCCCTTATGAGCACCGACATGGAGCGC
ATCATCCACGGCTGCAAGGACTTCCACGAGATCTGGGGCAACACCCTGCAGGTGGCCGTCTCCGTCTGGCTTCTC
TACAACAACATGGGTATTGCTTGCGTCGCTCCCTCCGTCGTCACTATCCTCTCCAGTGCCGGCTCCTTCGTGATA
TCCTCGTACGCCGACAAGGCCCAGGAGAGGTGGATGGAGGCCACCCAGGCGCGCGTAGCCGCGACCGTCAAAGCC
ATAACCTCTATGAAATTCATGAGGCTTCTCGGCCTTTCCGACAACATCCACGCCATGCTCAGTGACCTACGACGG
GCCGAGCTCCGGGCAGCCAAAGTGTACCGATACATCGAGGTGCTCACGGCCAACTTGTCCTTTGCGCCCCTGCTG
CTGTCCCCGGTCTTCACCTTCATGGTCTTCGTCATACAGGCGCAAAGCACGGGCAACCGTCTGGACATCACCACC
GCTTTCACATCCCTCTCCCTCCTCCAGCTCATGACCAACCCGCTGGTCTGGCTTTTTCAATCCATACCGCTCTTC
GTCGCCTCTCTCGGCTGTCTCCGCCGCATCGAGCTGTACCTGAACTCCCAGCCCAGGACGGAGATGAGGACTTTG
AGGGCCGACGAGAGCGGTTGGACGTCACCCTCGGCCAGCATGAGCTCAGCCCAAGAGATGGTGGAAAAGCCCAAT
GGCGTTGACGGCAACGCCATCGCGATCCGTGATGGCCAGTTCGGCTGGACACGTGACAGTCCCGTGCTGCGCGAG
GTGAATGTCGACATCCCCGCCTCGAAACTGACCATGATCGTCGGACCCGTGGCCAGCGGAAAAAGTACGTTCAGC
AAGGCCATCATCGGCGAGATTCCTTACTGCACCGGCCAAGTCCACTTGAATCTGTCGTCTGCGCAAATCGCCTAC
TGCGACCAGAACGCTTTCGTCATAAACGGAACGGTCCGTGACAATATCGTCGGCTTTTCCGACTTTGACAGCATC
CGGTACGATGCTGTCGTCCGGGCAGTCGACCTCGCCAAAGATGTCGCAGCGATGGCGGATGGCCACCAGACCCGA
GTGGGCAGCAAGGGAGTCATCCTCAGCGGCGGACAACGGCAGAGAGTGGCCATAGCCCGAGCCGTTTACGCGCGG
ACCGCTCTGGCCGTTTTCGATGACGTGCTGAGCGGGCTGGACGCCGTGACCAAGAGGCACGTATTCGAACATGTC
TTCAGCCCCCGAGGGCTGCTTCGAGAGCAAGGGTGCACCGTCATGCTCTCGACGCACGACGTCGACCTCCTGCCG
GAGGCCGACCATATCATTGCCTTGGGCAGGGACGGATGCGTAGCCGACAGCGGCTCGTATGCGCACTTGAGCCAG
GAGTCTGAATACATCAAGTCGCTGGCTGTCCGCGAAGTCCAGGCTGCCAACCACGACGGGGCTCACCAGGCCAAC
AGCGCTCCGGCCAGGTTGTCCATGGAGGGCGAGGAGCCGCCGGCCGAGGCACCAGAGGACATGAAGCGCCGCCTG
GGCGATGCCTCCATCTACCGATACCTCTTCCACCACATCGGTCTGCGGCGGGTCCTGCTCTTCTGCTTCTACGAA
TGCGGATGGGCTGTCTTTTCGACAATCGGGCCGGTCTGGCTCAAGTTCTGGGCCGCTGCGAGCATGGCGGGAGAG
GACCGCGACGGATACTACATGGGCGTGTTCGTAGCCTTCCAGGGCCTGGCTCTGGTGTTTCTCGCCCTCATCGCC
AGCCACACCTTGGTCACCGTGGCCGTCAGAGCTGGAAAGTCCCTGCACGGAGTCCTGCTCAGGACCGTCATGGCC
GCACCCATGTCCTTCTTCGGCACAGTCGACGCGGGAATCACGACGAATCGCTTCTCCCAGGACCTCATCCTCATA
GACGGAGACCTCCCCATTTCCATCCTGGAGACCGTGTCAGCGGGTCTGGTCGCTCTAGTGCAGGCCATCCTCATC
GCCATAGCGGCGCCGTACGTGGCCATCGCTTACCCGTTTCTGGTCCTGCTGCTGTACGCCATCCAAAGCTTCTAC
CTGCGTACCTCTCGACAGCTCAGGTTCCTCGAGCTCGAGGCCAAGAGCCCGCTATACACGCATTTTCTGGAGACG
CTGCAGGGCCTCGCCACCATCCGCTCCTTTGGCTGGTCGGACGAAAACAACGAGCTCAACCACCAGCTGGTAGAC
GCTTCGCAGAAGCCGCTTTACCTCCTCTACATGGTGCAGAGATGGCTGCAGCTGGTGCTGGAGCTGCTGATCGCC
GTCACCGCCGTAATCCTGATTGCGGTGGCCGTCCAACTGCATTCGACCTCGGCAGGCTTCATCGGCGTGGCGCTG
GTGAATCTCATGTCCATCAGCCAGGAGCTAAAGATGATTGTGATTGAGTGGACGAACCTGGAGACGTCCCTCAGT
GCCCTCGCGCGCACCAAGTCTTTCGAAGAGGAGACGCCCCCGGAGGGCAAGGAGGACGGGCGGAGCGAACCGCCG
TCGGCGTGGCCTCAGACGGGCCATGTCCAGCTCTCTTCCATCTCGGCCAGCTACGGCGTTTCGGAGCAGGCAAGT
CTCGCCCTGCGCGACGTGTCGATGACGATCCCCAACGGTCGCAAGGTTGCCATCTGCGGACGGAGCGGCAGCGGG
AAAAGCACGCTCGTCATGGCTCTCGCGCGAATGATAGACTTGACTTCCGGATCCATCACGGTCGACGGCGTGGAC
CTCAGCAGCCTGCCCCGGTCGACGGTACGCTCTGCGCTCAACGTCATCCCACAGGAACCGCATTTCTTCCACAAG
ACGACGTCGCAGAATCTCGATCCGTCGGGATCTGCATCGGCCGAGGCCATGCGCTCGGCGCTCGAGAAGGTGCAG
CTGTGGGAGGTGGTGGACTTGGCAGGGGGGCTCGATGCCGAGCTCGACGTCGAGACGCTCAGCCAGGGCCAGCGG
CAGCTTCTCGCCTTGGCTCGCGCGCTGCTGAGGCAGGGCAAGATTGTCGTGCTGGACGAGGCGACGAGCAACGTG
GACAAGCATGTGGAGGAGGTGATGCAGCAGATCATCCGCGAAGAGTTTCAGGGGCGGACCATCATCGCCGTGGCG
CACCAGCTGCGGACCATCATCGACTTCGACGAGGTCATGGTCATGGACGCGGGCCAGCTAGTCGAGAGCGGGACG
CCGAGAGAGCTAATGGCACGCGACTCCACGTTCAAGCGGCTGTGCGACATGCAAGGGGTTTCCATTGACTAG
Gene >Hirsu2|9016
ATGGACAATACGAGTCGCTGCGACGATGACGACTTTGGCCCGTTCATCCACGGCTGTCGAGGGGACTTCGACTTC
ACTCTTCTGTTCGAACAGAGCTTCTTCTCCATCACGCCCTCCTCCCTCTTCCTCCTCCTGTCGACCCTGCGCCTA
GGCCTCCTTCTCTCTCGCGGCAGGAGGCAGGTCTCCGGCACCTGGTTCCAGCTCGGCAAGCTGGCCGCCATCGCC
TGTTACGGCGCCGTCCAGTCAGCCCTCTTGGCCCTCTGGGCCCGAACCGGCGTCTACGAGACGCGCACCAGCCTG
GCCGCCGCCGTCCTCTCCTTTGCCGACGTCTTCGCCCTCGGCCTCCTTTCCTGGTTCGAGCATGCCTACTCGCCG
CGCCCCTCGGCCCTCATCAACATCTACCTCCTGCTCTCCATCGTGTTCGATGCCGTACAAGCCCGTACCCTGTGG
CTCAAGCACGCCGGAGACGCCCTACCTGCCCTCTTCACCGCCTCGCTGGCCATCAAGGCAGCATTGCTTGCCCTC
GAAAGCATAGACAAGGACAGCTTCCTGCCTCCGGCCTGGCGAGCGCGAAGTCCGGAGGAAAGGAGCGGCGTCTTC
AGCCGCGGTCTCCTGCTGTGGCTCCACCGCATTCTGTTCCAAGGCCGCAAGCACACCCTGCATCCCCAGGACTTG
TATACCTTGGTGCCCGGCCTCGAGACTCGACGACTATCCTCCGCATTCTGGGAGGCCTGGTCGTCGCAGGCGGCA
GAACCCTCGTCCAAGAACATCGGCCGCGCCCTCCTGCACACTCTCAAGTGGTCCCTCTTGGCCCCCGTCATCCCC
CGCCTGGCCCAGTGCGCCTTTACCATTTGCCAGCCCCTTCTCCTCGGCGAGTTTCTCCGCTACCTCCAGGGCGAG
GACAACTTCGTCAGCGGCACCGGCTATGGCTTTATCGGTGCCTACGGCCTGCTGTACTGCGGCCTCGCCATCTCG
ACATGCCTCTCCTGGCGCTTGACGTACAAGTGCCTCATCAAGATGCGCGGCTGTCTGGTGGCGGCCATCTACAAG
AAGACGACCGACATCGACGCTGCCAGCTGCGACATGACCGCGCCCGTGGCCCTTATGAGCACCGACATGGAGCGC
ATCATCCACGGCTGCAAGGACTTCCACGAGATCTGGGGCAACACCCTGCAGGTGGCCGTCTCCGTCTGGCTTCTC
TACAACAACATGGGTATTGCTTGCGTCGCTCCCTCCGTCGTCACTATCCTCTCCAGTGCCGGCTCCTTCGTGATA
TCCTCGTACGCCGACAAGGCCCAGGAGAGGTGGATGGAGGCCACCCAGGCGCGCGTAGCCGCGACCGTCAAAGCC
ATAACCTCTATGAAATTCATGAGGCTTCTCGGCCTTTCCGACAACATCCACGCCATGCTCAGTGACCTACGACGG
GCCGAGCTCCGGGCAGCCAAAGTGTACCGATACATCGAGGTGCTCACGGCCAACTTGTCCTTTGCGCCCCTGCTG
CTGTCCCCGGTCTTCACCTTCATGGTCTTCGTCATACAGGCGCAAAGCACGGGCAACCGTCTGGACATCACCACC
GCTTTCACATCCCTCTCCCTCCTCCAGCTCATGACCAACCCGCTGGTCTGGCTTTTTCAATCCATACCGCTCTTC
GTCGCCTCTCTCGGCTGTCTCCGCCGCATCGAGCTGTACCTGAACTCCCAGCCCAGGACGGAGATGAGGACTTTG
AGGGCCGACGAGAGCGGTTGGACGTCACCCTCGGCCAGCATGAGCTCAGCCCAAGAGATGGTGGAAAAGCCCAAT
GGCGTTGACGGCAACGCCATCGCGATCCGTGATGGCCAGTTCGGCTGGACACGTGACAGTCCCGTGCTGCGCGAG
GTGAATGTCGACATCCCCGCCTCGAAACTGACCATGATCGTCGGACCCGTGGCCAGCGGAAAAAGTACGTTCAGC
AAGGCCATCATCGGCGAGATTCCTTACTGCACCGGCCAAGTCCACTTGAATCTGTCGTCTGCGCAAATCGCCTAC
TGCGACCAGAACGCTTTCGTCATAAACGGAACGGTCCGTGACAATATCGTCGGCTTTTCCGACTTTGACAGCATC
CGGTACGATGCTGTCGTCCGGGCAGTCGACCTCGCCAAAGATGTCGCAGCGATGGCGGATGGCCACCAGACCCGA
GTGGGCAGCAAGGGAGTCATCCTCAGCGGCGGACAACGGCAGAGAGTGGCCATAGCCCGAGCCGTTTACGCGCGG
ACCGCTCTGGCCGTTTTCGATGACGTGCTGAGCGGGCTGGACGCCGTGACCAAGAGGCACGTATTCGAACATGTC
TTCAGCCCCCGAGGGCTGCTTCGAGAGCAAGGGTGCACCGTCATGCTCTCGACGCACGACGTCGACCTCCTGCCG
GAGGCCGACCATATCATTGCCTTGGGCAGGGACGGATGCGTAGCCGACAGCGGCTCGTATGCGCACTTGAGCCAG
GAGTCTGAATACATCAAGTCGCTGGCTGTCCGCGAAGTCCAGGCTGCCAACCACGACGGGGCTCACCAGGCCAAC
AGCGCTCCGGCCAGGTTGTCCATGGAGGGCGAGGAGCCGCCGGCCGAGGCACCAGAGGACATGAAGCGCCGCCTG
GGCGATGCCTCCATCTACCGATACCTCTTCCACCACATCGGTCTGCGGCGGGTCCTGCTCTTCTGCTTCTACGAA
TGCGGATGGGCTGTCTTTTCGACAATCGGGCCGGTCTGGCTCAAGTTCTGGGCCGCTGCGAGCATGGCGGGAGAG
GACCGCGACGGATACTACATGGGCGTGTTCGTAGCCTTCCAGGGCCTGGCTCTGGTGTTTCTCGCCCTCATCGCC
AGCCACACCTTGGTCACCGTGGCCGTCAGAGCTGGAAAGTCCCTGCACGGAGTCCTGCTCAGGACCGTCATGGCC
GCACCCATGTCCTTCTTCGGCACAGTCGACGCGGGAATCACGACGAATCGCTTCTCCCAGGACCTCATCCTCATA
GACGGAGACCTCCCCATTTCCATCCTGGAGACCGTGTCAGCGGGTCTGGTCGCTCTAGTGCAGGCCATCCTCATC
GCCATAGCGGCGCCGTACGTGGCCATCGCTTACCCGTTTCTGGTCCTGCTGCTGTACGCCATCCAAAGCTTCTAC
CTGCGTACCTCTCGACAGCTCAGGTTCCTCGAGCTCGAGGCCAAGAGCCCGCTATACACGCATTTTCTGGAGACG
CTGCAGGGCCTCGCCACCATCCGCTCCTTTGGCTGGTCGGACGAAAACAACGAGCTCAACCACCAGCTGGTAGAC
GCTTCGCAGAAGCCGCTTTACCTCCTCTACATGGTGCAGAGATGGCTGCAGCTGGTGCTGGAGCTGCTGATCGCC
GTCACCGCCGTAATCCTGATTGCGGTGGCCGTCCAACTGCATTCGACCTCGGCAGGCTTCATCGGCGTGGCGCTG
GTGAATCTCATGTCCATCAGCCAGGAGCTAAAGATGATTGTGATTGAGTGGACGAACCTGGAGACGTCCCTCAGT
GCCCTCGCGCGCACCAAGTCTTTCGAAGAGGAGACGCCCCCGGAGGGCAAGGAGGACGGGCGGAGCGAACCGCCG
TCGGCGTGGCCTCAGACGGGCCATGTCCAGCTCTCTTCCATCTCGGCCAGCTACGGCGTTTCGGAGCAGGCAAGT
CTCGCCCTGCGCGACGTGTCGATGACGATCCCCAACGGTCGCAAGGTTGCCATCTGCGGACGGAGCGGCAGCGGG
AAAAGCACGCTCGTCATGGCTCTCGCGCGAATGATAGACTTGACTTCCGGATCCATCACGGTCGACGGCGTGGAC
CTCAGCAGCCTGCCCCGGTCGACGGTACGCTCTGCGCTCAACGTCATCCCACAGGAACCGCATTTCTTCCACAAG
ACGACGTCGCAGAATCTCGATCCGTCGGGATCTGCATCGGCCGAGGCCATGCGCTCGGCGCTCGAGAAGGTGCAG
CTGTGGGAGGTGGTGGACTTGGCAGGGGGGCTCGATGCCGAGCTCGACGTCGAGACGCTCAGCCAGGGCCAGCGG
CAGCTTCTCGCCTTGGCTCGCGCGCTGCTGAGGCAGGGCAAGATTGTCGTGCTGGACGAGGCGACGAGCAAGTAA
GTGTCGGGATTTGCCCTCTATCGCCTTCTCTGTTGGGCCCCCCAACCAAGCAACCGACCCCCCTTTCCGTCTGGC
GGATGTGCGGGAGCTAACGCAGACCAGCGTGGACAAGCATGTGGAGGAGGTGATGCAGCAGATCATCCGCGAAGA
GTTTCAGGGGCGGACCATCATCGCCGTGGCGCACCAGCTGCGGACCATCATCGACTTCGACGAGGTCATGGTCAT
GGACGCGGGCCAGCTAGTCGAGAGCGGGACGCCGAGAGAGCTAATGGCACGCGACTCCACGTTCAAGCGGCTGTG
CGACATGCAAGGGGTTTCCATTGACTAG

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail