Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|9007
Gene name
LocationContig_624:13428..13983
Strand+
Gene length (bp)555
Transcript length (bp)375
Coding sequence length (bp)375
Protein length (aa) 125

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07960 CBP4 CBP4 2.7E-27 8 115

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q7SDU5|CBP4_NEUCR Assembly factor cbp-4 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=cbp-4 PE=3 SV=1 1 120 4.0E-44
sp|Q2H4Y0|CBP4_CHAGB Assembly factor CBP4 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=CBP4 PE=3 SV=2 5 120 2.0E-37
sp|A4RC22|CBP4_MAGO7 Assembly factor CBP4 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=CBP4 PE=3 SV=1 1 121 1.0E-35
sp|A7EJE5|CBP4_SCLS1 Assembly factor cbp4 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=cbp4 PE=3 SV=1 3 124 6.0E-32
sp|A6SAY2|CBP4_BOTFB Assembly factor cbp4 OS=Botryotinia fuckeliana (strain B05.10) GN=cbp4 PE=3 SV=1 3 124 2.0E-31
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q7SDU5|CBP4_NEUCR Assembly factor cbp-4 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=cbp-4 PE=3 SV=1 1 120 4.0E-44
sp|Q2H4Y0|CBP4_CHAGB Assembly factor CBP4 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=CBP4 PE=3 SV=2 5 120 2.0E-37
sp|A4RC22|CBP4_MAGO7 Assembly factor CBP4 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=CBP4 PE=3 SV=1 1 121 1.0E-35
sp|A7EJE5|CBP4_SCLS1 Assembly factor cbp4 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=cbp4 PE=3 SV=1 3 124 6.0E-32
sp|A6SAY2|CBP4_BOTFB Assembly factor cbp4 OS=Botryotinia fuckeliana (strain B05.10) GN=cbp4 PE=3 SV=1 3 124 2.0E-31
sp|A1CMM2|CBP4_ASPCL Assembly factor cbp4 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=cbp4 PE=3 SV=1 12 116 8.0E-31
sp|A1DLB6|CBP4_NEOFI Assembly factor cbp4 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=cbp4 PE=3 SV=1 12 116 2.0E-30
sp|Q2UE23|CBP4_ASPOR Assembly factor cbp4 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=cbp4 PE=3 SV=2 12 116 1.0E-29
sp|A2R065|CBP4_ASPNC Assembly factor cbp4 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=cbp4 PE=3 SV=2 12 116 2.0E-29
sp|Q0CGN5|CBP4_ASPTN Assembly factor cbp4 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=cbp4 PE=3 SV=1 12 116 9.0E-29
sp|Q1DHX9|CBP4_COCIM Assembly factor CBP4 OS=Coccidioides immitis (strain RS) GN=CBP4 PE=3 SV=1 12 93 2.0E-28
sp|Q5ASG4|CBP4_EMENI Assembly factor cbp4 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=cbp4 PE=3 SV=1 12 116 2.0E-27
sp|Q0ULB7|CBP4_PHANO Assembly factor CBP4 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=CBP4 PE=3 SV=2 12 100 2.0E-25
sp|A6R620|CBP4_AJECN Assembly factor CBP4 OS=Ajellomyces capsulatus (strain NAm1 / WU24) GN=CBP4 PE=3 SV=1 13 116 7.0E-25
sp|A3LQD9|CBP4_PICST Assembly factor CBP4 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=CBP4 PE=3 SV=1 4 115 2.0E-08
sp|Q6FVS6|CBP4_CANGA Assembly factor CBP4 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=CBP4 PE=3 SV=1 9 115 5.0E-08
sp|Q6C5S0|CBP4_YARLI Assembly factor CBP4 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=CBP4 PE=3 SV=1 3 83 2.0E-07
sp|Q59QC6|CBP4_CANAL Assembly factor CBP4 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CBP4 PE=3 SV=1 1 81 3.0E-07
sp|Q6BI17|CBP4_DEBHA Assembly factor CBP4 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=CBP4 PE=3 SV=2 5 81 2.0E-06
sp|A7TFK6|CBP4_VANPO Assembly factor CBP4 OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=CBP4 PE=3 SV=1 9 115 5.0E-06
sp|A5DM93|CBP4_PICGU Assembly factor CBP4 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=CBP4 PE=3 SV=2 9 81 5.0E-06
sp|A5DTG8|CBP4_LODEL Assembly factor CBP4 OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=CBP4 PE=3 SV=1 5 81 6.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.5

Transmembrane Domains

Domain # Start End Length
1 12 34 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|9007
MAPAKPINWRLWAKVLIGGTVVSVGGPALTWWLTPTEEELRSRYNPDLRKKSIEQREEREQEFDEFVTRLKAYSK
SDKPIWIVVKEEEERRKKAALAAGRQKQREAETQREEMRREAGLPPGNN*
Coding >Hirsu2|9007
ATGGCGCCCGCCAAGCCGATCAATTGGAGGCTCTGGGCCAAGGTGCTGATAGGCGGCACCGTGGTCAGCGTGGGC
GGACCGGCCCTTACGTGGTGGCTGACGCCGACGGAGGAGGAGCTGCGGTCGCGCTACAACCCGGACCTGCGCAAG
AAGAGCATCGAGCAGCGCGAGGAGCGCGAGCAGGAGTTTGACGAGTTCGTCACGCGCCTCAAGGCGTACTCCAAG
TCGGATAAGCCGATCTGGATCGTGGTCAAGGAGGAGGAGGAGCGGCGCAAGAAGGCGGCGCTGGCGGCGGGCCGG
CAGAAGCAGCGCGAGGCGGAGACGCAGCGCGAGGAGATGAGGCGCGAGGCAGGCCTGCCGCCCGGCAACAACTAG
Transcript >Hirsu2|9007
ATGGCGCCCGCCAAGCCGATCAATTGGAGGCTCTGGGCCAAGGTGCTGATAGGCGGCACCGTGGTCAGCGTGGGC
GGACCGGCCCTTACGTGGTGGCTGACGCCGACGGAGGAGGAGCTGCGGTCGCGCTACAACCCGGACCTGCGCAAG
AAGAGCATCGAGCAGCGCGAGGAGCGCGAGCAGGAGTTTGACGAGTTCGTCACGCGCCTCAAGGCGTACTCCAAG
TCGGATAAGCCGATCTGGATCGTGGTCAAGGAGGAGGAGGAGCGGCGCAAGAAGGCGGCGCTGGCGGCGGGCCGG
CAGAAGCAGCGCGAGGCGGAGACGCAGCGCGAGGAGATGAGGCGCGAGGCAGGCCTGCCGCCCGGCAACAACTAG
Gene >Hirsu2|9007
ATGGCGCCCGCCAAGCCGATCAATTGGAGGCTCTGGGCCAAGGTGCTGATAGGGTAGGTGTAGACGGACCGGGGG
GCGGACAAGGACGCGAGCTTGCTGACTTTTTTCTCTCTTCTTTGCTCGCAGCGGCACCGTGGTCAGCGTGGGCGG
ACCGGCCCTTACGTGGTGGCTGACGCCGACGGAGGAGGAGCTGCGGTCGCGCTACAACCCGGACCTGCGCAAGAA
GAGCATCGAGCAGCGCGAGGAGCGCGAGCAGGAGTTTGACGAGTTCGTCACGCGCCTCAAGGCGTACTCCAAGTC
GGATAAGCCGAGTCCGTCAACCCCCCTTTTGTCTTTCCCCCTTTCCCGAGAGAAGCAGGAAGAGGAGAGGGGGAA
AAAAAACAAAAGGACAGGCGGGCTAACATTCCTTCCTTGGCAGTCTGGATCGTGGTCAAGGAGGAGGAGGAGCGG
CGCAAGAAGGCGGCGCTGGCGGCGGGCCGGCAGAAGCAGCGCGAGGCGGAGACGCAGCGCGAGGAGATGAGGCGC
GAGGCAGGCCTGCCGCCCGGCAACAACTAG

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail