Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|9011
Gene name
LocationContig_625:13627..14259
Strand+
Gene length (bp)632
Transcript length (bp)459
Coding sequence length (bp)459
Protein length (aa) 153

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05730 CFEM CFEM domain 3.8E-14 21 87

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|D4AXU8|CFMC_ARTBC GPI-anchored CFEM domain protein ARB_01017 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_01017 PE=3 SV=1 24 128 2.0E-10
sp|G1UB63|CSA1_CANAL Cell wall protein 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CSA1 PE=1 SV=1 8 132 2.0E-06
sp|Q59UT4|RBT5_CANAL Repressed by TUP1 protein 5 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=RBT5 PE=1 SV=1 8 94 3.0E-06
sp|Q59UP6|PGA10_CANAL GPI-anchored protein 10 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=PGA10 PE=1 SV=1 8 94 3.0E-06

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 18 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|9011
MKPALVVVAATASLAAAQDQLDGMPACARDCVAKYTTGSTVGKCKMGDIACICGNKDFLNSIACCLTGVCSQQDL
DKTLKIAKQLCNASGVQVPDKVECNKQAAASSSGSATTSPTGTANRASASSTAAAVPLLASSGGTMVGAALALLA
AL*
Coding >Hirsu2|9011
ATGAAGCCGGCTCTCGTCGTCGTCGCCGCCACCGCCAGCCTGGCTGCAGCCCAAGACCAGCTGGACGGCATGCCT
GCGTGTGCGAGGGATTGTGTCGCCAAGTACACCACAGGATCGACTGTGGGCAAATGCAAGATGGGCGACATTGCC
TGCATCTGCGGCAACAAGGACTTCCTCAATAGCATCGCCTGCTGTCTCACCGGCGTCTGCAGCCAGCAGGACCTG
GACAAGACGCTCAAGATTGCCAAGCAGCTCTGCAACGCTTCGGGCGTCCAGGTCCCGGACAAGGTCGAGTGCAAC
AAGCAGGCCGCGGCCTCGTCGTCCGGCTCGGCCACGACGTCGCCCACCGGCACCGCCAACCGCGCCTCGGCCTCG
TCGACCGCCGCCGCCGTCCCGCTCCTCGCCTCCTCGGGCGGCACCATGGTCGGCGCCGCCTTGGCCCTCTTGGCC
GCCCTCTGA
Transcript >Hirsu2|9011
ATGAAGCCGGCTCTCGTCGTCGTCGCCGCCACCGCCAGCCTGGCTGCAGCCCAAGACCAGCTGGACGGCATGCCT
GCGTGTGCGAGGGATTGTGTCGCCAAGTACACCACAGGATCGACTGTGGGCAAATGCAAGATGGGCGACATTGCC
TGCATCTGCGGCAACAAGGACTTCCTCAATAGCATCGCCTGCTGTCTCACCGGCGTCTGCAGCCAGCAGGACCTG
GACAAGACGCTCAAGATTGCCAAGCAGCTCTGCAACGCTTCGGGCGTCCAGGTCCCGGACAAGGTCGAGTGCAAC
AAGCAGGCCGCGGCCTCGTCGTCCGGCTCGGCCACGACGTCGCCCACCGGCACCGCCAACCGCGCCTCGGCCTCG
TCGACCGCCGCCGCCGTCCCGCTCCTCGCCTCCTCGGGCGGCACCATGGTCGGCGCCGCCTTGGCCCTCTTGGCC
GCCCTCTGA
Gene >Hirsu2|9011
ATGAAGCCGGCTCTCGTCGTCGTCGCCGCCACCGCCAGCCTGGCTGCAGCCCAAGACCAGCTGGACGGCATGCCT
GCGTGTGCGGTACGTCGGCATTGGCCACGAATGTGTGACGCAGTCTGGCCAACAAGACCTTTCCCCATTCCCTCC
CTCCCTCCCCTCCCCTCCCCAGACCGGCCTTCGCGGGGGACTTGGTCGCTGACGACGACGGCCTCTTCTTCTTTC
CTTCTTCTCTTACCCTCTTTACCGGCACGCAGAGGGATTGTGTCGCCAAGTACACCACAGGATCGACTGTGGGCA
AATGCAAGATGGGCGACATTGCCTGCATCTGCGGCAACAAGGACTTCCTCAATAGCATCGCCTGCTGTCTCACCG
GCGTCTGCAGCCAGCAGGACCTGGACAAGACGCTCAAGATTGCCAAGCAGCTCTGCAACGCTTCGGGCGTCCAGG
TCCCGGACAAGGTCGAGTGCAACAAGCAGGCCGCGGCCTCGTCGTCCGGCTCGGCCACGACGTCGCCCACCGGCA
CCGCCAACCGCGCCTCGGCCTCGTCGACCGCCGCCGCCGTCCCGCTCCTCGCCTCCTCGGGCGGCACCATGGTCG
GCGCCGCCTTGGCCCTCTTGGCCGCCCTCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail