Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|9013
Gene name
LocationContig_626:5212..7024
Strand-
Gene length (bp)1812
Transcript length (bp)1812
Coding sequence length (bp)1812
Protein length (aa) 604

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07690 MFS_1 Major Facilitator Superfamily 5.0E-47 85 483
PF06609 TRI12 Fungal trichothecene efflux pump (TRI12) 2.9E-28 94 340
PF00083 Sugar_tr Sugar (and other) transporter 1.2E-11 109 253

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q10072|YAN6_SCHPO Uncharacterized transporter C3H1.06c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC3H1.06c PE=3 SV=1 79 579 3.0E-91
sp|Q9HE13|YI32_SCHPO Uncharacterized MFS-type transporter C1399.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1399.02 PE=3 SV=1 58 579 7.0E-88
sp|O42922|YBIH_SCHPO Uncharacterized MFS-type transporter C16A3.17c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC16A3.17c PE=3 SV=1 34 571 9.0E-83
sp|O32182|YUSP_BACSU Uncharacterized MFS-type transporter YusP OS=Bacillus subtilis (strain 168) GN=yusP PE=3 SV=1 70 492 2.0E-58
sp|P9WG85|Y1877_MYCTU Uncharacterized MFS-type transporter Rv1877 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv1877 PE=3 SV=1 80 577 3.0E-55
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q10072|YAN6_SCHPO Uncharacterized transporter C3H1.06c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC3H1.06c PE=3 SV=1 79 579 3.0E-91
sp|Q9HE13|YI32_SCHPO Uncharacterized MFS-type transporter C1399.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1399.02 PE=3 SV=1 58 579 7.0E-88
sp|O42922|YBIH_SCHPO Uncharacterized MFS-type transporter C16A3.17c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC16A3.17c PE=3 SV=1 34 571 9.0E-83
sp|O32182|YUSP_BACSU Uncharacterized MFS-type transporter YusP OS=Bacillus subtilis (strain 168) GN=yusP PE=3 SV=1 70 492 2.0E-58
sp|P9WG85|Y1877_MYCTU Uncharacterized MFS-type transporter Rv1877 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv1877 PE=3 SV=1 80 577 3.0E-55
sp|P9WG84|Y1877_MYCTO Uncharacterized MFS-type transporter MT1926 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT1926 PE=3 SV=1 80 577 3.0E-55
sp|P36172|VBA5_YEAST Vacuolar basic amino acid transporter 5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VBA5 PE=3 SV=1 34 499 3.0E-54
sp|P96712|BMR3_BACSU Multidrug resistance protein 3 OS=Bacillus subtilis (strain 168) GN=bmr3 PE=1 SV=1 91 515 1.0E-53
sp|Q00357|TOXA_COCCA Putative HC-toxin efflux carrier TOXA OS=Cochliobolus carbonum GN=TOXA PE=3 SV=1 21 573 1.0E-49
sp|Q09752|FNX1_SCHPO Multidrug resistance protein fnx1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=fnx1 PE=2 SV=2 52 568 9.0E-49
sp|O59726|FNX2_SCHPO Vacuolar membrane amino acid uptake transporter fnx2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=fnx2 PE=3 SV=1 63 571 1.0E-44
sp|P33335|SGE1_YEAST Protein SGE1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SGE1 PE=1 SV=1 95 498 2.0E-42
sp|P50080|AZR1_YEAST Azole resistance protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AZR1 PE=1 SV=1 95 492 1.0E-38
sp|P9WG87|Y1250_MYCTU Uncharacterized MFS-type transporter Rv1250 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv1250 PE=3 SV=1 82 479 2.0E-38
sp|P9WG86|Y1250_MYCTO Uncharacterized MFS-type transporter MT1289 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT1289 PE=3 SV=1 82 479 2.0E-38
sp|P25594|VBA3_YEAST Vacuolar basic amino acid transporter 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VBA3 PE=1 SV=1 167 499 2.0E-35
sp|P54585|YHCA_BACSU Uncharacterized MFS-type transporter YhcA OS=Bacillus subtilis (strain 168) GN=yhcA PE=3 SV=2 70 568 3.0E-35
sp|P38358|VBA2_YEAST Vacuolar basic amino acid transporter 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VBA2 PE=1 SV=1 118 490 2.0E-32
sp|Q04301|VBA1_YEAST Vacuolar basic amino acid transporter 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VBA1 PE=1 SV=1 76 401 7.0E-31
sp|P94422|YCNB_BACSU Uncharacterized MFS-type transporter YcnB OS=Bacillus subtilis (strain 168) GN=ycnB PE=3 SV=1 90 494 5.0E-30
sp|B5BP47|YP53_SCHPO Uncharacterized transporter C460.03 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC460.03 PE=3 SV=1 81 498 7.0E-30
sp|Q00538|MMR_BACSU Methylenomycin A resistance protein OS=Bacillus subtilis (strain 168) GN=mmr PE=3 SV=1 81 492 8.0E-30
sp|P9WG88|EMRB_MYCTO Multidrug resistance protein B homolog OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=emrB PE=3 SV=1 59 573 9.0E-30
sp|P9WG89|EMRB_MYCTU Multidrug resistance protein B homolog OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=emrB PE=3 SV=1 59 422 1.0E-29
sp|P11545|MMR_STRCO Methylenomycin A resistance protein OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=mmr PE=3 SV=1 56 519 1.0E-27
sp|P39886|TCMA_STRGA Tetracenomycin C resistance and export protein OS=Streptomyces glaucescens GN=tcmA PE=3 SV=1 54 402 8.0E-27
sp|P44903|HSRA_HAEIN Probable transport protein HsrA OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=hsrA PE=3 SV=1 87 414 2.0E-26
sp|O31563|YFIU_BACSU Uncharacterized MFS-type transporter YfiU OS=Bacillus subtilis (strain 168) GN=yfiU PE=3 SV=1 87 483 6.0E-26
sp|P76269|YEBQ_ECOLI Uncharacterized transporter YebQ OS=Escherichia coli (strain K12) GN=yebQ PE=3 SV=2 66 493 2.0E-25
sp|P0AEJ0|EMRB_ECOLI Multidrug export protein EmrB OS=Escherichia coli (strain K12) GN=emrB PE=1 SV=1 65 507 3.0E-25
sp|P0AEJ1|EMRB_ECO57 Multidrug export protein EmrB OS=Escherichia coli O157:H7 GN=emrB PE=3 SV=1 65 507 3.0E-25
sp|A4WCC3|MDTD_ENT38 Putative multidrug resistance protein MdtD OS=Enterobacter sp. (strain 638) GN=mdtD PE=3 SV=1 90 498 6.0E-25
sp|O35018|LMRB_BACSU Lincomycin resistance protein LmrB OS=Bacillus subtilis (strain 168) GN=lmrB PE=3 SV=1 67 573 2.0E-24
sp|P42670|PUR8_STRAD Puromycin resistance protein pur8 OS=Streptomyces alboniger GN=pur8 PE=3 SV=1 82 486 1.0E-23
sp|P46105|ACT22_STRCO Probable actinorhodin transporter OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=actII-2 PE=3 SV=1 94 498 2.0E-23
sp|P31474|HSRA_ECOLI Probable transport protein HsrA OS=Escherichia coli (strain K12) GN=hsrA PE=1 SV=1 86 492 2.0E-23
sp|Q99S97|SDRM_STAAN Multidrug efflux pump SdrM OS=Staphylococcus aureus (strain N315) GN=sdrM PE=1 SV=1 75 491 2.0E-23
sp|B5XPB7|MDTD_KLEP3 Putative multidrug resistance protein MdtD OS=Klebsiella pneumoniae (strain 342) GN=mdtD PE=3 SV=1 90 498 2.0E-22
sp|O74395|STR1_SCHPO Siderophore iron transporter 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=str1 PE=1 SV=1 17 575 3.0E-22
sp|A8GHR1|MDTD_SERP5 Putative multidrug resistance protein MdtD OS=Serratia proteamaculans (strain 568) GN=mdtD PE=3 SV=1 90 498 4.0E-22
sp|A6TBH6|MDTD_KLEP7 Putative multidrug resistance protein MdtD OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=mdtD PE=3 SV=1 90 498 5.0E-22
sp|A8AEE4|MDTD_CITK8 Putative multidrug resistance protein MdtD OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=mdtD PE=3 SV=1 90 499 5.0E-22
sp|P9WG90|STP_MYCTO Multidrug resistance protein Stp OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=stp PE=3 SV=1 75 491 2.0E-21
sp|B5BF67|MDTD_SALPK Putative multidrug resistance protein MdtD OS=Salmonella paratyphi A (strain AKU_12601) GN=mdtD PE=3 SV=1 90 419 3.0E-21
sp|Q5PDW9|MDTD_SALPA Putative multidrug resistance protein MdtD OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=mdtD PE=3 SV=1 90 419 3.0E-21
sp|C6DBD0|MDTD_PECCP Putative multidrug resistance protein MdtD OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=mdtD PE=3 SV=1 90 408 3.0E-21
sp|Q8Z5F5|MDTD_SALTI Putative multidrug resistance protein MdtD OS=Salmonella typhi GN=mdtD PE=3 SV=1 90 419 4.0E-21
sp|B5FMU8|MDTD_SALDC Putative multidrug resistance protein MdtD OS=Salmonella dublin (strain CT_02021853) GN=mdtD PE=3 SV=1 90 419 5.0E-21
sp|B4SXW2|MDTD_SALNS Putative multidrug resistance protein MdtD OS=Salmonella newport (strain SL254) GN=mdtD PE=3 SV=1 90 419 6.0E-21
sp|B5R0C2|MDTD_SALEP Putative multidrug resistance protein MdtD OS=Salmonella enteritidis PT4 (strain P125109) GN=mdtD PE=3 SV=1 90 419 6.0E-21
sp|B5EXV9|MDTD_SALA4 Putative multidrug resistance protein MdtD OS=Salmonella agona (strain SL483) GN=mdtD PE=3 SV=1 90 419 6.0E-21
sp|B4TNI8|MDTD_SALSV Putative multidrug resistance protein MdtD OS=Salmonella schwarzengrund (strain CVM19633) GN=mdtD PE=3 SV=1 90 419 8.0E-21
sp|P9WG91|STP_MYCTU Multidrug resistance protein Stp OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=stp PE=1 SV=1 75 491 9.0E-21
sp|P9WJY5|EFPA_MYCTU Uncharacterized MFS-type transporter EfpA OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=efpA PE=1 SV=1 90 387 9.0E-21
sp|P9WJY4|EFPA_MYCTO Uncharacterized MFS-type transporter EfpA OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=efpA PE=3 SV=1 90 387 9.0E-21
sp|Q8ZNQ0|MDTD_SALTY Putative multidrug resistance protein MdtD OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=mdtD PE=3 SV=1 90 419 1.0E-20
sp|B4T9U3|MDTD_SALHS Putative multidrug resistance protein MdtD OS=Salmonella heidelberg (strain SL476) GN=mdtD PE=3 SV=1 85 419 1.0E-20
sp|B1JSD2|MDTD_YERPY Putative multidrug resistance protein MdtD OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=mdtD PE=3 SV=1 90 410 1.0E-20
sp|A4TMR4|MDTD_YERPP Putative multidrug resistance protein MdtD OS=Yersinia pestis (strain Pestoides F) GN=mdtD PE=3 SV=1 90 410 1.0E-20
sp|Q1CK62|MDTD_YERPN Putative multidrug resistance protein MdtD OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=mdtD PE=3 SV=1 90 410 1.0E-20
sp|A9QZU7|MDTD_YERPG Putative multidrug resistance protein MdtD OS=Yersinia pestis bv. Antiqua (strain Angola) GN=mdtD PE=3 SV=1 90 410 1.0E-20
sp|Q7CJL1|MDTD_YERPE Putative multidrug resistance protein MdtD OS=Yersinia pestis GN=mdtD PE=3 SV=1 90 410 1.0E-20
sp|B2K9M2|MDTD_YERPB Putative multidrug resistance protein MdtD OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=mdtD PE=3 SV=1 90 410 1.0E-20
sp|Q1C5L8|MDTD_YERPA Putative multidrug resistance protein MdtD OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=mdtD PE=3 SV=1 90 410 1.0E-20
sp|A7FG15|MDTD_YERP3 Putative multidrug resistance protein MdtD OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=mdtD PE=3 SV=1 90 410 1.0E-20
sp|B7LV41|MDTD_ESCF3 Putative multidrug resistance protein MdtD OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=mdtD PE=3 SV=1 67 491 1.0E-20
sp|Q6D2A9|MDTD_PECAS Putative multidrug resistance protein MdtD OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=mdtD PE=3 SV=1 90 410 2.0E-20
sp|Q668C4|MDTD_YERPS Putative multidrug resistance protein MdtD OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=mdtD PE=3 SV=1 90 410 7.0E-20
sp|P52600|EMRY_ECOLI Probable multidrug resistance protein EmrY OS=Escherichia coli (strain K12) GN=emrY PE=2 SV=1 68 382 7.0E-20
sp|A1JKW8|MDTD_YERE8 Putative multidrug resistance protein MdtD OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=mdtD PE=3 SV=2 90 498 7.0E-20
sp|P9WJW9|Y2459_MYCTU Uncharacterized MFS-type transporter Rv2459 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv2459 PE=3 SV=1 80 490 1.0E-19
sp|P9WJW8|Y2459_MYCTO Uncharacterized MFS-type transporter MT2534 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT2534 PE=3 SV=1 80 490 1.0E-19
sp|Q870L3|MIRC_EMENI Siderophore iron transporter mirC OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=mirC PE=3 SV=1 41 573 2.0E-19
sp|P0A0J9|QACA_STAAU Antiseptic resistance protein OS=Staphylococcus aureus GN=qacA PE=1 SV=1 74 488 3.0E-19
sp|P0A0J8|QACA_STAAM Antiseptic resistance protein OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=qacA PE=3 SV=1 74 488 3.0E-19
sp|A9N7L0|MDTD_SALPB Putative multidrug resistance protein MdtD OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=mdtD PE=3 SV=1 85 419 3.0E-19
sp|Q0T353|MDTD_SHIF8 Putative multidrug resistance protein MdtD OS=Shigella flexneri serotype 5b (strain 8401) GN=mdtD PE=3 SV=2 67 491 8.0E-19
sp|B5YUD5|MDTD_ECO5E Putative multidrug resistance protein MdtD OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=mdtD PE=3 SV=1 67 491 1.0E-18
sp|Q8X7I3|MDTD_ECO57 Putative multidrug resistance protein MdtD OS=Escherichia coli O157:H7 GN=mdtD PE=3 SV=1 67 491 1.0E-18
sp|P44927|EMRB_HAEIN Multidrug export protein EmrB OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=emrB PE=3 SV=1 90 507 1.0E-18
sp|A8ACM0|MDTL_CITK8 Multidrug resistance protein MdtL OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=mdtL PE=3 SV=1 76 261 1.0E-18
sp|B7UTB5|MDTD_ECO27 Putative multidrug resistance protein MdtD OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=mdtD PE=3 SV=1 67 491 1.0E-18
sp|B2TYA6|MDTD_SHIB3 Putative multidrug resistance protein MdtD OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=mdtD PE=3 SV=1 67 491 1.0E-18
sp|P36554|MDTD_ECOLI Putative multidrug resistance protein MdtD OS=Escherichia coli (strain K12) GN=mdtD PE=1 SV=2 67 491 1.0E-18
sp|B1IYZ7|MDTD_ECOLC Putative multidrug resistance protein MdtD OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=mdtD PE=3 SV=1 67 491 1.0E-18
sp|A8A1U9|MDTD_ECOHS Putative multidrug resistance protein MdtD OS=Escherichia coli O9:H4 (strain HS) GN=mdtD PE=3 SV=1 67 491 1.0E-18
sp|B1X7H3|MDTD_ECODH Putative multidrug resistance protein MdtD OS=Escherichia coli (strain K12 / DH10B) GN=mdtD PE=3 SV=1 67 491 1.0E-18
sp|C4ZSG5|MDTD_ECOBW Putative multidrug resistance protein MdtD OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=mdtD PE=3 SV=1 67 491 1.0E-18
sp|B7NCB3|MDTD_ECOLU Putative multidrug resistance protein MdtD OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=mdtD PE=3 SV=1 67 491 2.0E-18
sp|B1LNW4|MDTD_ECOSM Putative multidrug resistance protein MdtD OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=mdtD PE=3 SV=1 67 491 2.0E-18
sp|B7M460|MDTD_ECO8A Putative multidrug resistance protein MdtD OS=Escherichia coli O8 (strain IAI1) GN=mdtD PE=3 SV=1 67 491 2.0E-18
sp|Q0TG13|MDTD_ECOL5 Putative multidrug resistance protein MdtD OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=mdtD PE=3 SV=1 67 491 2.0E-18
sp|Q3Z0C7|MDTD_SHISS Putative multidrug resistance protein MdtD OS=Shigella sonnei (strain Ss046) GN=mdtD PE=3 SV=1 90 491 2.0E-18
sp|Q83QZ0|MDTD_SHIFL Putative multidrug resistance protein MdtD OS=Shigella flexneri GN=mdtD PE=3 SV=1 67 491 2.0E-18
sp|B7L9V0|MDTD_ECO55 Putative multidrug resistance protein MdtD OS=Escherichia coli (strain 55989 / EAEC) GN=mdtD PE=3 SV=1 67 491 2.0E-18
sp|B6HYS2|MDTD_ECOSE Putative multidrug resistance protein MdtD OS=Escherichia coli (strain SE11) GN=mdtD PE=3 SV=1 67 491 2.0E-18
sp|Q1R9Z4|MDTD_ECOUT Putative multidrug resistance protein MdtD OS=Escherichia coli (strain UTI89 / UPEC) GN=mdtD PE=3 SV=1 67 491 2.0E-18
sp|B7ME89|MDTD_ECO45 Putative multidrug resistance protein MdtD OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=mdtD PE=3 SV=1 67 491 2.0E-18
sp|B7NQA9|MDTD_ECO7I Putative multidrug resistance protein MdtD OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=mdtD PE=3 SV=1 67 491 2.0E-18
sp|Q8FG02|MDTD_ECOL6 Putative multidrug resistance protein MdtD OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=mdtD PE=3 SV=1 67 491 2.0E-18
sp|P9WJY3|MFS55_MYCTU MFS-type drug efflux transporter P55 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv1410c PE=1 SV=1 86 421 3.0E-18
sp|P9WJY2|MFS55_MYCTO MFS-type drug efflux transporter P55 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT1454 PE=3 SV=1 86 421 3.0E-18
sp|C6DTH3|MFS55_MYCTK MFS-type drug efflux transporter P55 OS=Mycobacterium tuberculosis (strain KZN 1435 / MDR) GN=TBMG_02570 PE=3 SV=1 86 421 3.0E-18
sp|A5WM93|MFS55_MYCTF MFS-type drug efflux transporter P55 OS=Mycobacterium tuberculosis (strain F11) GN=TBFG_11439 PE=3 SV=1 86 421 3.0E-18
sp|A5U2B2|MFS55_MYCTA MFS-type drug efflux transporter P55 OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=MRA_1419 PE=3 SV=1 86 421 3.0E-18
sp|C1AN55|MFS55_MYCBT MFS-type drug efflux transporter P55 OS=Mycobacterium bovis (strain BCG / Tokyo 172 / ATCC 35737 / TMC 1019) GN=JTY_1446 PE=3 SV=1 86 421 3.0E-18
sp|A1KIJ9|MFS55_MYCBP MFS-type drug efflux transporter P55 OS=Mycobacterium bovis (strain BCG / Pasteur 1173P2) GN=BCG_1471c PE=1 SV=1 86 421 3.0E-18
sp|Q7U042|MFS55_MYCBO MFS-type drug efflux transporter P55 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=Mb1445c PE=3 SV=1 86 421 3.0E-18
sp|Q323D8|MDTD_SHIBS Putative multidrug resistance protein MdtD OS=Shigella boydii serotype 4 (strain Sb227) GN=mdtD PE=3 SV=1 67 491 4.0E-18
sp|Q9CCP7|MFS55_MYCLE MFS-type drug efflux transporter P55 OS=Mycobacterium leprae (strain TN) GN=ML0556 PE=3 SV=1 86 422 5.0E-18
sp|P46104|LMRA_STRLN Lincomycin resistance protein OS=Streptomyces lincolnensis GN=lmrA PE=3 SV=1 64 403 7.0E-18
sp|A7ZNQ0|MDTD_ECO24 Putative multidrug resistance protein MdtD OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=mdtD PE=3 SV=1 67 491 8.0E-18
sp|A1ACT2|MDTD_ECOK1 Putative multidrug resistance protein MdtD OS=Escherichia coli O1:K1 / APEC GN=mdtD PE=3 SV=1 67 491 8.0E-18
sp|B7MWZ0|MDTD_ECO81 Putative multidrug resistance protein MdtD OS=Escherichia coli O81 (strain ED1a) GN=mdtD PE=3 SV=1 67 491 1.0E-17
sp|A9MJT5|MDTL_SALAR Multidrug resistance protein MdtL OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=mdtL PE=3 SV=1 76 259 3.0E-17
sp|Q92EE1|LMRB_LISIN Lincomycin resistance protein LmrB OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=lmrB PE=3 SV=1 112 382 3.0E-17
sp|Q8Y9K8|LMRB_LISMO Lincomycin resistance protein LmrB OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=lmrB PE=3 SV=1 112 382 4.0E-17
sp|O94607|STR2_SCHPO Siderophore iron transporter 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=str2 PE=1 SV=1 24 562 6.0E-17
sp|P34698|Y5813_SACEN Uncharacterized MFS-type transporter SACE_5813 OS=Saccharopolyspora erythraea (strain ATCC 11635 / DSM 40517 / JCM 4748 / NBRC 13426 / NCIMB 8594 / NRRL 2338) GN=SACE_5813 PE=3 SV=2 59 446 2.0E-16
sp|A7MHI9|MDTD_CROS8 Putative multidrug resistance protein MdtD OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=mdtD PE=3 SV=1 67 410 2.0E-16
sp|Q8ZKY1|MDTL_SALTY Multidrug resistance protein MdtL OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=mdtL PE=3 SV=1 76 264 2.0E-16
sp|B5QUQ6|MDTL_SALEP Multidrug resistance protein MdtL OS=Salmonella enteritidis PT4 (strain P125109) GN=mdtL PE=3 SV=1 76 264 2.0E-16
sp|B5FN15|MDTL_SALDC Multidrug resistance protein MdtL OS=Salmonella dublin (strain CT_02021853) GN=mdtL PE=3 SV=1 76 264 2.0E-16
sp|B5BIM0|MDTL_SALPK Multidrug resistance protein MdtL OS=Salmonella paratyphi A (strain AKU_12601) GN=mdtL PE=3 SV=1 76 259 3.0E-16
sp|Q5PKV6|MDTL_SALPA Multidrug resistance protein MdtL OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=mdtL PE=3 SV=1 76 259 3.0E-16
sp|B4TAV4|MDTL_SALHS Multidrug resistance protein MdtL OS=Salmonella heidelberg (strain SL476) GN=mdtL PE=3 SV=1 76 266 4.0E-16
sp|O34502|YVKA_BACSU Uncharacterized MFS-type transporter YvkA OS=Bacillus subtilis (strain 168) GN=yvkA PE=3 SV=1 84 490 4.0E-16
sp|Q8Z2N9|MDTL_SALTI Multidrug resistance protein MdtL OS=Salmonella typhi GN=mdtL PE=3 SV=1 76 259 4.0E-16
sp|C0Q2L5|MDTL_SALPC Multidrug resistance protein MdtL OS=Salmonella paratyphi C (strain RKS4594) GN=mdtL PE=3 SV=1 76 264 5.0E-16
sp|Q57HZ5|MDTL_SALCH Multidrug resistance protein MdtL OS=Salmonella choleraesuis (strain SC-B67) GN=mdtL PE=3 SV=1 76 264 5.0E-16
sp|A9MX86|MDTL_SALPB Multidrug resistance protein MdtL OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=mdtL PE=3 SV=1 76 259 6.0E-16
sp|B4SYB3|MDTL_SALNS Multidrug resistance protein MdtL OS=Salmonella newport (strain SL254) GN=mdtL PE=3 SV=1 76 259 6.0E-16
sp|B5EYX7|MDTL_SALA4 Multidrug resistance protein MdtL OS=Salmonella agona (strain SL483) GN=mdtL PE=3 SV=1 76 259 6.0E-16
sp|B4TN12|MDTL_SALSV Multidrug resistance protein MdtL OS=Salmonella schwarzengrund (strain CVM19633) GN=mdtL PE=3 SV=1 76 259 6.0E-16
sp|Q0TAZ8|MDTL_ECOL5 Multidrug resistance protein MdtL OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=mdtL PE=3 SV=1 76 262 7.0E-16
sp|B7UMH7|MDTL_ECO27 Multidrug resistance protein MdtL OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=mdtL PE=3 SV=1 76 262 7.0E-16
sp|Q1R4M4|MDTL_ECOUT Multidrug resistance protein MdtL OS=Escherichia coli (strain UTI89 / UPEC) GN=mdtL PE=3 SV=1 76 262 9.0E-16
sp|A1AHP3|MDTL_ECOK1 Multidrug resistance protein MdtL OS=Escherichia coli O1:K1 / APEC GN=mdtL PE=3 SV=1 76 262 9.0E-16
sp|B7MGD1|MDTL_ECO45 Multidrug resistance protein MdtL OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=mdtL PE=3 SV=1 76 262 9.0E-16
sp|B7M562|MDTL_ECO8A Multidrug resistance protein MdtL OS=Escherichia coli O8 (strain IAI1) GN=mdtL PE=3 SV=1 76 262 1.0E-15
sp|A7ZTR5|MDTL_ECO24 Multidrug resistance protein MdtL OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=mdtL PE=3 SV=1 76 262 1.0E-15
sp|B1LL36|MDTL_ECOSM Multidrug resistance protein MdtL OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=mdtL PE=3 SV=1 76 262 1.0E-15
sp|B7NF27|MDTL_ECOLU Multidrug resistance protein MdtL OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=mdtL PE=3 SV=1 76 262 1.0E-15
sp|B7LK52|MDTL_ESCF3 Multidrug resistance protein MdtL OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=mdtL PE=3 SV=1 76 262 2.0E-15
sp|B7NR12|MDTL_ECO7I Multidrug resistance protein MdtL OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=mdtL PE=3 SV=1 76 262 2.0E-15
sp|Q83PL6|MDTL_SHIFL Multidrug resistance protein MdtL OS=Shigella flexneri GN=mdtL PE=3 SV=1 76 262 2.0E-15
sp|Q3YWK3|MDTL_SHISS Multidrug resistance protein MdtL OS=Shigella sonnei (strain Ss046) GN=mdtL PE=3 SV=1 76 262 2.0E-15
sp|Q31UW4|MDTL_SHIBS Multidrug resistance protein MdtL OS=Shigella boydii serotype 4 (strain Sb227) GN=mdtL PE=3 SV=1 76 262 2.0E-15
sp|B2TUR5|MDTL_SHIB3 Multidrug resistance protein MdtL OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=mdtL PE=3 SV=1 76 262 2.0E-15
sp|B1IX28|MDTL_ECOLC Multidrug resistance protein MdtL OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=mdtL PE=3 SV=1 76 262 2.0E-15
sp|A8A6H2|MDTL_ECOHS Multidrug resistance protein MdtL OS=Escherichia coli O9:H4 (strain HS) GN=mdtL PE=3 SV=1 76 262 2.0E-15
sp|B5XZP2|MDTL_KLEP3 Multidrug resistance protein MdtL OS=Klebsiella pneumoniae (strain 342) GN=mdtL PE=3 SV=1 87 259 2.0E-15
sp|Q328Z8|MDTL_SHIDS Multidrug resistance protein MdtL OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=mdtL PE=3 SV=1 76 262 2.0E-15
sp|B6I3U3|MDTL_ECOSE Multidrug resistance protein MdtL OS=Escherichia coli (strain SE11) GN=mdtL PE=3 SV=1 76 262 2.0E-15
sp|P31462|MDTL_ECOLI Multidrug resistance protein MdtL OS=Escherichia coli (strain K12) GN=mdtL PE=1 SV=2 76 262 2.0E-15
sp|B1X9T9|MDTL_ECODH Multidrug resistance protein MdtL OS=Escherichia coli (strain K12 / DH10B) GN=mdtL PE=3 SV=1 76 262 2.0E-15
sp|C4ZYY8|MDTL_ECOBW Multidrug resistance protein MdtL OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=mdtL PE=3 SV=1 76 262 2.0E-15
sp|B7L855|MDTL_ECO55 Multidrug resistance protein MdtL OS=Escherichia coli (strain 55989 / EAEC) GN=mdtL PE=3 SV=1 76 262 2.0E-15
sp|B5YXB4|MDTL_ECO5E Multidrug resistance protein MdtL OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=mdtL PE=3 SV=1 76 262 3.0E-15
sp|Q8XB24|MDTL_ECO57 Multidrug resistance protein MdtL OS=Escherichia coli O157:H7 GN=mdtL PE=3 SV=1 76 262 3.0E-15
sp|Q870L2|MIRB_EMENI Siderophore iron transporter mirB OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=mirB PE=3 SV=1 127 575 3.0E-15
sp|A6TG19|MDTL_KLEP7 Multidrug resistance protein MdtL OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=mdtL PE=3 SV=1 87 277 3.0E-15
sp|Q0SYP9|MDTL_SHIF8 Multidrug resistance protein MdtL OS=Shigella flexneri serotype 5b (strain 8401) GN=mdtL PE=3 SV=1 76 262 4.0E-15
sp|Q8FBV0|MDTL_ECOL6 Multidrug resistance protein MdtL OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=mdtL PE=3 SV=1 76 262 4.0E-15
sp|B7N2F5|MDTL_ECO81 Multidrug resistance protein MdtL OS=Escherichia coli O81 (strain ED1a) GN=mdtL PE=3 SV=1 76 262 4.0E-15
sp|Q03263|YM8M_YEAST Uncharacterized transporter YMR279C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YMR279C PE=1 SV=1 50 503 6.0E-15
sp|P0A4K6|TCR_STREE Tetracycline resistance protein OS=Streptococcus pneumoniae GN=tet PE=3 SV=1 73 264 1.0E-14
sp|P0A4K8|TCR_BACIU Tetracycline resistance protein OS=Bacillus subtilis GN=tet PE=3 SV=1 73 264 1.0E-14
sp|P0A4K7|TCR_BACCE Tetracycline resistance protein OS=Bacillus cereus GN=tet PE=3 SV=1 73 264 1.0E-14
sp|P07561|TCR_GEOSE Tetracycline resistance protein OS=Geobacillus stearothermophilus GN=tet PE=3 SV=1 73 264 1.0E-14
sp|P62967|TCR_STAES Tetracycline resistance protein OS=Staphylococcus epidermidis (strain ATCC 12228) GN=tet PE=3 SV=1 81 267 1.0E-14
sp|P02983|TCR_STAAU Tetracycline resistance protein OS=Staphylococcus aureus GN=tet PE=3 SV=3 81 267 1.0E-14
sp|Q08902|YO378_YEAST Drug resistance protein YOR378W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YOR378W PE=1 SV=1 34 490 4.0E-14
sp|Q8X1Z7|MIRA_EMENI Siderophore iron transporter mirA OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=mirA PE=3 SV=1 89 525 5.0E-14
sp|P36890|TCR_STAHY Tetracycline resistance protein OS=Staphylococcus hyicus GN=tet PE=3 SV=1 73 234 1.0E-13
sp|P13924|TCR_STRAG Tetracycline resistance protein OS=Streptococcus agalactiae GN=tet PE=3 SV=1 73 264 1.0E-13
sp|P23054|TCRB_BACSU Tetracycline resistance protein OS=Bacillus subtilis (strain 168) GN=tetB PE=3 SV=1 81 286 2.0E-13
sp|Q87FV4|MDTL_VIBPA Multidrug resistance protein MdtL OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=mdtL PE=3 SV=1 87 266 8.0E-13
sp|P13090|ATR1_YEAST Aminotriazole resistance protein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ATR1 PE=1 SV=2 33 341 1.0E-12
sp|P94574|YWOD_BACSU Uncharacterized MFS-type transporter YwoD OS=Bacillus subtilis (strain 168) GN=ywoD PE=3 SV=1 91 499 1.0E-12
sp|Q9P6J7|YHD3_SCHPO Uncharacterized MFS-type transporter C1683.03c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1683.03c PE=3 SV=1 118 503 5.0E-12
sp|P45123|BCR_HAEIN Bicyclomycin resistance protein homolog OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=bcr PE=3 SV=1 134 273 5.0E-11
sp|Q08299|ENB1_YEAST Siderophore iron transporter ENB1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ENB1 PE=1 SV=1 84 589 1.0E-10
sp|P37594|SMVA_SALTY Methyl viologen resistance protein SmvA OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=smvA PE=3 SV=2 93 419 3.0E-10
sp|D0ZXQ3|SMVA_SALT1 Methyl viologen resistance protein SmvA OS=Salmonella typhimurium (strain 14028s / SGSC 2262) GN=smvA PE=1 SV=1 93 419 3.0E-10
sp|P9WJX3|Y1634_MYCTU Probable multidrug-efflux transporter Rv1634 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv1634 PE=1 SV=1 68 236 4.0E-10
sp|P9WJX2|Y1634_MYCTO Probable multidrug-efflux transporter MT1670 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT1670 PE=3 SV=1 68 236 4.0E-10
sp|Q8EA87|MDTL_SHEON Multidrug resistance protein MdtL OS=Shewanella oneidensis (strain MR-1) GN=mdtL PE=3 SV=1 94 256 4.0E-10
sp|P96709|YDGK_BACSU Uncharacterized MFS-type transporter YdgK OS=Bacillus subtilis (strain 168) GN=ydgK PE=3 SV=1 71 278 5.0E-10
sp|Q04733|CMCT_AMYLA Cephamycin export protein CmcT OS=Amycolatopsis lactamdurans GN=cmcT PE=3 SV=1 86 392 5.0E-10
sp|P32369|BAIG_CLOSV Bile acid transporter OS=Clostridium scindens (strain JCM 10418 / VPI 12708) GN=baiG PE=3 SV=2 118 300 6.0E-10
sp|A0L190|MDTL_SHESA Multidrug resistance protein MdtL OS=Shewanella sp. (strain ANA-3) GN=mdtL PE=3 SV=1 94 255 7.0E-10
sp|O59814|YCT4_SCHPO Uncharacterized transporter C794.04c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC794.04c PE=3 SV=1 19 261 8.0E-10
sp|Q92341|STR3_SCHPO Siderophore iron transporter 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=str3 PE=1 SV=1 132 507 2.0E-09
sp|P38731|ARN1_YEAST Siderophore iron transporter ARN1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ARN1 PE=1 SV=1 134 498 3.0E-09
sp|Q9P3V5|YI45_SCHPO Uncharacterized transporter C1348.05 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1348.05 PE=3 SV=1 44 331 4.0E-09
sp|Q9P3E8|YLZ2_SCHPO Uncharacterized transporter C750.02c/PB2B2.16c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC750.02c PE=3 SV=1 44 331 4.0E-09
sp|O34307|YVMA_BACSU Uncharacterized MFS-type transporter YvmA OS=Bacillus subtilis (strain 168) GN=yvmA PE=3 SV=1 72 251 5.0E-09
sp|P53943|AQR1_YEAST Probable transporter AQR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AQR1 PE=1 SV=1 41 261 7.0E-09
sp|Q12256|TPO4_YEAST Polyamine transporter 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPO4 PE=1 SV=1 42 258 9.0E-09
sp|Q10084|MFS2_SCHPO Uncharacterized transporter mfs2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mfs2 PE=3 SV=1 44 254 1.0E-08
sp|P39980|SIT1_YEAST Siderophore iron transporter 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SIT1 PE=3 SV=1 51 602 1.0E-08
sp|P39637|YWFA_BACSU Uncharacterized MFS-type transporter YwfA OS=Bacillus subtilis (strain 168) GN=ywfA PE=3 SV=1 80 238 2.0E-08
sp|P02980|TCR2_ECOLX Tetracycline resistance protein, class B OS=Escherichia coli GN=tetA PE=1 SV=1 123 255 4.0E-08
sp|P0AE24|ARAE_ECOLI Arabinose-proton symporter OS=Escherichia coli (strain K12) GN=araE PE=1 SV=1 57 266 4.0E-08
sp|P0AE25|ARAE_ECO57 Arabinose-proton symporter OS=Escherichia coli O157:H7 GN=araE PE=3 SV=1 57 266 4.0E-08
sp|P28246|BCR_ECOLI Bicyclomycin resistance protein OS=Escherichia coli (strain K12) GN=bcr PE=1 SV=4 77 265 4.0E-08
sp|O74829|YN2F_SCHPO Uncharacterized MFS-type transporter C530.15c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC530.15c PE=1 SV=2 66 261 5.0E-08
sp|Q59YT1|QDR2_CANAL MFS antiporter QDR2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=QDR2 PE=3 SV=1 59 254 9.0E-08
sp|Q9HDX4|MFC1_SCHPO Uncharacterized transporter mfc1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mfc1 PE=3 SV=2 30 266 9.0E-08
sp|O32084|YUBD_BACSU Uncharacterized MFS-type transporter YubD OS=Bacillus subtilis (strain 168) GN=yubD PE=3 SV=1 124 331 1.0E-07
sp|P37597|YDHC_ECOLI Inner membrane transport protein YdhC OS=Escherichia coli (strain K12) GN=ydhC PE=1 SV=3 77 285 1.0E-07
sp|O59700|YN43_SCHPO Uncharacterized transporter C36.03c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC36.03c PE=3 SV=1 121 265 1.0E-07
sp|P25596|GEX1_YEAST Glutathione exchanger 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GEX1 PE=1 SV=4 134 603 1.0E-07
sp|P0AEP1|GALP_ECOLI Galactose-proton symporter OS=Escherichia coli (strain K12) GN=galP PE=1 SV=1 66 234 2.0E-07
sp|P0AEP2|GALP_ECOL6 Galactose-proton symporter OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=galP PE=3 SV=1 66 234 2.0E-07
sp|P32482|CMLA_PSEAI Chloramphenicol resistance protein OS=Pseudomonas aeruginosa GN=cmlA PE=3 SV=2 90 236 2.0E-07
sp|P36173|GEX2_YEAST Glutathione exchanger 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GEX2 PE=1 SV=1 134 603 2.0E-07
sp|P77726|YAJR_ECOLI Inner membrane transport protein YajR OS=Escherichia coli (strain K12) GN=yajR PE=1 SV=2 123 254 3.0E-07
sp|O59833|YCUD_SCHPO Uncharacterized transporter C965.13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC965.13 PE=3 SV=1 3 251 3.0E-07
sp|P46333|CSBC_BACSU Probable metabolite transport protein CsbC OS=Bacillus subtilis (strain 168) GN=csbC PE=1 SV=3 135 266 4.0E-07
sp|Q04602|VBA4_YEAST Vacuolar basic amino acid transporter 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VBA4 PE=1 SV=1 84 251 5.0E-07
sp|P33532|BSU1_SCHPO Vitamin B6 transporter bsu1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=bsu1 PE=3 SV=2 135 251 6.0E-07
sp|P45598|ARAE_KLEOX Arabinose-proton symporter OS=Klebsiella oxytoca GN=araE PE=3 SV=1 56 266 1.0E-06
sp|Q9USN4|YJA1_SCHPO Uncharacterized transporter C1529.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1529.01 PE=3 SV=2 38 261 1.0E-06
sp|P14551|TCR_STRRM Tetracycline resistance determinant OS=Streptomyces rimosus GN=tetB PE=3 SV=1 298 579 1.0E-06
sp|Q07282|TCR5_ECOLX Tetracycline resistance protein, class E OS=Escherichia coli GN=tetA PE=3 SV=1 81 326 2.0E-06
sp|O59699|YN42_SCHPO Uncharacterized transporter C36.02c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC36.02c PE=3 SV=1 30 250 3.0E-06
sp|Q9D2V8|MFS10_MOUSE Major facilitator superfamily domain-containing protein 10 OS=Mus musculus GN=Mfsd10 PE=1 SV=1 100 232 3.0E-06
sp|P38227|QDR3_YEAST Quinidine resistance protein 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=QDR3 PE=1 SV=2 80 265 4.0E-06
sp|P40474|QDR2_YEAST Quinidine resistance protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=QDR2 PE=1 SV=1 33 237 4.0E-06
sp|Q5HHX4|NORA_STAAC Quinolone resistance protein NorA OS=Staphylococcus aureus (strain COL) GN=norA PE=3 SV=1 121 290 6.0E-06
sp|Q6GIU7|NORA_STAAR Quinolone resistance protein NorA OS=Staphylococcus aureus (strain MRSA252) GN=norA PE=3 SV=1 121 272 6.0E-06
sp|Q1RI77|BCRH_RICBR Uncharacterized transporter RBE_0856 OS=Rickettsia bellii (strain RML369-C) GN=RBE_0856 PE=3 SV=1 83 265 6.0E-06
sp|P0A0J6|NORA_STAAW Quinolone resistance protein NorA OS=Staphylococcus aureus (strain MW2) GN=norA PE=3 SV=1 121 290 6.0E-06
sp|P0A0J7|NORA_STAAU Quinolone resistance protein NorA OS=Staphylococcus aureus GN=norA PE=3 SV=1 121 290 6.0E-06
sp|P0A0J5|NORA_STAAN Quinolone resistance protein NorA OS=Staphylococcus aureus (strain N315) GN=norA PE=3 SV=1 121 290 6.0E-06
sp|P0A0J4|NORA_STAAM Quinolone resistance protein NorA OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=norA PE=3 SV=1 121 290 6.0E-06
sp|Q6GBD5|NORA_STAAS Quinolone resistance protein NorA OS=Staphylococcus aureus (strain MSSA476) GN=norA PE=3 SV=1 121 272 7.0E-06
sp|Q8XB84|MDTM_ECO57 Multidrug resistance protein MdtM OS=Escherichia coli O157:H7 GN=mdtM PE=3 SV=1 83 268 7.0E-06
sp|O74899|YQEH_SCHPO Uncharacterized transporter C576.17c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC576.17c PE=1 SV=1 4 252 8.0E-06
sp|Q9I6Q3|PCAK_PSEAE 4-hydroxybenzoate transporter PcaK OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=pcaK PE=3 SV=1 58 219 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0016021 integral component of membrane Yes
GO:0055085 transmembrane transport Yes
GO:0022857 transmembrane transporter activity Yes
GO:0031224 intrinsic component of membrane No
GO:0008150 biological_process No
GO:0006810 transport No
GO:0051179 localization No
GO:0003674 molecular_function No
GO:0051234 establishment of localization No
GO:0044425 membrane part No
GO:0005575 cellular_component No
GO:0005215 transporter activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 19 0.45

Transmembrane Domains

Domain # Start End Length
1 79 101 22
2 116 138 22
3 145 167 22
4 171 193 22
5 205 227 22
6 232 254 22
7 266 288 22
8 298 320 22
9 341 363 22
10 378 397 19
11 402 424 22
12 434 456 22
13 469 491 22
14 549 566 17

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|9013
MATVAAEPIPPASRVVSADTIDAEHGAAIDRVFKAVSQQPLQPNDSNTGDDDSLSTTVDAEAPAQPDAPEKGRTN
LETFLVMLALCIALFLAALDMTIIATAIPAISSHFNSSIGYVWIGSAYLLGNATFVPTWGKISDIFGRKPVLISA
VVIFWIGSLLCAVSNSMGMLIAARAIQGVGGGGTIILPNICVSDLFSMRRRSLYFGILGCVWALASAIGPVLGGL
FTTKVSWRWCFYINLPLGGVGIIILVFMLKLHNPRTPVRQGLVAIDWLGSLLVIGGTLMFLFGLEFGGSQLPWSS
PTVICLLLFGVVAVVLFALYEAFVAKFPLMPVSLFRHRTSIAAFAIAFLHAFTFMSGSYWLPLYFQAVMGASPLM
SGVYLLPFVLSLSTVSVATGIIIKKTGNYKIIISAGLCIMTLGFGLFIGLGDDRVWAKIIIFQIIAGIGVGPNFQ
SPLLALQTNVEPRDIGAATASFGFLRQLGTSVSVAVGGVVFNNEMQKQHDFLQRSLGRKLAGKFGGATAATSVQV
VSTLQPGPRLVVQHAYWNAVQKMYIVYTVFIFAGFLVSFFIKQKQLSKTHTEHKTGLTSLKHRTEDNNGQDASFS
EKR*
Coding >Hirsu2|9013
ATGGCGACGGTCGCAGCAGAACCGATCCCTCCCGCTTCCCGTGTCGTCTCGGCCGACACGATAGATGCCGAGCAT
GGAGCCGCCATCGATCGCGTCTTCAAGGCCGTCAGCCAGCAGCCGCTCCAACCGAATGACAGCAACACAGGCGAT
GACGACTCCTTGTCGACGACGGTCGATGCCGAGGCGCCGGCCCAGCCCGACGCGCCCGAGAAGGGGCGCACCAAC
CTCGAGACCTTCCTCGTCATGCTCGCCCTGTGCATCGCCCTCTTCCTCGCCGCCCTCGACATGACCATCATCGCC
ACCGCCATCCCCGCCATCTCGAGCCACTTCAACTCGAGCATCGGCTACGTCTGGATCGGCAGCGCCTACCTCTTG
GGCAATGCCACCTTCGTCCCGACCTGGGGCAAGATCTCGGACATCTTCGGCCGCAAGCCTGTCCTCATCAGTGCC
GTCGTCATCTTCTGGATCGGCTCCCTGCTCTGCGCCGTCAGCAACAGCATGGGCATGCTCATCGCCGCCCGCGCC
ATCCAGGGCGTCGGCGGCGGCGGCACCATCATCCTGCCCAACATCTGCGTCTCCGACCTCTTCTCCATGCGCCGC
CGCAGCCTCTACTTTGGCATCCTCGGCTGCGTCTGGGCCCTCGCCTCCGCCATCGGGCCCGTCCTCGGAGGCCTC
TTCACCACTAAGGTCTCGTGGCGCTGGTGCTTCTACATCAATCTGCCCCTCGGCGGCGTCGGCATCATCATCCTC
GTCTTCATGCTCAAGCTCCATAACCCGCGCACCCCCGTCCGCCAGGGCCTCGTCGCCATCGACTGGCTCGGCAGC
CTCCTCGTCATCGGCGGCACCCTCATGTTCCTCTTCGGCCTCGAGTTCGGCGGCAGCCAGCTCCCATGGAGCTCT
CCCACCGTCATCTGTCTCCTCCTCTTCGGCGTCGTCGCCGTCGTCCTCTTCGCCCTCTACGAGGCCTTCGTCGCC
AAGTTCCCCCTCATGCCCGTTTCCCTCTTCCGCCACCGGACCAGCATCGCCGCCTTCGCCATCGCCTTCCTCCAT
GCCTTCACCTTTATGAGCGGCAGCTACTGGCTGCCGCTTTACTTCCAGGCCGTCATGGGCGCCTCCCCGCTCATG
TCCGGCGTATACCTCCTGCCCTTTGTCCTCTCCCTCTCCACCGTCTCCGTCGCGACCGGCATCATCATCAAGAAG
ACGGGCAACTACAAGATCATCATCTCGGCCGGCCTCTGCATCATGACGCTCGGCTTCGGCCTGTTCATCGGCCTG
GGCGACGACAGGGTCTGGGCCAAGATCATCATCTTTCAGATCATCGCCGGCATCGGCGTCGGCCCCAATTTCCAG
TCGCCTCTCCTCGCGCTGCAGACCAACGTCGAGCCCCGCGACATCGGCGCCGCCACCGCGAGCTTCGGCTTCCTC
CGCCAGCTCGGCACCTCCGTCTCCGTTGCCGTCGGCGGCGTCGTATTCAATAATGAGATGCAGAAGCAGCACGAC
TTCCTTCAACGCAGCCTCGGGCGCAAACTGGCCGGCAAGTTTGGCGGCGCCACCGCCGCCACCAGCGTCCAGGTC
GTCAGCACCCTCCAGCCCGGACCCCGCCTCGTCGTCCAGCACGCCTATTGGAACGCGGTGCAGAAGATGTACATT
GTCTACACCGTCTTCATCTTCGCCGGCTTTCTCGTCAGCTTCTTCATCAAACAGAAGCAGCTGAGCAAGACTCAC
ACGGAGCACAAGACGGGGCTGACCAGTCTCAAGCACCGCACGGAAGACAACAATGGCCAAGACGCCAGCTTCAGC
GAAAAGCGATGA
Transcript >Hirsu2|9013
ATGGCGACGGTCGCAGCAGAACCGATCCCTCCCGCTTCCCGTGTCGTCTCGGCCGACACGATAGATGCCGAGCAT
GGAGCCGCCATCGATCGCGTCTTCAAGGCCGTCAGCCAGCAGCCGCTCCAACCGAATGACAGCAACACAGGCGAT
GACGACTCCTTGTCGACGACGGTCGATGCCGAGGCGCCGGCCCAGCCCGACGCGCCCGAGAAGGGGCGCACCAAC
CTCGAGACCTTCCTCGTCATGCTCGCCCTGTGCATCGCCCTCTTCCTCGCCGCCCTCGACATGACCATCATCGCC
ACCGCCATCCCCGCCATCTCGAGCCACTTCAACTCGAGCATCGGCTACGTCTGGATCGGCAGCGCCTACCTCTTG
GGCAATGCCACCTTCGTCCCGACCTGGGGCAAGATCTCGGACATCTTCGGCCGCAAGCCTGTCCTCATCAGTGCC
GTCGTCATCTTCTGGATCGGCTCCCTGCTCTGCGCCGTCAGCAACAGCATGGGCATGCTCATCGCCGCCCGCGCC
ATCCAGGGCGTCGGCGGCGGCGGCACCATCATCCTGCCCAACATCTGCGTCTCCGACCTCTTCTCCATGCGCCGC
CGCAGCCTCTACTTTGGCATCCTCGGCTGCGTCTGGGCCCTCGCCTCCGCCATCGGGCCCGTCCTCGGAGGCCTC
TTCACCACTAAGGTCTCGTGGCGCTGGTGCTTCTACATCAATCTGCCCCTCGGCGGCGTCGGCATCATCATCCTC
GTCTTCATGCTCAAGCTCCATAACCCGCGCACCCCCGTCCGCCAGGGCCTCGTCGCCATCGACTGGCTCGGCAGC
CTCCTCGTCATCGGCGGCACCCTCATGTTCCTCTTCGGCCTCGAGTTCGGCGGCAGCCAGCTCCCATGGAGCTCT
CCCACCGTCATCTGTCTCCTCCTCTTCGGCGTCGTCGCCGTCGTCCTCTTCGCCCTCTACGAGGCCTTCGTCGCC
AAGTTCCCCCTCATGCCCGTTTCCCTCTTCCGCCACCGGACCAGCATCGCCGCCTTCGCCATCGCCTTCCTCCAT
GCCTTCACCTTTATGAGCGGCAGCTACTGGCTGCCGCTTTACTTCCAGGCCGTCATGGGCGCCTCCCCGCTCATG
TCCGGCGTATACCTCCTGCCCTTTGTCCTCTCCCTCTCCACCGTCTCCGTCGCGACCGGCATCATCATCAAGAAG
ACGGGCAACTACAAGATCATCATCTCGGCCGGCCTCTGCATCATGACGCTCGGCTTCGGCCTGTTCATCGGCCTG
GGCGACGACAGGGTCTGGGCCAAGATCATCATCTTTCAGATCATCGCCGGCATCGGCGTCGGCCCCAATTTCCAG
TCGCCTCTCCTCGCGCTGCAGACCAACGTCGAGCCCCGCGACATCGGCGCCGCCACCGCGAGCTTCGGCTTCCTC
CGCCAGCTCGGCACCTCCGTCTCCGTTGCCGTCGGCGGCGTCGTATTCAATAATGAGATGCAGAAGCAGCACGAC
TTCCTTCAACGCAGCCTCGGGCGCAAACTGGCCGGCAAGTTTGGCGGCGCCACCGCCGCCACCAGCGTCCAGGTC
GTCAGCACCCTCCAGCCCGGACCCCGCCTCGTCGTCCAGCACGCCTATTGGAACGCGGTGCAGAAGATGTACATT
GTCTACACCGTCTTCATCTTCGCCGGCTTTCTCGTCAGCTTCTTCATCAAACAGAAGCAGCTGAGCAAGACTCAC
ACGGAGCACAAGACGGGGCTGACCAGTCTCAAGCACCGCACGGAAGACAACAATGGCCAAGACGCCAGCTTCAGC
GAAAAGCGATGA
Gene >Hirsu2|9013
ATGGCGACGGTCGCAGCAGAACCGATCCCTCCCGCTTCCCGTGTCGTCTCGGCCGACACGATAGATGCCGAGCAT
GGAGCCGCCATCGATCGCGTCTTCAAGGCCGTCAGCCAGCAGCCGCTCCAACCGAATGACAGCAACACAGGCGAT
GACGACTCCTTGTCGACGACGGTCGATGCCGAGGCGCCGGCCCAGCCCGACGCGCCCGAGAAGGGGCGCACCAAC
CTCGAGACCTTCCTCGTCATGCTCGCCCTGTGCATCGCCCTCTTCCTCGCCGCCCTCGACATGACCATCATCGCC
ACCGCCATCCCCGCCATCTCGAGCCACTTCAACTCGAGCATCGGCTACGTCTGGATCGGCAGCGCCTACCTCTTG
GGCAATGCCACCTTCGTCCCGACCTGGGGCAAGATCTCGGACATCTTCGGCCGCAAGCCTGTCCTCATCAGTGCC
GTCGTCATCTTCTGGATCGGCTCCCTGCTCTGCGCCGTCAGCAACAGCATGGGCATGCTCATCGCCGCCCGCGCC
ATCCAGGGCGTCGGCGGCGGCGGCACCATCATCCTGCCCAACATCTGCGTCTCCGACCTCTTCTCCATGCGCCGC
CGCAGCCTCTACTTTGGCATCCTCGGCTGCGTCTGGGCCCTCGCCTCCGCCATCGGGCCCGTCCTCGGAGGCCTC
TTCACCACTAAGGTCTCGTGGCGCTGGTGCTTCTACATCAATCTGCCCCTCGGCGGCGTCGGCATCATCATCCTC
GTCTTCATGCTCAAGCTCCATAACCCGCGCACCCCCGTCCGCCAGGGCCTCGTCGCCATCGACTGGCTCGGCAGC
CTCCTCGTCATCGGCGGCACCCTCATGTTCCTCTTCGGCCTCGAGTTCGGCGGCAGCCAGCTCCCATGGAGCTCT
CCCACCGTCATCTGTCTCCTCCTCTTCGGCGTCGTCGCCGTCGTCCTCTTCGCCCTCTACGAGGCCTTCGTCGCC
AAGTTCCCCCTCATGCCCGTTTCCCTCTTCCGCCACCGGACCAGCATCGCCGCCTTCGCCATCGCCTTCCTCCAT
GCCTTCACCTTTATGAGCGGCAGCTACTGGCTGCCGCTTTACTTCCAGGCCGTCATGGGCGCCTCCCCGCTCATG
TCCGGCGTATACCTCCTGCCCTTTGTCCTCTCCCTCTCCACCGTCTCCGTCGCGACCGGCATCATCATCAAGAAG
ACGGGCAACTACAAGATCATCATCTCGGCCGGCCTCTGCATCATGACGCTCGGCTTCGGCCTGTTCATCGGCCTG
GGCGACGACAGGGTCTGGGCCAAGATCATCATCTTTCAGATCATCGCCGGCATCGGCGTCGGCCCCAATTTCCAG
TCGCCTCTCCTCGCGCTGCAGACCAACGTCGAGCCCCGCGACATCGGCGCCGCCACCGCGAGCTTCGGCTTCCTC
CGCCAGCTCGGCACCTCCGTCTCCGTTGCCGTCGGCGGCGTCGTATTCAATAATGAGATGCAGAAGCAGCACGAC
TTCCTTCAACGCAGCCTCGGGCGCAAACTGGCCGGCAAGTTTGGCGGCGCCACCGCCGCCACCAGCGTCCAGGTC
GTCAGCACCCTCCAGCCCGGACCCCGCCTCGTCGTCCAGCACGCCTATTGGAACGCGGTGCAGAAGATGTACATT
GTCTACACCGTCTTCATCTTCGCCGGCTTTCTCGTCAGCTTCTTCATCAAACAGAAGCAGCTGAGCAAGACTCAC
ACGGAGCACAAGACGGGGCTGACCAGTCTCAAGCACCGCACGGAAGACAACAATGGCCAAGACGCCAGCTTCAGC
GAAAAGCGATGA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail