Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|9012
Gene name
LocationContig_626:441..4187
Strand-
Gene length (bp)3746
Transcript length (bp)3555
Coding sequence length (bp)3555
Protein length (aa) 1185

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00225 Kinesin Kinesin motor domain 2.1E-110 75 407
PF16796 Microtub_bd Microtubule binding 2.9E-25 69 219
PF13931 Microtub_bind Kinesin-associated microtubule-binding 4.2E-06 988 1019

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P17120|BIMC_EMENI Kinesin-like protein bimC OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=bimC PE=2 SV=2 23 1018 0.0E+00
sp|P24339|CUT7_SCHPO Kinesin-like protein cut7 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cut7 PE=3 SV=3 67 1000 1.0E-166
sp|Q8J1G4|KIP1_ASHGO Kinesin-like protein KIP1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=KIP1 PE=3 SV=1 40 574 2.0E-148
sp|B2GU58|KIF11_XENTR Kinesin-like protein KIF11 OS=Xenopus tropicalis GN=kif11 PE=2 SV=1 69 750 2.0E-144
sp|P28025|KI11B_XENLA Kinesin-like protein KIF11-B OS=Xenopus laevis GN=kif11-b PE=1 SV=2 69 636 8.0E-143
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P17120|BIMC_EMENI Kinesin-like protein bimC OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=bimC PE=2 SV=2 23 1018 0.0E+00
sp|P24339|CUT7_SCHPO Kinesin-like protein cut7 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cut7 PE=3 SV=3 67 1000 1.0E-166
sp|Q8J1G4|KIP1_ASHGO Kinesin-like protein KIP1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=KIP1 PE=3 SV=1 40 574 2.0E-148
sp|B2GU58|KIF11_XENTR Kinesin-like protein KIF11 OS=Xenopus tropicalis GN=kif11 PE=2 SV=1 69 750 2.0E-144
sp|P28025|KI11B_XENLA Kinesin-like protein KIF11-B OS=Xenopus laevis GN=kif11-b PE=1 SV=2 69 636 8.0E-143
sp|P28742|KIP1_YEAST Kinesin-like protein KIP1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KIP1 PE=1 SV=1 7 488 2.0E-140
sp|Q8J1G7|CIN8_ASHGO Kinesin-like protein CIN8 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=CIN8 PE=3 SV=1 54 1000 1.0E-133
sp|Q6P9P6|KIF11_MOUSE Kinesin-like protein KIF11 OS=Mus musculus GN=Kif11 PE=1 SV=1 69 575 4.0E-131
sp|O23826|K125_TOBAC 125 kDa kinesin-related protein OS=Nicotiana tabacum GN=TKRP125 PE=1 SV=1 68 1019 7.0E-130
sp|P82266|K125_ARATH Probable 125 kDa kinesin-related protein OS=Arabidopsis thaliana GN=At2g36200 PE=2 SV=2 60 620 9.0E-129
sp|P46863|KL61_DROME Bipolar kinesin KRP-130 OS=Drosophila melanogaster GN=Klp61F PE=1 SV=2 69 611 5.0E-122
sp|P46874|KLP2_BOMMO Kinesin-like protein KLP2 (Fragment) OS=Bombyx mori PE=2 SV=1 69 408 1.0E-102
sp|Q6RZZ9|KIF13_DICDI Kinesin-related protein 13 OS=Dictyostelium discoideum GN=kif13 PE=1 SV=1 61 495 3.0E-88
sp|Q9Y496|KIF3A_HUMAN Kinesin-like protein KIF3A OS=Homo sapiens GN=KIF3A PE=1 SV=4 69 437 9.0E-83
sp|Q5R4H3|KIF3A_PONAB Kinesin-like protein KIF3A OS=Pongo abelii GN=KIF3A PE=2 SV=1 69 437 1.0E-82
sp|Q4R628|KIF3A_MACFA Kinesin-like protein KIF3A OS=Macaca fascicularis GN=KIF3A PE=2 SV=1 69 437 1.0E-82
sp|P28741|KIF3A_MOUSE Kinesin-like protein KIF3A OS=Mus musculus GN=Kif3a PE=1 SV=2 69 437 4.0E-82
sp|P46872|KRP85_STRPU Kinesin-II 85 kDa subunit OS=Strongylocentrotus purpuratus GN=KRP85 PE=1 SV=1 69 437 3.0E-81
sp|Q61771|KIF3B_MOUSE Kinesin-like protein KIF3B OS=Mus musculus GN=Kif3b PE=1 SV=1 69 437 5.0E-79
sp|O15066|KIF3B_HUMAN Kinesin-like protein KIF3B OS=Homo sapiens GN=KIF3B PE=1 SV=1 69 437 9.0E-79
sp|P27895|CIN8_YEAST Kinesin-like protein CIN8 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CIN8 PE=1 SV=3 240 893 4.0E-78
sp|P46869|FLA10_CHLRE Kinesin-like protein FLA10 OS=Chlamydomonas reinhardtii GN=FLA10 PE=1 SV=1 63 437 6.0E-78
sp|Q99PW8|KIF17_MOUSE Kinesin-like protein KIF17 OS=Mus musculus GN=Kif17 PE=1 SV=1 69 437 1.0E-77
sp|P46871|KRP95_STRPU Kinesin-II 95 kDa subunit OS=Strongylocentrotus purpuratus GN=KRP95 PE=1 SV=1 70 437 4.0E-77
sp|Q9P2E2|KIF17_HUMAN Kinesin-like protein KIF17 OS=Homo sapiens GN=KIF17 PE=2 SV=3 70 437 5.0E-77
sp|P46873|OSM3_CAEEL Osmotic avoidance abnormal protein 3 OS=Caenorhabditis elegans GN=osm-3 PE=2 SV=4 70 435 3.0E-75
sp|Q6FXI5|CIN8_CANGA Kinesin-like protein CIN8 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=CIN8 PE=3 SV=1 239 477 3.0E-74
sp|O14782|KIF3C_HUMAN Kinesin-like protein KIF3C OS=Homo sapiens GN=KIF3C PE=1 SV=3 70 437 3.0E-72
sp|A0JN40|KIF3C_BOVIN Kinesin-like protein KIF3C OS=Bos taurus GN=KIF3C PE=2 SV=1 70 437 6.0E-72
sp|Q5R706|KIF3C_PONAB Kinesin-like protein KIF3C OS=Pongo abelii GN=KIF3C PE=2 SV=1 70 437 2.0E-71
sp|O35066|KIF3C_MOUSE Kinesin-like protein KIF3C OS=Mus musculus GN=Kif3c PE=1 SV=3 70 437 3.0E-71
sp|O55165|KIF3C_RAT Kinesin-like protein KIF3C OS=Rattus norvegicus GN=Kif3c PE=2 SV=1 70 437 3.0E-71
sp|Q29DY1|KLP68_DROPS Kinesin-like protein Klp68D OS=Drosophila pseudoobscura pseudoobscura GN=Klp68D PE=3 SV=1 70 443 7.0E-71
sp|P46867|KLP68_DROME Kinesin-like protein Klp68D OS=Drosophila melanogaster GN=Klp68D PE=2 SV=2 70 443 1.0E-70
sp|O43093|KINH_SYNRA Kinesin heavy chain OS=Syncephalastrum racemosum PE=2 SV=1 69 429 2.0E-70
sp|P48467|KINH_NEUCR Kinesin heavy chain OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=kin PE=1 SV=2 69 437 8.0E-70
sp|Q86Z98|KINH_GIBMO Kinesin heavy chain OS=Gibberella moniliformis GN=KLP1 PE=3 SV=1 69 437 4.0E-68
sp|Q86ZC1|KINH_BOTFU Kinesin heavy chain OS=Botryotinia fuckeliana GN=klp1 PE=3 SV=1 69 430 8.0E-68
sp|P33174|KIF4_MOUSE Chromosome-associated kinesin KIF4 OS=Mus musculus GN=Kif4 PE=1 SV=3 70 414 2.0E-67
sp|Q2VIQ3|KIF4B_HUMAN Chromosome-associated kinesin KIF4B OS=Homo sapiens GN=KIF4B PE=2 SV=2 70 414 3.0E-67
sp|Q90640|KIF4_CHICK Chromosome-associated kinesin KIF4 OS=Gallus gallus GN=KIF4 PE=2 SV=1 66 414 2.0E-66
sp|Q61768|KINH_MOUSE Kinesin-1 heavy chain OS=Mus musculus GN=Kif5b PE=1 SV=3 67 417 4.0E-66
sp|P17210|KINH_DROME Kinesin heavy chain OS=Drosophila melanogaster GN=Khc PE=1 SV=2 67 432 4.0E-66
sp|O95239|KIF4A_HUMAN Chromosome-associated kinesin KIF4A OS=Homo sapiens GN=KIF4A PE=1 SV=3 70 414 4.0E-66
sp|Q2PQA9|KINH_RAT Kinesin-1 heavy chain OS=Rattus norvegicus GN=Kif5b PE=1 SV=1 67 417 5.0E-66
sp|Q86VH2|KIF27_HUMAN Kinesin-like protein KIF27 OS=Homo sapiens GN=KIF27 PE=2 SV=1 66 414 6.0E-66
sp|P33176|KINH_HUMAN Kinesin-1 heavy chain OS=Homo sapiens GN=KIF5B PE=1 SV=1 67 417 1.0E-65
sp|Q8T135|KIF5_DICDI Kinesin-related protein 5 OS=Dictyostelium discoideum GN=kif5 PE=1 SV=1 69 414 2.0E-65
sp|Q54UC9|KIF3_DICDI Kinesin-related protein 3 OS=Dictyostelium discoideum GN=kif3 PE=1 SV=1 68 450 5.0E-65
sp|Q7M6Z4|KIF27_MOUSE Kinesin-like protein KIF27 OS=Mus musculus GN=Kif27 PE=1 SV=1 66 414 6.0E-65
sp|Q7M6Z5|KIF27_RAT Kinesin-like protein KIF27 OS=Rattus norvegicus GN=Kif27 PE=1 SV=1 66 491 2.0E-64
sp|Q6YUL8|BC2_ORYSJ Kinesin-like protein BC2 OS=Oryza sativa subsp. japonica GN=BC2 PE=1 SV=1 111 441 9.0E-64
sp|Q9US60|KLP3_SCHPO Kinesin-like protein 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=klp3 PE=2 SV=1 68 417 2.0E-63
sp|Q2M1P5|KIF7_HUMAN Kinesin-like protein KIF7 OS=Homo sapiens GN=KIF7 PE=1 SV=2 64 414 3.0E-63
sp|Q91784|KIF4_XENLA Chromosome-associated kinesin KIF4 OS=Xenopus laevis GN=kif4 PE=2 SV=1 70 414 3.0E-63
sp|Q27IK7|POK1_ARATH Phragmoplast orienting kinesin-1 OS=Arabidopsis thaliana GN=POK1 PE=1 SV=1 116 439 3.0E-63
sp|B7ZNG0|KIF7_MOUSE Kinesin-like protein KIF7 OS=Mus musculus GN=Kif7 PE=1 SV=1 64 414 3.0E-63
sp|P34540|KINH_CAEEL Kinesin heavy chain OS=Caenorhabditis elegans GN=unc-116 PE=2 SV=2 65 432 3.0E-63
sp|L0N7N1|KIF14_MOUSE Kinesin-like protein KIF14 OS=Mus musculus GN=Kif14 PE=1 SV=1 66 487 1.0E-62
sp|P35978|KINH_STRPU Kinesin heavy chain OS=Strongylocentrotus purpuratus PE=2 SV=1 67 438 2.0E-61
sp|Q8GS71|FRA1_ARATH Kinesin-like protein FRA1 OS=Arabidopsis thaliana GN=FRA1 PE=1 SV=1 111 437 3.0E-61
sp|P21613|KINH_DORPE Kinesin heavy chain OS=Doryteuthis pealeii PE=2 SV=1 67 433 7.0E-61
sp|B1AVY7|KI16B_MOUSE Kinesin-like protein KIF16B OS=Mus musculus GN=Kif16b PE=1 SV=1 69 510 8.0E-61
sp|Q9P2P6|STAR9_HUMAN StAR-related lipid transfer protein 9 OS=Homo sapiens GN=STARD9 PE=1 SV=3 69 461 2.0E-60
sp|Q96L93|KI16B_HUMAN Kinesin-like protein KIF16B OS=Homo sapiens GN=KIF16B PE=1 SV=2 69 510 6.0E-60
sp|Q15058|KIF14_HUMAN Kinesin-like protein KIF14 OS=Homo sapiens GN=KIF14 PE=1 SV=1 66 470 4.0E-59
sp|O60282|KIF5C_HUMAN Kinesin heavy chain isoform 5C OS=Homo sapiens GN=KIF5C PE=1 SV=1 63 414 4.0E-59
sp|Q58G59|KIF7_DANRE Kinesin-like protein kif7 OS=Danio rerio GN=kif7 PE=1 SV=1 66 414 4.0E-59
sp|P28738|KIF5C_MOUSE Kinesin heavy chain isoform 5C OS=Mus musculus GN=Kif5c PE=1 SV=3 63 414 5.0E-59
sp|Q9NQT8|KI13B_HUMAN Kinesin-like protein KIF13B OS=Homo sapiens GN=KIF13B PE=1 SV=2 67 437 6.0E-59
sp|Q86Y91|KI18B_HUMAN Kinesin-like protein KIF18B OS=Homo sapiens GN=KIF18B PE=1 SV=3 66 447 1.0E-58
sp|Q12840|KIF5A_HUMAN Kinesin heavy chain isoform 5A OS=Homo sapiens GN=KIF5A PE=1 SV=2 67 414 1.0E-58
sp|Q54TL0|KIF7_DICDI Kinesin-related protein 7 OS=Dictyostelium discoideum GN=kif7 PE=2 SV=1 68 507 1.0E-58
sp|Q6RT24|CENPE_MOUSE Centromere-associated protein E OS=Mus musculus GN=Cenpe PE=1 SV=1 65 443 1.0E-58
sp|Q5R9K7|KIF5A_PONAB Kinesin heavy chain isoform 5A OS=Pongo abelii GN=KIF5A PE=2 SV=1 67 414 2.0E-58
sp|P33175|KIF5A_MOUSE Kinesin heavy chain isoform 5A OS=Mus musculus GN=Kif5a PE=1 SV=3 67 414 2.0E-58
sp|Q6S001|KIF11_DICDI Kinesin-related protein 11 OS=Dictyostelium discoideum GN=kif11 PE=3 SV=1 105 437 2.0E-58
sp|Q7ZXX2|KIF19_XENLA Kinesin-like protein KIF19 OS=Xenopus laevis GN=kif19 PE=2 SV=1 64 437 3.0E-58
sp|Q27IK6|POK2_ARATH Phragmoplast orienting kinesin 2 OS=Arabidopsis thaliana GN=POK2 PE=2 SV=1 116 422 3.0E-58
sp|Q91WD7|KI18A_MOUSE Kinesin-like protein KIF18A OS=Mus musculus GN=Kif18a PE=2 SV=1 116 461 4.0E-58
sp|Q54NP8|KIF4_DICDI Kinesin-related protein 4 OS=Dictyostelium discoideum GN=kif4 PE=2 SV=1 70 458 5.0E-58
sp|Q9LDN0|KN12A_ARATH Kinesin-like protein KIN12A OS=Arabidopsis thaliana GN=KIN12A PE=1 SV=1 61 417 8.0E-58
sp|Q6QLM7|KIF5A_RAT Kinesin heavy chain isoform 5A OS=Rattus norvegicus GN=Kif5a PE=1 SV=1 67 414 1.0E-57
sp|Q5ZLK6|KI18B_CHICK Kinesin-like protein KIF18B OS=Gallus gallus GN=KIF18B PE=2 SV=1 116 437 3.0E-57
sp|Q91785|KI15A_XENLA Kinesin-like protein KIF15-A OS=Xenopus laevis GN=kif15-a PE=1 SV=1 114 842 5.0E-57
sp|Q9NS87|KIF15_HUMAN Kinesin-like protein KIF15 OS=Homo sapiens GN=KIF15 PE=1 SV=1 114 414 1.0E-56
sp|Q28WQ1|KIF1A_DROPS Kinesin-like protein unc-104 OS=Drosophila pseudoobscura pseudoobscura GN=unc-104 PE=3 SV=1 68 437 1.0E-56
sp|Q8L7Y8|KN12B_ARATH Kinesin-like protein KIN12B OS=Arabidopsis thaliana GN=KIN12B PE=1 SV=1 64 437 2.0E-56
sp|Q6P9L6|KIF15_MOUSE Kinesin-like protein KIF15 OS=Mus musculus GN=Kif15 PE=1 SV=1 114 414 2.0E-56
sp|Q02224|CENPE_HUMAN Centromere-associated protein E OS=Homo sapiens GN=CENPE PE=1 SV=2 65 437 2.0E-56
sp|Q7TSP2|KIF15_RAT Kinesin-like protein KIF15 OS=Rattus norvegicus GN=Kif15 PE=2 SV=1 114 414 2.0E-56
sp|Q9QXL2|KI21A_MOUSE Kinesin-like protein KIF21A OS=Mus musculus GN=Kif21a PE=1 SV=2 63 455 3.0E-56
sp|Q498L9|KI15B_XENLA Kinesin-like protein KIF15-B OS=Xenopus laevis GN=kif15-b PE=1 SV=1 114 437 3.0E-56
sp|Q9LPC6|ARK2_ARATH Armadillo repeat-containing kinesin-like protein 2 OS=Arabidopsis thaliana GN=ARK2 PE=1 SV=2 8 547 3.0E-56
sp|Q8NI77|KI18A_HUMAN Kinesin-like protein KIF18A OS=Homo sapiens GN=KIF18A PE=1 SV=2 116 453 3.0E-56
sp|Q99PT9|KIF19_MOUSE Kinesin-like protein KIF19 OS=Mus musculus GN=Kif19 PE=1 SV=2 114 437 5.0E-56
sp|Q9GYZ0|KIF15_STRPU Kinesin-like protein KIF15 OS=Strongylocentrotus purpuratus GN=KIF15 PE=1 SV=1 114 414 6.0E-56
sp|Q9NGQ2|KIF1_DICDI Kinesin-related protein 1 OS=Dictyostelium discoideum GN=kif1 PE=1 SV=1 69 452 6.0E-56
sp|A1ZAJ2|KIF1A_DROME Kinesin-like protein unc-104 OS=Drosophila melanogaster GN=unc-104 PE=1 SV=1 68 437 7.0E-56
sp|Q7Z4S6|KI21A_HUMAN Kinesin-like protein KIF21A OS=Homo sapiens GN=KIF21A PE=1 SV=2 66 490 9.0E-56
sp|Q4KLL9|KI18B_RAT Kinesin-like protein KIF18B OS=Rattus norvegicus GN=Kif18b PE=2 SV=1 115 447 1.0E-55
sp|Q2TAC6|KIF19_HUMAN Kinesin-like protein KIF19 OS=Homo sapiens GN=KIF19 PE=2 SV=2 114 437 1.0E-55
sp|Q6PFD6|KI18B_MOUSE Kinesin-like protein KIF18B OS=Mus musculus GN=Kif18b PE=2 SV=2 115 447 2.0E-55
sp|O14343|KLP5_SCHPO Kinesin-like protein 5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=klp5 PE=1 SV=1 116 408 4.0E-55
sp|Q9EQW7|KI13A_MOUSE Kinesin-like protein KIF13A OS=Mus musculus GN=Kif13a PE=1 SV=1 67 437 5.0E-55
sp|Q9H1H9|KI13A_HUMAN Kinesin-like protein KIF13A OS=Homo sapiens GN=KIF13A PE=1 SV=2 67 437 5.0E-55
sp|Q9BVG8|KIFC3_HUMAN Kinesin-like protein KIFC3 OS=Homo sapiens GN=KIFC3 PE=1 SV=4 69 413 7.0E-55
sp|Q60575|KIF1B_MOUSE Kinesin-like protein KIF1B OS=Mus musculus GN=Kif1b PE=1 SV=2 69 437 8.0E-55
sp|Q8S950|NACK1_TOBAC Kinesin-like protein NACK1 OS=Nicotiana tabacum GN=NACK1 PE=1 SV=1 65 437 9.0E-55
sp|O60333|KIF1B_HUMAN Kinesin-like protein KIF1B OS=Homo sapiens GN=KIF1B PE=1 SV=5 69 437 1.0E-54
sp|O35071|KIF1C_MOUSE Kinesin-like protein KIF1C OS=Mus musculus GN=Kif1c PE=1 SV=2 69 439 1.0E-54
sp|F9W301|KPSS1_ORYSJ Kinesin-1-like protein PSS1 OS=Oryza sativa subsp. japonica GN=PSS1 PE=1 SV=1 68 412 1.0E-54
sp|Q6ZMV9|KIF6_HUMAN Kinesin-like protein KIF6 OS=Homo sapiens GN=KIF6 PE=1 SV=3 116 437 2.0E-54
sp|Q9QXL1|KI21B_MOUSE Kinesin-like protein KIF21B OS=Mus musculus GN=Kif21b PE=1 SV=2 63 438 2.0E-54
sp|O75037|KI21B_HUMAN Kinesin-like protein KIF21B OS=Homo sapiens GN=KIF21B PE=1 SV=2 63 438 2.0E-54
sp|Q80TF6|STAR9_MOUSE StAR-related lipid transfer protein 9 OS=Mus musculus GN=Stard9 PE=1 SV=2 69 451 3.0E-54
sp|O88658|KIF1B_RAT Kinesin-like protein KIF1B OS=Rattus norvegicus GN=Kif1b PE=1 SV=2 69 437 5.0E-54
sp|Q8S905|NACK1_ARATH Kinesin-like protein NACK1 OS=Arabidopsis thaliana GN=NACK1 PE=1 SV=1 67 436 5.0E-54
sp|Q7PHR1|KIF1A_ANOGA Kinesin-like protein unc-104 OS=Anopheles gambiae GN=unc-104 PE=3 SV=3 68 437 8.0E-54
sp|Q17BU3|KIF1A_AEDAE Kinesin-like protein unc-104 OS=Aedes aegypti GN=unc-104 PE=3 SV=1 68 437 1.0E-53
sp|A8WFU8|KIF22_DANRE Kinesin-like protein KIF22 OS=Danio rerio GN=kif22 PE=2 SV=1 60 411 1.0E-53
sp|P23678|UN104_CAEEL Kinesin-like protein unc-104 OS=Caenorhabditis elegans GN=unc-104 PE=2 SV=4 68 437 1.0E-53
sp|O43896|KIF1C_HUMAN Kinesin-like protein KIF1C OS=Homo sapiens GN=KIF1C PE=1 SV=3 69 439 2.0E-53
sp|Q0DV28|ARK1_ORYSJ Armadillo repeat-containing kinesin-like protein 1 OS=Oryza sativa subsp. japonica GN=Os03g0152900 PE=2 SV=2 60 437 4.0E-53
sp|O35231|KIFC3_MOUSE Kinesin-like protein KIFC3 OS=Mus musculus GN=Kifc3 PE=1 SV=4 115 411 4.0E-53
sp|Q9BPU3|KIF2_DICDI Kinesin-related protein 2 OS=Dictyostelium discoideum GN=kif2 PE=2 SV=1 97 401 7.0E-53
sp|Q6P3R1|KIF22_XENTR Kinesin-like protein KIF22 OS=Xenopus tropicalis GN=kif22 PE=2 SV=1 70 411 9.0E-53
sp|O35787|KIF1C_RAT Kinesin-like protein KIF1C OS=Rattus norvegicus GN=Kif1c PE=1 SV=1 69 439 1.0E-52
sp|Q9I869|KF22A_XENLA Kinesin-like protein KIF22-A OS=Xenopus laevis GN=kif22-a PE=1 SV=1 70 411 2.0E-52
sp|O59751|KLP6_SCHPO Kinesin-like protein 6 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=klp6 PE=1 SV=1 116 410 2.0E-52
sp|Q12756|KIF1A_HUMAN Kinesin-like protein KIF1A OS=Homo sapiens GN=KIF1A PE=1 SV=2 69 439 2.0E-52
sp|P33173|KIF1A_MOUSE Kinesin-like protein KIF1A OS=Mus musculus GN=Kif1a PE=1 SV=2 69 439 2.0E-52
sp|Q9SV36|ARK1_ARATH Armadillo repeat-containing kinesin-like protein 1 OS=Arabidopsis thaliana GN=ARK1 PE=1 SV=2 104 437 5.0E-52
sp|P53086|KIP3_YEAST Kinesin-like protein KIP3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KIP3 PE=1 SV=1 116 410 6.0E-52
sp|Q7ZYL5|KF22B_XENLA Kinesin-like protein KIF22-B OS=Xenopus laevis GN=kif22-b PE=2 SV=2 70 411 1.0E-51
sp|Q96FN5|KIF12_HUMAN Kinesin-like protein KIF12 OS=Homo sapiens GN=KIF12 PE=1 SV=3 57 444 2.0E-51
sp|P46870|KLP1_CHLRE Kinesin-like protein KLP1 OS=Chlamydomonas reinhardtii GN=KLP1 PE=2 SV=1 115 509 9.0E-51
sp|Q9D2Z8|KIF12_MOUSE Kinesin-like protein KIF12 OS=Mus musculus GN=Kif12 PE=1 SV=1 57 412 1.0E-50
sp|P79955|CTK2_XENLA Carboxy-terminal kinesin 2 OS=Xenopus laevis PE=2 SV=1 71 401 2.0E-50
sp|Q5VQ09|ARK2_ORYSJ Armadillo repeat-containing kinesin-like protein 2 OS=Oryza sativa subsp. japonica GN=Os06g0137100 PE=2 SV=1 68 473 3.0E-50
sp|D3YXS5|KIF28_MOUSE Kinesin-like protein KIF28P OS=Mus musculus GN=Kif28p PE=3 SV=1 69 414 5.0E-50
sp|Q8S949|NACK2_TOBAC Kinesin-like protein NACK2 OS=Nicotiana tabacum GN=NACK2 PE=1 SV=1 116 437 8.0E-50
sp|O81635|ATK4_ARATH Kinesin-4 OS=Arabidopsis thaliana GN=ATK4 PE=1 SV=2 71 407 9.0E-50
sp|P28739|KLPA_EMENI Kinesin-like protein klpA OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=klpA PE=2 SV=3 69 406 2.0E-49
sp|F8WLE0|KIF28_RAT Kinesin-like protein KIF28P OS=Rattus norvegicus GN=Kif28p PE=2 SV=1 69 414 2.0E-49
sp|P46865|KINL_LEICH Kinesin-like protein K39 (Fragment) OS=Leishmania chagasi GN=KIN PE=2 SV=1 105 414 3.0E-49
sp|Q5I0E8|KIF22_RAT Kinesin-like protein KIF22 OS=Rattus norvegicus GN=Kif22 PE=2 SV=1 37 422 4.0E-49
sp|Q9FZ06|ARK3_ARATH Armadillo repeat-containing kinesin-like protein 3 OS=Arabidopsis thaliana GN=ARK3 PE=1 SV=1 1 436 5.0E-49
sp|Q9WV04|KIF9_MOUSE Kinesin-like protein KIF9 OS=Mus musculus GN=Kif9 PE=1 SV=2 109 490 5.0E-49
sp|A6QPL4|KIF22_BOVIN Kinesin-like protein KIF22 OS=Bos taurus GN=KIF22 PE=2 SV=2 70 422 7.0E-49
sp|Q9HAQ2|KIF9_HUMAN Kinesin-like protein KIF9 OS=Homo sapiens GN=KIF9 PE=1 SV=4 109 456 1.0E-48
sp|Q3V300|KIF22_MOUSE Kinesin-like protein KIF22 OS=Mus musculus GN=Kif22 PE=2 SV=2 116 422 2.0E-48
sp|P46875|ATK3_ARATH Kinesin-3 OS=Arabidopsis thaliana GN=ATK3 PE=2 SV=1 71 419 4.0E-48
sp|Q5REP4|KIF22_PONAB Kinesin-like protein KIF22 OS=Pongo abelii GN=KIF22 PE=2 SV=1 70 422 4.0E-48
sp|Q14807|KIF22_HUMAN Kinesin-like protein KIF22 OS=Homo sapiens GN=KIF22 PE=1 SV=5 70 422 5.0E-48
sp|Q9FHN8|KCBP_ARATH Kinesin-like calmodulin-binding protein OS=Arabidopsis thaliana GN=KCBP PE=1 SV=1 70 411 9.0E-48
sp|Q8LNZ2|NACK2_ARATH Kinesin-like protein NACK2 OS=Arabidopsis thaliana GN=NACK2 PE=1 SV=1 116 439 1.0E-47
sp|P46864|ATK2_ARATH Kinesin-2 OS=Arabidopsis thaliana GN=ATK2 PE=2 SV=1 71 404 2.0E-47
sp|Q8W1Y3|KP1_ARATH Kinesin KP1 OS=Arabidopsis thaliana GN=KP1 PE=1 SV=2 114 437 5.0E-47
sp|Q6S002|KIF10_DICDI Kinesin-related protein 10 OS=Dictyostelium discoideum GN=kif10 PE=3 SV=1 72 408 7.0E-47
sp|P45962|KLP3_CAEEL Kinesin-like protein klp-3 OS=Caenorhabditis elegans GN=klp-3 PE=1 SV=1 69 401 2.0E-46
sp|F4JGP4|ATK5_ARATH Kinesin-5 OS=Arabidopsis thaliana GN=ATK5 PE=2 SV=1 116 404 5.0E-46
sp|Q1MTQ1|TEA2_SCHPO Kinesin-like protein tea2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tea2 PE=1 SV=1 116 407 6.0E-46
sp|Q92376|KLP1_SCHPO Kinesin-like protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=klp1 PE=2 SV=2 97 401 1.0E-45
sp|B7ZC32|KIF28_HUMAN Kinesin-like protein KIF28P OS=Homo sapiens GN=KIF28P PE=3 SV=2 126 410 1.0E-45
sp|Q07970|ATK1_ARATH Kinesin-1 OS=Arabidopsis thaliana GN=ATK1 PE=2 SV=1 69 404 2.0E-45
sp|Q5XI63|KIFC1_RAT Kinesin-like protein KIFC1 OS=Rattus norvegicus GN=Kifc1 PE=2 SV=1 69 401 6.0E-45
sp|Q9US03|KLP2_SCHPO Kinesin-like protein 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=klp2 PE=3 SV=1 71 406 1.0E-44
sp|P20480|NCD_DROME Protein claret segregational OS=Drosophila melanogaster GN=ncd PE=1 SV=1 71 401 1.0E-44
sp|Q9BW19|KIFC1_HUMAN Kinesin-like protein KIFC1 OS=Homo sapiens GN=KIFC1 PE=1 SV=2 93 401 2.0E-44
sp|Q9QWT9|KIFC1_MOUSE Kinesin-like protein KIFC1 OS=Mus musculus GN=Kifc1 PE=1 SV=2 69 401 2.0E-44
sp|Q95LP1|KIF2C_MACFA Kinesin-like protein KIF2C OS=Macaca fascicularis GN=KIF2C PE=2 SV=1 66 407 3.0E-44
sp|Q99661|KIF2C_HUMAN Kinesin-like protein KIF2C OS=Homo sapiens GN=KIF2C PE=1 SV=2 66 407 3.0E-44
sp|Q960Z0|KI10A_DROME Kinesin-like protein Klp10A OS=Drosophila melanogaster GN=Klp10A PE=1 SV=1 111 407 4.0E-44
sp|Q7XPJ0|KCBP_ORYSJ Kinesin-like calmodulin-binding protein homolog OS=Oryza sativa subsp. japonica GN=Os04g0666900 PE=2 SV=1 70 409 4.0E-44
sp|Q6FXI5|CIN8_CANGA Kinesin-like protein CIN8 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=CIN8 PE=3 SV=1 52 231 1.0E-43
sp|Q60443|KIFC1_CRIGR Kinesin-like protein KIFC1 OS=Cricetulus griseus PE=2 SV=1 116 401 2.0E-43
sp|O08672|KIFC2_MOUSE Kinesin-like protein KIFC2 OS=Mus musculus GN=Kifc2 PE=1 SV=1 71 407 2.0E-43
sp|P27895|CIN8_YEAST Kinesin-like protein CIN8 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CIN8 PE=1 SV=3 36 231 3.0E-43
sp|Q96AC6|KIFC2_HUMAN Kinesin-like protein KIFC2 OS=Homo sapiens GN=KIFC2 PE=2 SV=1 67 384 4.0E-43
sp|Q8N4N8|KIF2B_HUMAN Kinesin-like protein KIF2B OS=Homo sapiens GN=KIF2B PE=1 SV=3 66 407 6.0E-43
sp|Q95LT1|KIF2B_MACFA Kinesin-like protein KIF2B OS=Macaca fascicularis GN=KIF2B PE=2 SV=1 66 407 3.0E-42
sp|P70096|KIF2C_CRIGR Kinesin-like protein KIF2C OS=Cricetulus griseus GN=KIF2C PE=1 SV=2 66 407 5.0E-42
sp|P18105|NOD_DROME Kinesin-like protein Nod OS=Drosophila melanogaster GN=nod PE=1 SV=1 116 416 1.0E-41
sp|Q922S8|KIF2C_MOUSE Kinesin-like protein KIF2C OS=Mus musculus GN=Kif2c PE=1 SV=1 66 407 2.0E-41
sp|Q9W1U4|KI59C_DROME Kinesin-like protein Klp59C OS=Drosophila melanogaster GN=Klp59C PE=3 SV=1 111 407 2.0E-41
sp|P28740|KIF2A_MOUSE Kinesin-like protein KIF2A OS=Mus musculus GN=Kif2a PE=1 SV=2 66 411 5.0E-41
sp|Q5ZKV8|KIF2A_CHICK Kinesin-like protein KIF2A OS=Gallus gallus GN=KIF2A PE=2 SV=2 66 411 5.0E-41
sp|Q91637|KIF2A_XENLA Kinesin-like protein KIF2A OS=Xenopus laevis GN=kif2a PE=1 SV=2 66 407 6.0E-41
sp|O00139|KIF2A_HUMAN Kinesin-like protein KIF2A OS=Homo sapiens GN=KIF2A PE=1 SV=3 66 411 6.0E-41
sp|Q62909|KIF2C_RAT Kinesin-like protein KIF2C OS=Rattus norvegicus GN=Kif2c PE=2 SV=3 66 407 8.0E-41
sp|Q9WV63|KIF2A_RAT Kinesin-like protein KIF2A OS=Rattus norvegicus GN=Kif2a PE=1 SV=2 66 411 8.0E-41
sp|Q5R9Y9|KIF2A_PONAB Kinesin-like protein KIF2A OS=Pongo abelii GN=KIF2A PE=2 SV=1 66 434 8.0E-41
sp|P17119|KAR3_YEAST Kinesin-like protein KAR3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KAR3 PE=1 SV=1 71 408 9.0E-41
sp|Q2NL05|KIF2A_BOVIN Kinesin-like protein KIF2A OS=Bos taurus GN=KIF2A PE=2 SV=1 66 411 3.0E-40
sp|Q8C0N1|KIF2B_MOUSE Kinesin-like protein KIF2B OS=Mus musculus GN=Kif2b PE=1 SV=1 66 407 4.0E-40
sp|Q5XI51|KIF2B_RAT Kinesin-like protein KIF2B OS=Rattus norvegicus GN=Kif2b PE=2 SV=2 66 423 6.0E-40
sp|Q9UIL4|KIF25_HUMAN Kinesin-like protein KIF25 OS=Homo sapiens GN=KIF25 PE=2 SV=2 120 411 2.0E-39
sp|Q91636|KIF2C_XENLA Kinesin-like protein KIF2C OS=Xenopus laevis GN=kif2c PE=1 SV=2 65 412 3.0E-39
sp|Q8J1G1|KIP2_ASHGO Kinesin-like protein KIP2 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=KIP2 PE=3 SV=1 116 407 3.0E-39
sp|Q6S004|KIF6_DICDI Kinesin-related protein 6 OS=Dictyostelium discoideum GN=kif6 PE=2 SV=1 70 407 4.0E-39
sp|A6H750|KIF2B_BOVIN Kinesin-like protein KIF2B OS=Bos taurus GN=KIF2B PE=2 SV=1 70 407 6.0E-39
sp|Q5T7B8|KIF24_HUMAN Kinesin-like protein KIF24 OS=Homo sapiens GN=KIF24 PE=1 SV=2 70 408 6.0E-39
sp|Q555I8|KIF9_DICDI Kinesin-related protein 9 OS=Dictyostelium discoideum GN=kif9 PE=2 SV=1 116 411 8.0E-39
sp|Q9FKP4|KCA2_ARATH Kinesin-like protein KCA2 OS=Arabidopsis thaliana GN=KCA2 PE=1 SV=1 71 406 1.0E-38
sp|P28743|KIP2_YEAST Kinesin-like protein KIP2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KIP2 PE=1 SV=1 116 407 3.0E-38
sp|Q6NWW5|KIF24_MOUSE Kinesin-like protein KIF24 OS=Mus musculus GN=Kif24 PE=1 SV=2 66 408 3.0E-37
sp|Q9LX99|KCA1_ARATH Kinesin-like protein KCA1 OS=Arabidopsis thaliana GN=KCA1 PE=1 SV=1 71 406 3.0E-35
sp|Q39493|DSK1_CYLFU Diatom spindle kinesin-1 OS=Cylindrotheca fusiformis GN=DSK1 PE=2 SV=1 68 408 7.0E-34
sp|E9Q5G3|KIF23_MOUSE Kinesin-like protein KIF23 OS=Mus musculus GN=Kif23 PE=1 SV=1 116 401 4.0E-33
sp|P56536|KIF5C_RAT Kinesin heavy chain isoform 5C (Fragment) OS=Rattus norvegicus GN=Kif5c PE=1 SV=2 67 320 2.0E-32
sp|Q940B8|KIN13_ARATH Kinesin-13A OS=Arabidopsis thaliana GN=KINESIN-13A PE=1 SV=1 70 407 2.0E-32
sp|Q9V877|SUB_DROME Kinesin-like protein subito OS=Drosophila melanogaster GN=sub PE=1 SV=1 114 407 4.0E-30
sp|Q6S003|KIF8_DICDI Kinesin-related protein 8 OS=Dictyostelium discoideum GN=kif8 PE=2 SV=1 70 288 4.0E-30
sp|Q02241|KIF23_HUMAN Kinesin-like protein KIF23 OS=Homo sapiens GN=KIF23 PE=1 SV=3 116 401 1.0E-29
sp|Q80WE4|KI20B_MOUSE Kinesin-like protein KIF20B OS=Mus musculus GN=Kif20b PE=1 SV=3 194 407 2.0E-27
sp|Q6S003|KIF8_DICDI Kinesin-related protein 8 OS=Dictyostelium discoideum GN=kif8 PE=2 SV=1 309 414 5.0E-27
sp|Q9UTL2|KLP8_SCHPO Kinesin-like protein 8 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=klp8 PE=1 SV=1 69 414 1.0E-25
sp|Q96Q89|KI20B_HUMAN Kinesin-like protein KIF20B OS=Homo sapiens GN=KIF20B PE=1 SV=3 203 407 8.0E-25
sp|Q52KG5|KI26A_MOUSE Kinesin-like protein KIF26A OS=Mus musculus GN=Kif26a PE=1 SV=2 104 410 1.0E-24
sp|P97329|KI20A_MOUSE Kinesin-like protein KIF20A OS=Mus musculus GN=Kif20a PE=2 SV=1 198 414 5.0E-24
sp|O95235|KI20A_HUMAN Kinesin-like protein KIF20A OS=Homo sapiens GN=KIF20A PE=1 SV=1 203 413 6.0E-24
sp|Q29RT6|KI20A_BOVIN Kinesin-like protein KIF20A OS=Bos taurus GN=KIF20A PE=2 SV=1 198 411 1.0E-23
sp|P32364|SMY1_YEAST Kinesin-related protein SMY1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SMY1 PE=1 SV=1 112 477 7.0E-23
sp|Q7TNC6|KI26B_MOUSE Kinesin-like protein KIF26B OS=Mus musculus GN=Kif26b PE=1 SV=3 70 403 7.0E-23
sp|Q1MTQ7|KLP9_SCHPO Kinesin-like motor protein 9 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=klp9 PE=1 SV=2 117 411 4.0E-22
sp|Q2KJY2|KI26B_HUMAN Kinesin-like protein KIF26B OS=Homo sapiens GN=KIF26B PE=2 SV=1 70 403 7.0E-22
sp|Q292S8|COS_DROPS Kinesin-like protein costa OS=Drosophila pseudoobscura pseudoobscura GN=cos PE=3 SV=2 128 414 7.0E-22
sp|O16844|COS_DROME Kinesin-like protein costa OS=Drosophila melanogaster GN=cos PE=1 SV=2 104 409 1.0E-21
sp|Q6S000|KIF12_DICDI Kinesin-related protein 12 OS=Dictyostelium discoideum GN=kif12 PE=3 SV=1 194 417 3.0E-21
sp|Q9ULI4|KI26A_HUMAN Kinesin-like protein KIF26A OS=Homo sapiens GN=KIF26A PE=2 SV=3 108 410 5.0E-20
sp|Q96Q89|KI20B_HUMAN Kinesin-like protein KIF20B OS=Homo sapiens GN=KIF20B PE=1 SV=3 84 195 4.0E-09
sp|Q6S000|KIF12_DICDI Kinesin-related protein 12 OS=Dictyostelium discoideum GN=kif12 PE=3 SV=1 70 204 4.0E-09
sp|Q29RT6|KI20A_BOVIN Kinesin-like protein KIF20A OS=Bos taurus GN=KIF20A PE=2 SV=1 47 195 6.0E-09
sp|P97329|KI20A_MOUSE Kinesin-like protein KIF20A OS=Mus musculus GN=Kif20a PE=2 SV=1 116 195 1.0E-08
sp|O95235|KI20A_HUMAN Kinesin-like protein KIF20A OS=Homo sapiens GN=KIF20A PE=1 SV=1 2 195 3.0E-08
sp|Q80WE4|KI20B_MOUSE Kinesin-like protein KIF20B OS=Mus musculus GN=Kif20b PE=1 SV=3 83 195 7.0E-08
[Show less]

GO

GO Term Description Terminal node
GO:0003777 microtubule motor activity Yes
GO:0007018 microtubule-based movement Yes
GO:0008017 microtubule binding Yes
GO:0005524 ATP binding Yes
GO:1901265 nucleoside phosphate binding No
GO:0003774 cytoskeletal motor activity No
GO:0008150 biological_process No
GO:0007017 microtubule-based process No
GO:0032555 purine ribonucleotide binding No
GO:0005488 binding No
GO:0036094 small molecule binding No
GO:1901363 heterocyclic compound binding No
GO:0009987 cellular process No
GO:0097159 organic cyclic compound binding No
GO:0030554 adenyl nucleotide binding No
GO:0008092 cytoskeletal protein binding No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0043167 ion binding No
GO:0032559 adenyl ribonucleotide binding No
GO:0000166 nucleotide binding No
GO:0043168 anion binding No
GO:0032553 ribonucleotide binding No
GO:0003674 molecular_function No
GO:0015631 tubulin binding No
GO:0140657 ATP-dependent activity No
GO:0097367 carbohydrate derivative binding No
GO:0005515 protein binding No
GO:0017076 purine nucleotide binding No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Nucleus Nuclear localization signal 0.3862 0.8263 0.108 0.0186 0.0782 0.0009 0.0517 0.0332 0.0374 0.0035

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup146
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4387
Ophiocordyceps australis 1348a (Ghana) OphauG2|5166
Ophiocordyceps australis map64 (Brazil) OphauB2|6091
Ophiocordyceps australis map64 (Brazil) OphauB2|6092
Ophiocordyceps australis map64 (Brazil) OphauB2|6093
Ophiocordyceps australis map64 (Brazil) OphauB2|87
Ophiocordyceps camponoti-floridani Ophcf2|02677
Ophiocordyceps camponoti-rufipedis Ophun1|4371
Ophiocordyceps kimflemingae Ophio5|2062
Ophiocordyceps kimflemingae Ophio5|4888
Ophiocordyceps kimflemingae Ophio5|8395
Ophiocordyceps subramaniannii Hirsu2|5226
Ophiocordyceps subramaniannii Hirsu2|9012 (this protein)

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|9012
MGSSSLRAGAMSRNGARPGSVRASTARHASATTVTRGAGAASPAGSVSTSGTKRKERDFDSEAGGEETNINVVVR
CRGRNEREVKESSTVVVRTDGVKGKLVELSMGANALSNKTYNFDRVFSPAADQNMVFDDTVKPILDEMLAGYNCT
IFAYGQTGTGKTYTMSGDMTETLGMLSDEAGIIPRVLQQLFNKLEIDDTENCVKCSFIELYNEELRDLLSVEENA
KLKIFDDASRKGHAGTIIQGMEEKHIKNASEGIKVLQDGSLKRQVAATKCNDLSSRSHTVFTITAYVKKTNEHGV
DDFVSAGKLNLVDLAGSENIQRSGAENKRAAEAGLINKSLLTLGRVINALVDRSAHIPYRESKLTRLLQDSLGGR
TKTCIIATISPAKSNMEETISTLDYAFRAKNIRNKPQLNPMLNKKMLLKDFASEIEKLKSELISTRQRNGVYMSN
DAYEEMTAQSESRRIVLEEQSAKIETLETNLRNKVQELFSLTTTFMGLRKDHEGTKVQLDETKGVLDQTEIVLAA
TRKSLADETQLRKAHEQTEEKLTEIGGELISKLKKTVHDVSGLHAKNKRKSDLQSLNRAAWGTSQAQVADVTSMV
QRRVLEFQDEQLEHISSVSRRMEDFVGGELGKLSATQAFLDEHLDLFVDSKRRMLQQTQTSKDDLDEALEEIKAI
RDGVKEKVGESLRVISHAAEKISADVLHEMTNFHSALHNSYSSLGKDFKSIFEDLVRHITAQRTEADSLRRQLQS
ATNAVVLQNASVTTRIQEALEEERRQACEDRQKLMAQIASLMGAQAESQEARLSERAAQMQKTVTESNASLEGAT
GQYGQGMEAWDEKEGQLLDEVRKSRDLLKTKLKDDWTAANDKSTAIQNTAKSVHAEAVRVVDEQIEDLDTQMEAL
DDFVARARSENACQHEKNAHSVQALSNTVERSFANISAHFKTTFDRVRNLGEEMELDASDMMDILEPLEAQLCQP
LANLREGIASTALHEYQPTGQTPQKVLYTYPTKLPRTQPRDLLVVSKTDGALTAEDAQGGEEGRLKDEGGEEDGD
EMKAETERDDADDDGNDGNSLVFPDLDLGGGRKMSLPAATQARRPSLAGSLDQRNRLSVSLREVSPNLATGPLGL
LDARASIASMPAEGVMAMLRKQQPKKQGGVVVAEGRENLPPTAEAFPQGLGRRKSPRLN*
Coding >Hirsu2|9012
ATGGGGAGCAGCAGTCTGCGCGCCGGCGCCATGAGCCGCAACGGCGCGAGACCGGGCAGCGTGAGGGCATCGACG
GCGCGGCACGCGTCCGCCACGACGGTGACGCGGGGGGCGGGCGCAGCCTCGCCGGCCGGTTCCGTCTCGACCTCG
GGGACGAAGCGCAAGGAGCGCGATTTCGACTCGGAGGCAGGAGGCGAGGAGACCAACATCAACGTCGTGGTGCGC
TGCAGGGGCCGCAACGAGCGCGAGGTCAAAGAGAGCAGCACCGTCGTGGTGCGGACCGACGGCGTCAAGGGGAAG
CTGGTCGAGCTGTCCATGGGAGCCAACGCGCTCAGCAACAAGACGTACAACTTCGACCGCGTGTTCTCCCCCGCC
GCGGACCAGAACATGGTCTTTGACGACACGGTCAAGCCCATCCTGGACGAGATGCTCGCCGGCTACAACTGCACC
ATCTTCGCCTACGGACAGACGGGCACGGGAAAGACGTACACCATGTCGGGCGACATGACCGAGACGCTGGGCATG
CTCTCCGACGAGGCAGGCATCATCCCGCGCGTGCTCCAGCAGCTCTTCAACAAGCTCGAGATTGACGACACGGAA
AACTGCGTCAAGTGCTCCTTCATCGAGCTCTACAACGAAGAGCTCCGAGACCTGCTGTCGGTGGAGGAGAACGCA
AAACTCAAAATCTTCGACGACGCCTCCCGAAAGGGACACGCCGGCACCATCATCCAGGGCATGGAGGAGAAGCAC
ATCAAGAACGCGTCCGAGGGCATCAAGGTGCTCCAGGACGGCAGCTTGAAGCGCCAGGTGGCGGCGACCAAGTGC
AACGACCTCAGCTCCCGCAGCCACACCGTCTTCACCATCACCGCCTACGTCAAGAAGACCAACGAGCACGGCGTC
GACGACTTCGTCAGCGCCGGCAAGCTCAACCTCGTCGACCTGGCCGGCAGCGAGAACATCCAGCGGTCCGGCGCC
GAGAACAAGCGCGCGGCCGAGGCCGGCCTCATCAACAAGTCGCTGCTCACCCTCGGCCGCGTCATCAACGCGCTC
GTCGACCGCAGCGCCCACATCCCCTACCGCGAGTCCAAGCTGACGCGCCTGCTGCAAGACTCGCTCGGCGGCCGC
ACCAAGACGTGCATCATCGCCACCATATCGCCGGCCAAGAGCAACATGGAGGAGACCATCTCCACGCTCGACTAC
GCCTTCCGCGCCAAGAACATCCGCAACAAGCCGCAGCTGAACCCGATGCTCAACAAGAAGATGCTGCTCAAGGAC
TTCGCCAGCGAGATCGAGAAGCTCAAGAGCGAGCTCATCTCGACCCGCCAACGCAACGGCGTCTACATGTCCAAC
GACGCGTACGAGGAAATGACGGCCCAGAGCGAGTCGCGCCGGATCGTGCTCGAGGAGCAGTCGGCCAAGATCGAG
ACGCTCGAGACGAACCTGCGCAACAAGGTCCAGGAGCTCTTCTCCCTGACGACGACCTTTATGGGCCTGCGCAAG
GATCACGAGGGGACCAAGGTCCAGCTGGACGAGACCAAGGGCGTCCTCGACCAGACCGAGATCGTCCTCGCCGCC
ACGCGCAAGAGCCTGGCCGACGAGACGCAGCTGCGCAAGGCGCACGAGCAGACGGAGGAGAAGCTGACCGAGATC
GGCGGCGAGCTCATCAGCAAGCTCAAGAAGACGGTGCACGACGTCAGCGGCCTGCACGCCAAGAACAAGCGCAAG
TCGGACCTGCAGTCGCTCAACCGGGCCGCCTGGGGCACGTCGCAGGCCCAGGTGGCCGACGTCACGTCCATGGTC
CAGCGCCGCGTGCTCGAGTTCCAGGACGAGCAGCTCGAGCACATCTCGAGCGTCTCGCGGCGCATGGAGGACTTC
GTCGGCGGCGAGCTCGGCAAGCTGTCGGCCACGCAGGCCTTCCTCGACGAGCACCTCGACCTCTTCGTCGACTCG
AAGAGGAGGATGCTGCAGCAGACGCAGACGTCCAAGGACGACTTGGACGAGGCGCTCGAGGAGATCAAGGCGATC
CGCGACGGCGTCAAGGAGAAGGTGGGCGAGAGCCTTCGGGTCATCTCGCACGCCGCCGAGAAGATTTCAGCCGAC
GTACTGCACGAGATGACCAACTTTCACAGCGCCTTGCACAACTCGTACAGCTCCCTCGGCAAGGACTTCAAGTCC
ATCTTCGAAGACCTCGTCAGGCACATCACGGCCCAGCGGACCGAGGCGGACAGCCTCCGCAGACAGCTGCAGAGC
GCGACCAACGCCGTCGTGCTGCAGAACGCGAGCGTGACGACGCGCATCCAGGAGGCCCTGGAGGAGGAGCGCCGG
CAGGCCTGCGAGGACCGGCAGAAGCTGATGGCGCAGATCGCGTCCCTGATGGGCGCGCAGGCCGAGTCGCAGGAG
GCGCGCCTGTCGGAGCGCGCGGCGCAGATGCAAAAGACGGTGACGGAGTCCAACGCGTCGCTCGAGGGGGCGACC
GGCCAGTACGGGCAGGGCATGGAGGCGTGGGACGAGAAGGAGGGCCAGCTGCTGGACGAGGTGCGCAAGTCGCGC
GACCTGCTCAAGACCAAGCTCAAGGACGACTGGACGGCGGCCAACGACAAGAGCACGGCGATCCAGAACACGGCC
AAGTCGGTGCACGCCGAGGCGGTGCGCGTCGTGGACGAGCAGATCGAGGACCTGGACACGCAGATGGAGGCGCTC
GACGACTTCGTGGCGCGGGCGCGGTCCGAGAACGCGTGCCAGCACGAGAAGAACGCGCACTCGGTCCAGGCGCTG
TCGAACACGGTGGAGCGGTCGTTTGCTAACATCTCGGCCCACTTCAAGACGACGTTCGACCGCGTCCGGAACCTG
GGCGAGGAGATGGAGCTCGACGCCAGCGACATGATGGACATTCTCGAGCCGCTCGAGGCGCAGCTGTGCCAGCCC
CTGGCCAACCTGCGCGAAGGCATCGCCTCGACCGCCCTGCACGAGTACCAGCCGACGGGCCAGACGCCGCAGAAG
GTACTTTACACGTACCCGACGAAGCTGCCGCGGACCCAGCCGCGCGACCTGCTCGTCGTCTCCAAGACGGACGGG
GCCCTGACGGCAGAAGACGCACAGGGAGGAGAGGAGGGGCGTTTGAAGGACGAAGGCGGGGAAGAGGACGGGGAC
GAGATGAAGGCCGAGACGGAGCGCGACGACGCCGACGACGACGGCAACGACGGCAACAGCCTCGTCTTCCCCGAC
CTCGACCTCGGCGGCGGACGGAAGATGAGCCTGCCGGCGGCGACGCAGGCCCGGCGGCCGTCCTTGGCCGGCAGC
CTGGACCAACGGAACCGGCTGAGCGTGAGCCTGCGCGAGGTGAGCCCCAACCTGGCGACGGGGCCCCTGGGGCTC
CTCGACGCGCGCGCGAGCATCGCGTCGATGCCGGCCGAGGGCGTCATGGCGATGCTCAGGAAGCAGCAGCCCAAG
AAGCAGGGGGGCGTGGTGGTGGCGGAGGGGAGAGAGAATCTCCCGCCGACGGCCGAGGCCTTCCCGCAGGGCCTG
GGGAGGCGCAAGAGCCCGCGCCTGAACTGA
Transcript >Hirsu2|9012
ATGGGGAGCAGCAGTCTGCGCGCCGGCGCCATGAGCCGCAACGGCGCGAGACCGGGCAGCGTGAGGGCATCGACG
GCGCGGCACGCGTCCGCCACGACGGTGACGCGGGGGGCGGGCGCAGCCTCGCCGGCCGGTTCCGTCTCGACCTCG
GGGACGAAGCGCAAGGAGCGCGATTTCGACTCGGAGGCAGGAGGCGAGGAGACCAACATCAACGTCGTGGTGCGC
TGCAGGGGCCGCAACGAGCGCGAGGTCAAAGAGAGCAGCACCGTCGTGGTGCGGACCGACGGCGTCAAGGGGAAG
CTGGTCGAGCTGTCCATGGGAGCCAACGCGCTCAGCAACAAGACGTACAACTTCGACCGCGTGTTCTCCCCCGCC
GCGGACCAGAACATGGTCTTTGACGACACGGTCAAGCCCATCCTGGACGAGATGCTCGCCGGCTACAACTGCACC
ATCTTCGCCTACGGACAGACGGGCACGGGAAAGACGTACACCATGTCGGGCGACATGACCGAGACGCTGGGCATG
CTCTCCGACGAGGCAGGCATCATCCCGCGCGTGCTCCAGCAGCTCTTCAACAAGCTCGAGATTGACGACACGGAA
AACTGCGTCAAGTGCTCCTTCATCGAGCTCTACAACGAAGAGCTCCGAGACCTGCTGTCGGTGGAGGAGAACGCA
AAACTCAAAATCTTCGACGACGCCTCCCGAAAGGGACACGCCGGCACCATCATCCAGGGCATGGAGGAGAAGCAC
ATCAAGAACGCGTCCGAGGGCATCAAGGTGCTCCAGGACGGCAGCTTGAAGCGCCAGGTGGCGGCGACCAAGTGC
AACGACCTCAGCTCCCGCAGCCACACCGTCTTCACCATCACCGCCTACGTCAAGAAGACCAACGAGCACGGCGTC
GACGACTTCGTCAGCGCCGGCAAGCTCAACCTCGTCGACCTGGCCGGCAGCGAGAACATCCAGCGGTCCGGCGCC
GAGAACAAGCGCGCGGCCGAGGCCGGCCTCATCAACAAGTCGCTGCTCACCCTCGGCCGCGTCATCAACGCGCTC
GTCGACCGCAGCGCCCACATCCCCTACCGCGAGTCCAAGCTGACGCGCCTGCTGCAAGACTCGCTCGGCGGCCGC
ACCAAGACGTGCATCATCGCCACCATATCGCCGGCCAAGAGCAACATGGAGGAGACCATCTCCACGCTCGACTAC
GCCTTCCGCGCCAAGAACATCCGCAACAAGCCGCAGCTGAACCCGATGCTCAACAAGAAGATGCTGCTCAAGGAC
TTCGCCAGCGAGATCGAGAAGCTCAAGAGCGAGCTCATCTCGACCCGCCAACGCAACGGCGTCTACATGTCCAAC
GACGCGTACGAGGAAATGACGGCCCAGAGCGAGTCGCGCCGGATCGTGCTCGAGGAGCAGTCGGCCAAGATCGAG
ACGCTCGAGACGAACCTGCGCAACAAGGTCCAGGAGCTCTTCTCCCTGACGACGACCTTTATGGGCCTGCGCAAG
GATCACGAGGGGACCAAGGTCCAGCTGGACGAGACCAAGGGCGTCCTCGACCAGACCGAGATCGTCCTCGCCGCC
ACGCGCAAGAGCCTGGCCGACGAGACGCAGCTGCGCAAGGCGCACGAGCAGACGGAGGAGAAGCTGACCGAGATC
GGCGGCGAGCTCATCAGCAAGCTCAAGAAGACGGTGCACGACGTCAGCGGCCTGCACGCCAAGAACAAGCGCAAG
TCGGACCTGCAGTCGCTCAACCGGGCCGCCTGGGGCACGTCGCAGGCCCAGGTGGCCGACGTCACGTCCATGGTC
CAGCGCCGCGTGCTCGAGTTCCAGGACGAGCAGCTCGAGCACATCTCGAGCGTCTCGCGGCGCATGGAGGACTTC
GTCGGCGGCGAGCTCGGCAAGCTGTCGGCCACGCAGGCCTTCCTCGACGAGCACCTCGACCTCTTCGTCGACTCG
AAGAGGAGGATGCTGCAGCAGACGCAGACGTCCAAGGACGACTTGGACGAGGCGCTCGAGGAGATCAAGGCGATC
CGCGACGGCGTCAAGGAGAAGGTGGGCGAGAGCCTTCGGGTCATCTCGCACGCCGCCGAGAAGATTTCAGCCGAC
GTACTGCACGAGATGACCAACTTTCACAGCGCCTTGCACAACTCGTACAGCTCCCTCGGCAAGGACTTCAAGTCC
ATCTTCGAAGACCTCGTCAGGCACATCACGGCCCAGCGGACCGAGGCGGACAGCCTCCGCAGACAGCTGCAGAGC
GCGACCAACGCCGTCGTGCTGCAGAACGCGAGCGTGACGACGCGCATCCAGGAGGCCCTGGAGGAGGAGCGCCGG
CAGGCCTGCGAGGACCGGCAGAAGCTGATGGCGCAGATCGCGTCCCTGATGGGCGCGCAGGCCGAGTCGCAGGAG
GCGCGCCTGTCGGAGCGCGCGGCGCAGATGCAAAAGACGGTGACGGAGTCCAACGCGTCGCTCGAGGGGGCGACC
GGCCAGTACGGGCAGGGCATGGAGGCGTGGGACGAGAAGGAGGGCCAGCTGCTGGACGAGGTGCGCAAGTCGCGC
GACCTGCTCAAGACCAAGCTCAAGGACGACTGGACGGCGGCCAACGACAAGAGCACGGCGATCCAGAACACGGCC
AAGTCGGTGCACGCCGAGGCGGTGCGCGTCGTGGACGAGCAGATCGAGGACCTGGACACGCAGATGGAGGCGCTC
GACGACTTCGTGGCGCGGGCGCGGTCCGAGAACGCGTGCCAGCACGAGAAGAACGCGCACTCGGTCCAGGCGCTG
TCGAACACGGTGGAGCGGTCGTTTGCTAACATCTCGGCCCACTTCAAGACGACGTTCGACCGCGTCCGGAACCTG
GGCGAGGAGATGGAGCTCGACGCCAGCGACATGATGGACATTCTCGAGCCGCTCGAGGCGCAGCTGTGCCAGCCC
CTGGCCAACCTGCGCGAAGGCATCGCCTCGACCGCCCTGCACGAGTACCAGCCGACGGGCCAGACGCCGCAGAAG
GTACTTTACACGTACCCGACGAAGCTGCCGCGGACCCAGCCGCGCGACCTGCTCGTCGTCTCCAAGACGGACGGG
GCCCTGACGGCAGAAGACGCACAGGGAGGAGAGGAGGGGCGTTTGAAGGACGAAGGCGGGGAAGAGGACGGGGAC
GAGATGAAGGCCGAGACGGAGCGCGACGACGCCGACGACGACGGCAACGACGGCAACAGCCTCGTCTTCCCCGAC
CTCGACCTCGGCGGCGGACGGAAGATGAGCCTGCCGGCGGCGACGCAGGCCCGGCGGCCGTCCTTGGCCGGCAGC
CTGGACCAACGGAACCGGCTGAGCGTGAGCCTGCGCGAGGTGAGCCCCAACCTGGCGACGGGGCCCCTGGGGCTC
CTCGACGCGCGCGCGAGCATCGCGTCGATGCCGGCCGAGGGCGTCATGGCGATGCTCAGGAAGCAGCAGCCCAAG
AAGCAGGGGGGCGTGGTGGTGGCGGAGGGGAGAGAGAATCTCCCGCCGACGGCCGAGGCCTTCCCGCAGGGCCTG
GGGAGGCGCAAGAGCCCGCGCCTGAACTGA
Gene >Hirsu2|9012
ATGGGGAGCAGCAGTCTGCGCGCCGGCGCCATGAGCCGCAACGGCGCGAGACCGGGCAGCGTGAGGGCATCGACG
GCGCGGCACGCGTCCGCCACGACGGTGACGCGGGGGGCGGGCGCAGCCTCGCCGGCCGGTTCCGTCTCGACCTCG
GGGACGAAGCGCAAGGAGCGCGATTTCGACTCGGAGGCAGGAGGCGAGGAGACCAACATCAACGTCGTGGTGCGC
TGCAGGGGCCGCAACGAGCGCGAGGTCAAAGAGAGCAGCACCGTCGTGGTGCGGACCGACGGCGTCAAGGGGAAG
CTGGTCGAGCTGTCCATGGGAGCCAACGCGCTCAGCAACAAGACGTACAACTTCGACCGCGTGTTCTCCCCCGCC
GCGGACCAGAACATGGTCTTTGACGACACGGTCAAGCCCATCCTGGACGAGGTGAGACGACAGGATTATACCACC
CATGCAGATGACACGTGGAGAGGGAGATCGATGGCTGACCACTTTTTCTTTTCTCTCTTGTAGATGCTCGCCGGC
TACAACTGCACCATCTTCGCCTACGGACAGACGGGCACGGGAAAGACGTACACCATGTCGGGCGACATGACCGAG
ACGCTGGGCATGCTCTCCGACGAGGCAGGCATCATCCCGCGCGTGCTCCAGCAGCTCTTCAACAAGCTCGAGATT
GACGACACGGAAAACTGCGTCAAGTGCTCCTTCATCGAGCTCTACAACGAAGAGCTCCGAGACCTGCTGTCGGTG
GAGGAGAACGCAAAACTCAAAATCTTCGACGACGCCTCCCGAAAGGGACACGCCGGCACCATCATCCAGGGCATG
GAGGAGAAGCACATCAAGAACGCGTCCGAGGGCATCAAGGTGCTCCAGGACGGCAGCTTGAAGCGCCAGGTGGCG
GCGACCAAGTGCAACGACCTCAGCTCCCGCAGCCACACCGTCTTCACCATCACCGCCTACGTCAAGAAGACCAAC
GAGCACGGCGTCGACGACTTCGTCAGCGCCGGCAAGCTCAACCTCGTCGACCTGGCCGGCAGCGAGAACATCCAG
CGGTCCGGCGCCGAGAACAAGCGCGCGGCCGAGGCCGGCCTCATCAACAAGTCGCTGCTCACCCTCGGCCGCGTC
ATCAACGCGCTCGTCGACCGCAGCGCCCACATCCCCTACCGCGAGTCCAAGCTGACGCGCCTGCTGCAAGACTCG
CTCGGCGGCCGCACCAAGACGTGCATCATCGCCACCATATCGCCGGCCAAGAGCAACATGGAGGAGACCATCTCC
ACGCTCGACTACGCCTTCCGCGCCAAGAACATCCGCAACAAGCCGCAGCTGAACCCGATGCTCAACAAGAAGATG
CTGCTCAAGGACTTCGCCAGCGAGATCGAGAAGCTCAAGAGCGAGCTCATCTCGACCCGCCAACGCAACGGCGTC
TACATGTCCAACGACGCGTACGAGGAAATGACGGCCCAGAGCGAGTCGCGCCGGATCGTGCTCGAGGAGCAGTCG
GCCAAGATCGAGACGCTCGAGACGAACCTGCGCAACAAGGTCCAGGAGCTCTTCTCCCTGACGACGACCTTTATG
GGCCTGCGCAAGGATCACGAGGGGACCAAGGTCCAGCTGGACGAGACCAAGGGCGTCCTCGACCAGACCGAGATC
GTCCTCGCCGCCACGCGCAAGAGCCTGGCCGACGAGACGCAGCTGCGCAAGGCGCACGAGCAGACGGAGGAGAAG
CTGACCGAGATCGGCGGCGAGCTCATCAGCAAGCTCAAGAAGACGGTGCACGACGTCAGCGGCCTGCACGCCAAG
AACAAGCGCAAGTCGGACCTGCAGTCGCTCAACCGGGCCGCCTGGGGCACGTCGCAGGCCCAGGTGGCCGACGTC
ACGTCCATGGTCCAGCGCCGCGTGCTCGAGTTCCAGGACGAGCAGCTCGAGCACATCTCGAGCGTCTCGCGGCGC
ATGGAGGACTTCGTCGGCGGCGAGCTCGGCAAGCTGTCGGCCACGCAGGCCTTCCTCGACGAGCACCTCGACCTC
TTCGTCGACTCGAAGAGGAGGATGCTGCAGCAGACGCAGACGTCCAAGGACGACTTGGACGAGGCGCTCGAGGAG
ATCAAGGCGATCCGCGACGGCGTCAAGGAGAAGGTGGGCGAGAGCCTTCGGGTCATCTCGCACGCCGCCGAGAAG
ATTTCAGCCGACGTACTGCACGAGATGACCAACTTTCACAGCGCCGTACGTCTTTCTCGCCCTCCCTCTTCCTCT
TCCTCCTGCTCTCTCTCTCTCTCTCTCTCTCTCTGCCTCTCTCATAAGCGGGCCGCTGACCGACGACCGAACAGT
TGCACAACTCGTACAGCTCCCTCGGCAAGGACTTCAAGTCCATCTTCGAAGACCTCGTCAGGCACATCACGGCCC
AGCGGACCGAGGCGGACAGCCTCCGCAGACAGCTGCAGAGCGCGACCAACGCCGTCGTGCTGCAGAACGCGAGCG
TGACGACGCGCATCCAGGAGGCCCTGGAGGAGGAGCGCCGGCAGGCCTGCGAGGACCGGCAGAAGCTGATGGCGC
AGATCGCGTCCCTGATGGGCGCGCAGGCCGAGTCGCAGGAGGCGCGCCTGTCGGAGCGCGCGGCGCAGATGCAAA
AGACGGTGACGGAGTCCAACGCGTCGCTCGAGGGGGCGACCGGCCAGTACGGGCAGGGCATGGAGGCGTGGGACG
AGAAGGAGGGCCAGCTGCTGGACGAGGTGCGCAAGTCGCGCGACCTGCTCAAGACCAAGCTCAAGGACGACTGGA
CGGCGGCCAACGACAAGAGCACGGCGATCCAGAACACGGCCAAGTCGGTGCACGCCGAGGCGGTGCGCGTCGTGG
ACGAGCAGATCGAGGACCTGGACACGCAGATGGAGGCGCTCGACGACTTCGTGGCGCGGGCGCGGTCCGAGAACG
CGTGCCAGCACGAGAAGAACGCGCACTCGGTCCAGGCGCTGTCGAACACGGTGGAGCGGTCGTTTGCTAACATCT
CGGCCCACTTCAAGACGACGTTCGACCGCGTCCGGAACCTGGGCGAGGAGATGGAGCTCGACGCCAGCGACATGA
TGGACATTCTCGAGCCGCTCGAGGCGCAGCTGTGCCAGCCCCTGGCCAACCTGCGCGAAGGCATCGCCTCGACCG
CCCTGCACGAGTACCAGCCGACGGGCCAGACGCCGCAGAAGGTACTTTACACGTACCCGACGAAGCTGCCGCGGA
CCCAGCCGCGCGACCTGCTCGTCGTCTCCAAGACGGACGGGGCCCTGACGGCAGAAGACGCACAGGGAGGAGAGG
AGGGGCGTTTGAAGGACGAAGGCGGGGAAGAGGACGGGGACGAGATGAAGGCCGAGACGGAGCGCGACGACGCCG
ACGACGACGGCAACGACGGCAACAGCCTCGTCTTCCCCGACCTCGACCTCGGCGGCGGACGGAAGATGAGCCTGC
CGGCGGCGACGCAGGCCCGGCGGCCGTCCTTGGCCGGCAGCCTGGACCAACGGAACCGGCTGAGCGTGAGCCTGC
GCGAGGTGAGCCCCAACCTGGCGACGGGGCCCCTGGGGCTCCTCGACGCGCGCGCGAGCATCGCGTCGATGCCGG
CCGAGGGCGTCATGGCGATGCTCAGGAAGCAGCAGCCCAAGAAGCAGGGGGGCGTGGTGGTGGCGGAGGGGAGAG
AGAATCTCCCGCCGACGGCCGAGGCCTTCCCGCAGGGCCTGGGGAGGCGCAAGAGCCCGCGCCTGAACTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail