Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|9006
Gene name
LocationContig_624:8648..12512
Strand+
Gene length (bp)3864
Transcript length (bp)3801
Coding sequence length (bp)3801
Protein length (aa) 1267

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05183 RdRP RNA dependent RNA polymerase 4.1E-188 370 937

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O14227|RDR1_SCHPO RNA-dependent RNA polymerase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rdr1 PE=1 SV=1 289 1105 9.0E-158
sp|Q9LQV2|RDR1_ARATH RNA-dependent RNA polymerase 1 OS=Arabidopsis thaliana GN=RDR1 PE=2 SV=1 280 1019 6.0E-119
sp|Q0DXS3|RDR1_ORYSJ Probable RNA-dependent RNA polymerase 1 OS=Oryza sativa subsp. japonica GN=RDR1 PE=2 SV=2 373 1118 1.0E-111
sp|Q8LHH9|SHL2_ORYSJ Probable RNA-dependent RNA polymerase SHL2 OS=Oryza sativa subsp. japonica GN=SHL2 PE=2 SV=1 204 998 4.0E-111
sp|Q9SG02|RDR6_ARATH RNA-dependent RNA polymerase 6 OS=Arabidopsis thaliana GN=RDR6 PE=1 SV=1 285 1035 2.0E-108
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O14227|RDR1_SCHPO RNA-dependent RNA polymerase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rdr1 PE=1 SV=1 289 1105 9.0E-158
sp|Q9LQV2|RDR1_ARATH RNA-dependent RNA polymerase 1 OS=Arabidopsis thaliana GN=RDR1 PE=2 SV=1 280 1019 6.0E-119
sp|Q0DXS3|RDR1_ORYSJ Probable RNA-dependent RNA polymerase 1 OS=Oryza sativa subsp. japonica GN=RDR1 PE=2 SV=2 373 1118 1.0E-111
sp|Q8LHH9|SHL2_ORYSJ Probable RNA-dependent RNA polymerase SHL2 OS=Oryza sativa subsp. japonica GN=SHL2 PE=2 SV=1 204 998 4.0E-111
sp|Q9SG02|RDR6_ARATH RNA-dependent RNA polymerase 6 OS=Arabidopsis thaliana GN=RDR6 PE=1 SV=1 285 1035 2.0E-108
sp|Q7XM31|RDR2_ORYSJ Probable RNA-dependent RNA polymerase 2 OS=Oryza sativa subsp. japonica GN=RDR2 PE=2 SV=1 281 934 1.0E-103
sp|O82504|RDR2_ARATH RNA-dependent RNA polymerase 2 OS=Arabidopsis thaliana GN=RDR2 PE=1 SV=1 137 1104 3.0E-103
sp|O82188|RDR5_ARATH Probable RNA-dependent RNA polymerase 5 OS=Arabidopsis thaliana GN=RDR5 PE=2 SV=2 433 943 1.0E-26
sp|O82189|RDR4_ARATH Probable RNA-dependent RNA polymerase 4 OS=Arabidopsis thaliana GN=RDR4 PE=3 SV=2 421 943 5.0E-25
sp|O82190|RDR3_ARATH Probable RNA-dependent RNA polymerase 3 OS=Arabidopsis thaliana GN=RDR3 PE=3 SV=2 433 1043 1.0E-23
sp|Q5QMN5|RDR3_ORYSJ Probable RNA-dependent RNA polymerase 3 OS=Oryza sativa subsp. japonica GN=RDR3 PE=2 SV=2 478 995 2.0E-21
sp|Q5QMN4|RDR4_ORYSJ Probable RNA-dependent RNA polymerase 4 OS=Oryza sativa subsp. japonica GN=RDR4 PE=2 SV=2 478 936 9.0E-19
[Show less]

GO

GO Term Description Terminal node
GO:0003968 RNA-directed 5'-3' RNA polymerase activity Yes
GO:0140098 catalytic activity, acting on RNA No
GO:0034062 5'-3' RNA polymerase activity No
GO:0097747 RNA polymerase activity No
GO:0016740 transferase activity No
GO:0003674 molecular_function No
GO:0016779 nucleotidyltransferase activity No
GO:0003824 catalytic activity No
GO:0016772 transferase activity, transferring phosphorus-containing groups No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 17 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|9006
MTFKHQPKRAFWASGRPVPYHHPDKRRFPHGIPIKAELDGSAARLRDRPAKAVVGLRQLDFGNTTAPTAMTIMKS
LMASSNLGDMEMELNIETRQLAVYFALAAPTVHAGSRQFRFEVDLSQARKVYQTVLDDGSIAWVLHLARPPKYFW
RMDDVEATFTPDARTWGPRDVWYRATNVAQDLDTPMRYPVAVHNEIKDPDYAEIGCWTTFRLVVADKFRRRPESR
ALSQLRKGLEELNVSVEYCDAFSFPRGGETMWDYLDHPPLTDKGHGSALLAMAAPPIIHLPFPVRYQLEVCVSRG
MLNENSITADFLHRLAALRPFDATRRLEYLADQNEPLYDPLQLFADSDAESYVPNTKIPHYCTLIRKAIITPTAI
RYNSPAVEASNRVVRKYNHLQDRFLRVQFVEEAEQGRIAFNYRNNDEIFRRMLRVLFNGIRIGDRLYEFLGFGNS
QLRECGAYFFCPTEHTSCDDIRGWMGNFSHIRVVAKYAARLGQCFSSTREIRGIFTPKTRRIPDVERNGFVFTDG
VGIISPFLARLVIQEMALDVLDEPTAFQFRMGGCKGVLAVWPQAKGMEVLVRDSQKKFTAVFNGLEIIKCAKYST
ATLNRQTIPILECLGVPKSAFVALLDHQIREYESAMKDNSVAVSLLTKFVDENQSTLILAELLKAGFRSDSVQEP
FTVNLMNLWRSWTLKLLKEKARINIDKSAFVLGCVDETHTLRGHSKATEGSSDNDVNKLPQIFLQLTDPARCDQT
IIIKGLCAIGRNPSLHPGDIRVVQAVDNPKLRHLKDVVVFPSKGDRPVPSMLAGGDLDGDDYFVIWDPNLIPREW
NYSPMEYSAPKPKKISRDVNIDDVRDFFVEYMKSDVLGQIAHAHVAYADSQGPKSQRCVQLAGLHSEAVDFPKTG
KPAEIGSKLQPERWPHFMEKRRWYESKRALGVIYDKVKSRTVEFRPDWQHAFDQRITTKFELENGQLEAARRIKA
QYDLAVRRILAQLNVATEFELYTSWAMSKPAVESDYKRQEQLGREFDLLKARHRELCYEAAGGSDPDKLDRFVAA
MYRVTEQEMHAALREHEERAGDGSGGTAAPMPVDARSMPLISFPWIFHWVLIRIATGSKYKPKESLFAAAERAAQ
SAAGSLAARSLSALSAEGSAGGGSSEENGAAAGTTSLWAEAAPTPALVPVPAPAPASAAAAAASPAPPASTNMDY
GGSRDTDGWLSEQARDISEPVLMGDEEDEGISSDSEAETLVGEEEPVNGSAMDRLAALMDFGEDEV*
Coding >Hirsu2|9006
ATGACCTTCAAGCATCAACCGAAGCGTGCTTTCTGGGCCTCTGGCCGTCCGGTCCCCTATCATCATCCCGATAAA
CGGAGATTTCCTCATGGAATACCCATCAAGGCTGAGTTGGACGGCAGCGCCGCCCGCCTGCGCGATCGTCCGGCC
AAAGCCGTGGTCGGCCTTCGACAGCTTGACTTCGGAAATACGACGGCGCCGACGGCAATGACCATCATGAAATCC
CTCATGGCCTCGTCCAATCTGGGGGATATGGAGATGGAGCTCAACATCGAGACCAGGCAGCTTGCCGTCTACTTC
GCTCTCGCCGCACCGACCGTTCACGCCGGCTCAAGACAGTTTCGCTTCGAAGTGGACCTGTCGCAAGCCCGCAAG
GTGTACCAGACCGTGCTCGACGACGGTAGCATTGCCTGGGTGCTTCATCTGGCCCGCCCGCCCAAGTATTTCTGG
CGAATGGACGACGTCGAGGCCACCTTCACGCCTGATGCCCGGACCTGGGGGCCCAGGGACGTCTGGTACCGAGCC
ACCAATGTGGCCCAGGACCTGGACACGCCCATGCGATATCCCGTCGCCGTCCACAATGAGATCAAGGACCCGGAC
TATGCGGAGATTGGCTGCTGGACCACCTTTCGTCTCGTCGTTGCGGATAAGTTCCGCCGCCGCCCCGAAAGCCGA
GCCCTGTCGCAGCTGCGGAAGGGACTTGAAGAACTCAACGTATCCGTCGAGTACTGCGACGCCTTCAGCTTCCCA
AGGGGCGGCGAGACCATGTGGGACTACCTGGACCACCCGCCCCTAACCGACAAAGGCCATGGCTCTGCCTTGCTT
GCCATGGCGGCGCCGCCCATCATCCACCTGCCCTTCCCGGTGCGGTACCAGCTCGAGGTTTGCGTCTCCCGGGGC
ATGCTCAACGAGAACTCCATCACGGCCGACTTCCTGCACCGCCTCGCCGCTCTCCGGCCCTTTGATGCCACCCGT
CGCCTCGAGTACCTCGCCGACCAGAACGAGCCCCTATACGATCCCCTGCAGCTCTTCGCCGATTCCGACGCCGAG
TCGTACGTTCCAAACACCAAGATCCCGCACTACTGCACCCTCATCCGAAAGGCCATCATCACCCCGACCGCCATC
CGCTACAACTCGCCGGCCGTCGAGGCGTCCAACCGGGTCGTCCGGAAATACAACCATCTGCAGGACCGCTTCTTG
CGCGTCCAGTTTGTCGAAGAGGCAGAGCAGGGCCGGATCGCCTTCAACTACAGAAACAACGACGAAATCTTCCGC
CGCATGCTTCGCGTTCTCTTCAATGGCATCCGCATCGGCGACCGCCTGTACGAGTTCCTCGGCTTCGGCAACTCG
CAGCTCAGGGAATGCGGCGCCTACTTCTTCTGCCCGACCGAGCACACGTCGTGCGACGATATCCGAGGATGGATG
GGCAACTTCAGCCACATCCGAGTCGTCGCCAAGTATGCGGCCCGCCTCGGCCAGTGCTTCTCCTCGACGAGGGAG
ATCCGCGGCATCTTTACGCCGAAAACACGGCGCATCCCCGATGTCGAGAGGAACGGCTTCGTCTTCACGGACGGC
GTGGGCATCATTTCCCCGTTCTTGGCCCGCCTCGTCATCCAGGAGATGGCCCTCGACGTGCTCGACGAGCCGACG
GCCTTTCAGTTCCGCATGGGCGGCTGCAAGGGCGTCTTGGCCGTGTGGCCCCAGGCCAAGGGCATGGAAGTCCTC
GTGCGGGACTCGCAGAAGAAGTTCACGGCCGTGTTCAACGGCCTGGAGATCATCAAGTGCGCCAAGTACTCGACG
GCGACACTCAACCGGCAGACGATACCCATCCTCGAGTGCCTCGGGGTGCCGAAGAGCGCCTTTGTCGCCCTCTTG
GACCATCAGATCCGGGAGTATGAGAGCGCCATGAAGGACAACTCGGTCGCCGTAAGCCTGCTGACCAAGTTCGTG
GACGAAAACCAGTCGACGCTCATCCTGGCGGAACTGCTCAAGGCCGGCTTCAGGAGCGACAGCGTGCAGGAGCCA
TTCACGGTGAACCTGATGAACCTCTGGAGATCGTGGACGCTGAAGCTGCTCAAGGAAAAGGCGCGAATCAACATT
GACAAGAGCGCCTTTGTTCTCGGCTGCGTCGACGAGACGCACACGCTGAGGGGACACTCGAAAGCGACGGAGGGC
TCGTCCGACAACGACGTCAACAAACTGCCCCAGATATTCCTGCAGCTCACAGACCCGGCTCGGTGCGATCAGACC
ATCATCATCAAGGGCCTCTGCGCCATCGGCCGGAACCCTTCCCTGCACCCTGGCGACATCCGGGTCGTCCAAGCC
GTGGACAACCCCAAGCTTCGCCACCTCAAGGACGTGGTCGTGTTCCCCTCCAAGGGAGATCGCCCGGTTCCAAGC
ATGCTGGCCGGAGGCGACCTGGACGGCGACGACTACTTCGTCATCTGGGATCCCAACCTCATACCCAGAGAATGG
AACTACTCGCCCATGGAATACTCGGCCCCGAAGCCCAAGAAGATCTCGAGGGACGTGAACATTGATGATGTTCGC
GACTTCTTTGTTGAATATATGAAGAGCGACGTCTTGGGCCAGATTGCACACGCACATGTGGCATACGCGGACAGC
CAAGGGCCCAAGTCGCAGAGATGCGTCCAATTGGCCGGATTGCACTCCGAAGCCGTCGACTTCCCCAAAACTGGG
AAACCGGCCGAAATCGGGTCCAAGCTGCAACCAGAACGGTGGCCACACTTCATGGAGAAGAGGAGATGGTATGAG
TCCAAACGAGCTCTGGGCGTCATCTACGACAAGGTGAAGAGTCGGACCGTTGAATTTCGGCCCGACTGGCAACAT
GCATTTGACCAGAGGATCACGACAAAATTCGAACTGGAGAATGGCCAGCTCGAGGCGGCCAGGCGCATCAAGGCC
CAGTACGACCTGGCCGTCCGCCGAATCCTTGCTCAGCTCAACGTGGCGACCGAGTTTGAGCTGTACACGTCATGG
GCCATGTCGAAGCCGGCGGTGGAGTCGGACTACAAGCGGCAGGAACAGCTCGGCCGCGAGTTCGACCTCCTGAAG
GCGCGCCACCGCGAGCTGTGCTACGAGGCAGCGGGCGGCAGCGACCCTGACAAGCTGGACAGGTTCGTGGCGGCC
ATGTACAGGGTAACGGAGCAAGAGATGCATGCCGCGCTCCGCGAGCACGAGGAGAGGGCCGGGGACGGGTCCGGC
GGAACGGCGGCGCCGATGCCGGTGGATGCCAGATCGATGCCCCTCATCAGCTTCCCCTGGATATTCCACTGGGTG
TTGATTCGCATCGCCACGGGCAGCAAGTACAAGCCCAAGGAGTCCCTCTTCGCGGCGGCAGAGCGTGCAGCGCAG
AGCGCCGCCGGCTCGCTGGCGGCTCGAAGCCTGTCTGCCCTATCCGCCGAGGGCAGCGCGGGCGGAGGGTCCAGC
GAGGAGAACGGGGCAGCCGCCGGCACCACGAGTCTATGGGCCGAGGCAGCACCAACTCCAGCACTAGTACCAGTA
CCAGCACCAGCACCAGCATCAGCAGCGGCGGCGGCGGCATCACCAGCACCACCAGCGAGCACAAACATGGACTAT
GGTGGCAGCCGCGACACGGACGGGTGGTTGAGCGAGCAGGCGAGGGACATTTCGGAGCCGGTGCTGATGGGCGAC
GAAGAAGACGAGGGTATCTCAAGCGATTCCGAGGCGGAGACGCTGGTTGGGGAGGAGGAGCCCGTGAATGGGAGC
GCGATGGACCGGCTGGCTGCTCTCATGGATTTCGGCGAGGACGAAGTATAG
Transcript >Hirsu2|9006
ATGACCTTCAAGCATCAACCGAAGCGTGCTTTCTGGGCCTCTGGCCGTCCGGTCCCCTATCATCATCCCGATAAA
CGGAGATTTCCTCATGGAATACCCATCAAGGCTGAGTTGGACGGCAGCGCCGCCCGCCTGCGCGATCGTCCGGCC
AAAGCCGTGGTCGGCCTTCGACAGCTTGACTTCGGAAATACGACGGCGCCGACGGCAATGACCATCATGAAATCC
CTCATGGCCTCGTCCAATCTGGGGGATATGGAGATGGAGCTCAACATCGAGACCAGGCAGCTTGCCGTCTACTTC
GCTCTCGCCGCACCGACCGTTCACGCCGGCTCAAGACAGTTTCGCTTCGAAGTGGACCTGTCGCAAGCCCGCAAG
GTGTACCAGACCGTGCTCGACGACGGTAGCATTGCCTGGGTGCTTCATCTGGCCCGCCCGCCCAAGTATTTCTGG
CGAATGGACGACGTCGAGGCCACCTTCACGCCTGATGCCCGGACCTGGGGGCCCAGGGACGTCTGGTACCGAGCC
ACCAATGTGGCCCAGGACCTGGACACGCCCATGCGATATCCCGTCGCCGTCCACAATGAGATCAAGGACCCGGAC
TATGCGGAGATTGGCTGCTGGACCACCTTTCGTCTCGTCGTTGCGGATAAGTTCCGCCGCCGCCCCGAAAGCCGA
GCCCTGTCGCAGCTGCGGAAGGGACTTGAAGAACTCAACGTATCCGTCGAGTACTGCGACGCCTTCAGCTTCCCA
AGGGGCGGCGAGACCATGTGGGACTACCTGGACCACCCGCCCCTAACCGACAAAGGCCATGGCTCTGCCTTGCTT
GCCATGGCGGCGCCGCCCATCATCCACCTGCCCTTCCCGGTGCGGTACCAGCTCGAGGTTTGCGTCTCCCGGGGC
ATGCTCAACGAGAACTCCATCACGGCCGACTTCCTGCACCGCCTCGCCGCTCTCCGGCCCTTTGATGCCACCCGT
CGCCTCGAGTACCTCGCCGACCAGAACGAGCCCCTATACGATCCCCTGCAGCTCTTCGCCGATTCCGACGCCGAG
TCGTACGTTCCAAACACCAAGATCCCGCACTACTGCACCCTCATCCGAAAGGCCATCATCACCCCGACCGCCATC
CGCTACAACTCGCCGGCCGTCGAGGCGTCCAACCGGGTCGTCCGGAAATACAACCATCTGCAGGACCGCTTCTTG
CGCGTCCAGTTTGTCGAAGAGGCAGAGCAGGGCCGGATCGCCTTCAACTACAGAAACAACGACGAAATCTTCCGC
CGCATGCTTCGCGTTCTCTTCAATGGCATCCGCATCGGCGACCGCCTGTACGAGTTCCTCGGCTTCGGCAACTCG
CAGCTCAGGGAATGCGGCGCCTACTTCTTCTGCCCGACCGAGCACACGTCGTGCGACGATATCCGAGGATGGATG
GGCAACTTCAGCCACATCCGAGTCGTCGCCAAGTATGCGGCCCGCCTCGGCCAGTGCTTCTCCTCGACGAGGGAG
ATCCGCGGCATCTTTACGCCGAAAACACGGCGCATCCCCGATGTCGAGAGGAACGGCTTCGTCTTCACGGACGGC
GTGGGCATCATTTCCCCGTTCTTGGCCCGCCTCGTCATCCAGGAGATGGCCCTCGACGTGCTCGACGAGCCGACG
GCCTTTCAGTTCCGCATGGGCGGCTGCAAGGGCGTCTTGGCCGTGTGGCCCCAGGCCAAGGGCATGGAAGTCCTC
GTGCGGGACTCGCAGAAGAAGTTCACGGCCGTGTTCAACGGCCTGGAGATCATCAAGTGCGCCAAGTACTCGACG
GCGACACTCAACCGGCAGACGATACCCATCCTCGAGTGCCTCGGGGTGCCGAAGAGCGCCTTTGTCGCCCTCTTG
GACCATCAGATCCGGGAGTATGAGAGCGCCATGAAGGACAACTCGGTCGCCGTAAGCCTGCTGACCAAGTTCGTG
GACGAAAACCAGTCGACGCTCATCCTGGCGGAACTGCTCAAGGCCGGCTTCAGGAGCGACAGCGTGCAGGAGCCA
TTCACGGTGAACCTGATGAACCTCTGGAGATCGTGGACGCTGAAGCTGCTCAAGGAAAAGGCGCGAATCAACATT
GACAAGAGCGCCTTTGTTCTCGGCTGCGTCGACGAGACGCACACGCTGAGGGGACACTCGAAAGCGACGGAGGGC
TCGTCCGACAACGACGTCAACAAACTGCCCCAGATATTCCTGCAGCTCACAGACCCGGCTCGGTGCGATCAGACC
ATCATCATCAAGGGCCTCTGCGCCATCGGCCGGAACCCTTCCCTGCACCCTGGCGACATCCGGGTCGTCCAAGCC
GTGGACAACCCCAAGCTTCGCCACCTCAAGGACGTGGTCGTGTTCCCCTCCAAGGGAGATCGCCCGGTTCCAAGC
ATGCTGGCCGGAGGCGACCTGGACGGCGACGACTACTTCGTCATCTGGGATCCCAACCTCATACCCAGAGAATGG
AACTACTCGCCCATGGAATACTCGGCCCCGAAGCCCAAGAAGATCTCGAGGGACGTGAACATTGATGATGTTCGC
GACTTCTTTGTTGAATATATGAAGAGCGACGTCTTGGGCCAGATTGCACACGCACATGTGGCATACGCGGACAGC
CAAGGGCCCAAGTCGCAGAGATGCGTCCAATTGGCCGGATTGCACTCCGAAGCCGTCGACTTCCCCAAAACTGGG
AAACCGGCCGAAATCGGGTCCAAGCTGCAACCAGAACGGTGGCCACACTTCATGGAGAAGAGGAGATGGTATGAG
TCCAAACGAGCTCTGGGCGTCATCTACGACAAGGTGAAGAGTCGGACCGTTGAATTTCGGCCCGACTGGCAACAT
GCATTTGACCAGAGGATCACGACAAAATTCGAACTGGAGAATGGCCAGCTCGAGGCGGCCAGGCGCATCAAGGCC
CAGTACGACCTGGCCGTCCGCCGAATCCTTGCTCAGCTCAACGTGGCGACCGAGTTTGAGCTGTACACGTCATGG
GCCATGTCGAAGCCGGCGGTGGAGTCGGACTACAAGCGGCAGGAACAGCTCGGCCGCGAGTTCGACCTCCTGAAG
GCGCGCCACCGCGAGCTGTGCTACGAGGCAGCGGGCGGCAGCGACCCTGACAAGCTGGACAGGTTCGTGGCGGCC
ATGTACAGGGTAACGGAGCAAGAGATGCATGCCGCGCTCCGCGAGCACGAGGAGAGGGCCGGGGACGGGTCCGGC
GGAACGGCGGCGCCGATGCCGGTGGATGCCAGATCGATGCCCCTCATCAGCTTCCCCTGGATATTCCACTGGGTG
TTGATTCGCATCGCCACGGGCAGCAAGTACAAGCCCAAGGAGTCCCTCTTCGCGGCGGCAGAGCGTGCAGCGCAG
AGCGCCGCCGGCTCGCTGGCGGCTCGAAGCCTGTCTGCCCTATCCGCCGAGGGCAGCGCGGGCGGAGGGTCCAGC
GAGGAGAACGGGGCAGCCGCCGGCACCACGAGTCTATGGGCCGAGGCAGCACCAACTCCAGCACTAGTACCAGTA
CCAGCACCAGCACCAGCATCAGCAGCGGCGGCGGCGGCATCACCAGCACCACCAGCGAGCACAAACATGGACTAT
GGTGGCAGCCGCGACACGGACGGGTGGTTGAGCGAGCAGGCGAGGGACATTTCGGAGCCGGTGCTGATGGGCGAC
GAAGAAGACGAGGGTATCTCAAGCGATTCCGAGGCGGAGACGCTGGTTGGGGAGGAGGAGCCCGTGAATGGGAGC
GCGATGGACCGGCTGGCTGCTCTCATGGATTTCGGCGAGGACGAAGTATAG
Gene >Hirsu2|9006
ATGACCTTCAAGCATCAACCGAAGCGTGCTTTCTGGGCCTCTGGCCGTCCGGTCCCCTATCATCATCCCGATAAA
CGGAGATTTCCTCATGGAATACCCATCAAGGCTGAGTTGGACGGCAGCGCCGCCCGCCTGCGCGATCGTCCGGCC
AAAGCCGTGGTCGGCCTTCGACAGCTTGACTTCGGAAATACGACGGCGCCGACGGCAATGACCATCATGAAATCC
CTCATGGCCTCGTCCAATCTGGGGGATATGGAGATGGAGCTCAACATCGAGACCAGGCAGCTTGCCGTCTACTTC
GCTCTCGCCGCACCGACCGTTCACGCCGGCTCAAGACAGTTTCGCTTCGAAGTGGACCTGTCGCAAGCCCGCAAG
GTGTACCAGACCGTGCTCGACGACGGTAGCATTGCCTGGGTGCTTCATCTGGCCCGCCCGCCCAAGTATTTCTGG
CGAATGGACGACGTCGAGGCCACCTTCACGCCTGATGCCCGGACCTGGGGGCCCAGGGACGTCTGGTACCGAGCC
ACCAATGTGGCCCAGGACCTGGACACGCCCATGCGATATCCCGTCGCCGTCCACAATGAGATCAAGGACCCGGAC
TATGCGGAGATTGGCTGCTGGACCACCTTTCGTCTCGTCGTTGCGGATAAGTTCCGCCGCCGCCCCGAAAGCCGA
GCCCTGTCGCAGCTGCGGAAGGGACTTGAAGAACTCAACGTATCCGTCGAGTACTGCGACGCCTTCAGCTTCCCA
AGGGGCGGCGAGACCATGTGGGACTACCTGGACCACCCGCCCCTAACCGACAAAGGCCATGGCTCTGCCTTGCTT
GCCATGGCGGCGCCGCCCATCATCCACCTGCCCTTCCCGGTGCGGTACCAGCTCGAGGTTTGCGTCTCCCGGGGC
ATGCTCAACGAGAACTCCATCACGGCCGACTTCCTGCACCGCCTCGCCGCTCTCCGGCCCTTTGATGCCACCCGT
CGCCTCGAGTACCTCGCCGACCAGAACGAGCCCCTATACGATCCCCTGCAGCTCTTCGCCGATTCCGACGCCGAG
TCGTACGTTCCAAACACCAAGATCCCGCACTACTGCACCCTCATCCGAAAGGCCATCATCACCCCGACCGCCATC
CGCTACAACTCGCCGGCCGTCGAGGCGTCCAACCGGGTCGTCCGGAAATACAACCATCTGCAGGACCGCTTCTTG
CGCGTCCAGTTTGTCGAAGAGGCAGAGCAGGGCCGGATCGCCTTCAACTACAGAAACAACGACGAAATCTTCCGC
CGCATGCTTCGCGTTCTCTTCAATGGCATCCGCATCGGCGACCGCCTGTACGAGTTCCTCGGCTTCGGCAACTCG
CAGCTCAGGGAATGCGGCGCCTACTTCTTCTGCCCGACCGAGCACACGTCGTGCGACGATATCCGAGGATGGATG
GGCAACTTCAGCCACATCCGAGTCGTCGCCAAGTATGCGGCCCGCCTCGGCCAGTGCTTCTCCTCGACGAGGGAG
ATCCGCGGCATCTTTACGCCGAAAACACGGCGCATCCCCGATGTCGAGAGGAACGGCTTCGTCTTCACGGACGGC
GTGGGCATCATTTCCCCGTTCTTGGCCCGCCTCGTCATCCAGGAGATGGCCCTCGACGTGCTCGACGAGCCGACG
GCCTTTCAGTTCCGCATGGGCGGCTGCAAGGGCGTCTTGGCCGTGTGGCCCCAGGCCAAGGGCATGGAAGTCCTC
GTGCGGGACTCGCAGAAGAAGTTCACGGCCGTGTTCAACGGCCTGGAGATCATCAAGTGCGCCAAGTACTCGACG
GCGACACTCAACCGGCAGACGATACCCATCCTCGAGTGCCTCGGGGTGCCGAAGAGCGCCTTTGTCGCCCTCTTG
GACCATCAGATCCGGGAGTATGAGAGCGCCATGAAGGACAACTCGGTCGCCGTAAGCCTGCTGACCAAGTTCGTG
GACGAAAACCAGTCGACGCTCATCCTGGCGGAACTGCTCAAGGCCGGCTTCAGGAGCGACAGCGTGCAGGAGCCA
TTCACGGTGAACCTGATGAACCTCTGGAGATCGTGGACGCTGAAGCTGCTCAAGGAAAAGGCGCGAATCAACATT
GACAAGAGCGCCTTTGTTCTCGGCTGCGTCGACGAGACGCACACGCTGAGGGGACACTCGAAAGCGACGGAGGGC
TCGTCCGACAACGACGTCAACAAACTGCCCCAGATATTCCTGCAGCTCACAGACCCGGCTCGGTGCGATCAGACC
ATCATCATCAAGGGCCTCTGCGCCATCGGCCGGAACCCTTCCCTGCACCCTGGCGACATCCGGGTCGTCCAAGCC
GTGGACAACCCCAAGCTTCGCCACCTCAAGGACGTGGTCGTGTTCCCCTCCAAGGGAGATCGCCCGGTTCCAAGC
ATGCTGGCCGGAGGCGACCTGGACGGCGACGACTACTTCGTCATCTGGGATCCCAACCTCATACCCAGAGAATGG
AACTACTCGCCCATGGAATACTCGGCCCCGAAGCCCAAGAAGATCTCGAGGGACGTGAACATTGATGATGTTCGC
GACTTCTTTGTTGAATATATGAAGAGCGACGTCTTGGGCCAGATTGCACACGCACATGTGGCATACGCGGACAGC
CAAGGGCCCAAGTCGCAGAGATGTGAGTACCGGATCCATTCCAAGCGACCAATCTTTCTTGTCCGTCGTCTAACC
CGCGATCTAGGCGTCCAATTGGCCGGATTGCACTCCGAAGCCGTCGACTTCCCCAAAACTGGGAAACCGGCCGAA
ATCGGGTCCAAGCTGCAACCAGAACGGTGGCCACACTTCATGGAGAAGAGGAGATGGTATGAGTCCAAACGAGCT
CTGGGCGTCATCTACGACAAGGTGAAGAGTCGGACCGTTGAATTTCGGCCCGACTGGCAACATGCATTTGACCAG
AGGATCACGACAAAATTCGAACTGGAGAATGGCCAGCTCGAGGCGGCCAGGCGCATCAAGGCCCAGTACGACCTG
GCCGTCCGCCGAATCCTTGCTCAGCTCAACGTGGCGACCGAGTTTGAGCTGTACACGTCATGGGCCATGTCGAAG
CCGGCGGTGGAGTCGGACTACAAGCGGCAGGAACAGCTCGGCCGCGAGTTCGACCTCCTGAAGGCGCGCCACCGC
GAGCTGTGCTACGAGGCAGCGGGCGGCAGCGACCCTGACAAGCTGGACAGGTTCGTGGCGGCCATGTACAGGGTA
ACGGAGCAAGAGATGCATGCCGCGCTCCGCGAGCACGAGGAGAGGGCCGGGGACGGGTCCGGCGGAACGGCGGCG
CCGATGCCGGTGGATGCCAGATCGATGCCCCTCATCAGCTTCCCCTGGATATTCCACTGGGTGTTGATTCGCATC
GCCACGGGCAGCAAGTACAAGCCCAAGGAGTCCCTCTTCGCGGCGGCAGAGCGTGCAGCGCAGAGCGCCGCCGGC
TCGCTGGCGGCTCGAAGCCTGTCTGCCCTATCCGCCGAGGGCAGCGCGGGCGGAGGGTCCAGCGAGGAGAACGGG
GCAGCCGCCGGCACCACGAGTCTATGGGCCGAGGCAGCACCAACTCCAGCACTAGTACCAGTACCAGCACCAGCA
CCAGCATCAGCAGCGGCGGCGGCGGCATCACCAGCACCACCAGCGAGCACAAACATGGACTATGGTGGCAGCCGC
GACACGGACGGGTGGTTGAGCGAGCAGGCGAGGGACATTTCGGAGCCGGTGCTGATGGGCGACGAAGAAGACGAG
GGTATCTCAAGCGATTCCGAGGCGGAGACGCTGGTTGGGGAGGAGGAGCCCGTGAATGGGAGCGCGATGGACCGG
CTGGCTGCTCTCATGGATTTCGGCGAGGACGAAGTATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail