Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|9003
Gene name
LocationContig_624:445..1854
Strand-
Gene length (bp)1409
Transcript length (bp)1260
Coding sequence length (bp)1260
Protein length (aa) 420

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01066 CDP-OH_P_transf CDP-alcohol phosphatidyltransferase 3.9E-17 46 121

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O13901|YF3A_SCHPO Uncharacterized CDP-alcohol phosphatidyltransferase class-I family protein C22A12.10 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC22A12.10 PE=3 SV=1 4 395 4.0E-93
sp|P22140|EPT1_YEAST Choline/ethanolaminephosphotransferase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=EPT1 PE=1 SV=2 3 396 2.0E-80
sp|P17898|CPT1_YEAST Cholinephosphotransferase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CPT1 PE=1 SV=3 3 398 1.0E-76
sp|O82567|AAPT1_ARATH Choline/ethanolaminephosphotransferase 1 OS=Arabidopsis thaliana GN=AAPT1 PE=1 SV=1 1 395 2.0E-56
sp|O82568|AAPT2_ARATH Choline/ethanolaminephosphotransferase 2 OS=Arabidopsis thaliana GN=AAPT2 PE=1 SV=1 1 395 3.0E-55
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O13901|YF3A_SCHPO Uncharacterized CDP-alcohol phosphatidyltransferase class-I family protein C22A12.10 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC22A12.10 PE=3 SV=1 4 395 4.0E-93
sp|P22140|EPT1_YEAST Choline/ethanolaminephosphotransferase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=EPT1 PE=1 SV=2 3 396 2.0E-80
sp|P17898|CPT1_YEAST Cholinephosphotransferase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CPT1 PE=1 SV=3 3 398 1.0E-76
sp|O82567|AAPT1_ARATH Choline/ethanolaminephosphotransferase 1 OS=Arabidopsis thaliana GN=AAPT1 PE=1 SV=1 1 395 2.0E-56
sp|O82568|AAPT2_ARATH Choline/ethanolaminephosphotransferase 2 OS=Arabidopsis thaliana GN=AAPT2 PE=1 SV=1 1 395 3.0E-55
sp|Q550W1|CAPTC_DICDI Uncharacterized CDP-alcohol phosphatidyltransferase class-I family protein 3 OS=Dictyostelium discoideum GN=captC PE=2 SV=1 2 399 6.0E-43
sp|Q54XM0|CAPTB_DICDI Uncharacterized CDP-alcohol phosphatidyltransferase class-I family protein 2 OS=Dictyostelium discoideum GN=captB PE=3 SV=1 3 406 5.0E-40
sp|Q7ZYQ3|CEPT1_XENLA Choline/ethanolaminephosphotransferase 1 OS=Xenopus laevis GN=cept1 PE=2 SV=1 4 315 2.0E-35
sp|Q28H54|CEPT1_XENTR Choline/ethanolaminephosphotransferase 1 OS=Xenopus tropicalis GN=cept1 PE=2 SV=1 6 315 2.0E-34
sp|Q5ZKD1|CEPT1_CHICK Choline/ethanolaminephosphotransferase 1 OS=Gallus gallus GN=CEPT1 PE=2 SV=2 4 315 1.0E-33
sp|Q8BGS7|CEPT1_MOUSE Choline/ethanolaminephosphotransferase 1 OS=Mus musculus GN=Cept1 PE=1 SV=1 4 315 9.0E-33
sp|Q9Y6K0|CEPT1_HUMAN Choline/ethanolaminephosphotransferase 1 OS=Homo sapiens GN=CEPT1 PE=1 SV=1 4 315 1.0E-32
sp|Q6AXM5|CEPT1_RAT Choline/ethanolaminephosphotransferase 1 OS=Rattus norvegicus GN=Cept1 PE=2 SV=1 4 315 2.0E-32
sp|Q55AQ3|CAPTA_DICDI Uncharacterized CDP-alcohol phosphatidyltransferase class-I family protein 1 OS=Dictyostelium discoideum GN=captA PE=3 SV=1 2 398 4.0E-32
sp|Q4KLV1|CHPT1_XENLA Cholinephosphotransferase 1 OS=Xenopus laevis GN=chpt1 PE=2 SV=1 7 200 3.0E-30
sp|Q8C025|CHPT1_MOUSE Cholinephosphotransferase 1 OS=Mus musculus GN=Chpt1 PE=1 SV=1 8 200 6.0E-29
sp|Q9C0D9|EPT1_HUMAN Ethanolaminephosphotransferase 1 OS=Homo sapiens GN=EPT1 PE=1 SV=3 3 322 1.0E-28
sp|Q8WUD6|CHPT1_HUMAN Cholinephosphotransferase 1 OS=Homo sapiens GN=CHPT1 PE=1 SV=1 8 315 2.0E-28
sp|Q80TA1|EPT1_MOUSE Ethanolaminephosphotransferase 1 OS=Mus musculus GN=Ept1 PE=2 SV=3 3 319 1.0E-27
sp|Q66H21|CHPT1_RAT Cholinephosphotransferase 1 OS=Rattus norvegicus GN=Chpt1 PE=2 SV=1 8 200 1.0E-27
sp|Q5NV96|EPT1_PONAB Ethanolaminephosphotransferase 1 OS=Pongo abelii GN=EPT1 PE=2 SV=2 3 322 2.0E-27
sp|Q5ZHQ5|CHPT1_CHICK Cholinephosphotransferase 1 OS=Gallus gallus GN=CHPT1 PE=2 SV=1 8 200 3.0E-27
sp|Q1LZE6|CHPT1_BOVIN Cholinephosphotransferase 1 OS=Bos taurus GN=CHPT1 PE=2 SV=1 8 200 3.0E-27
sp|Q17QM4|EPT1_BOVIN Ethanolaminephosphotransferase 1 OS=Bos taurus GN=EPT1 PE=2 SV=3 3 328 8.0E-27
sp|Q7ZW02|CHPT1_DANRE Cholinephosphotransferase 1 OS=Danio rerio GN=chpt1 PE=2 SV=1 8 194 6.0E-26
sp|Q8T2Q6|CAPTD_DICDI Uncharacterized CDP-alcohol phosphatidyltransferase class-I family protein 4 OS=Dictyostelium discoideum GN=captD PE=3 SV=1 1 403 4.0E-23
sp|Q95ZE2|PSS_ENCCU CDP-diacylglycerol--serine O-phosphatidyltransferase OS=Encephalitozoon cuniculi (strain GB-M1) GN=PSS PE=3 SV=1 8 194 4.0E-21
[Show less]

GO

GO Term Description Terminal node
GO:0016020 membrane Yes
GO:0016780 phosphotransferase activity, for other substituted phosphate groups Yes
GO:0008654 phospholipid biosynthetic process Yes
GO:0006644 phospholipid metabolic process No
GO:0009987 cellular process No
GO:0003824 catalytic activity No
GO:0044249 cellular biosynthetic process No
GO:0009058 biosynthetic process No
GO:1901576 organic substance biosynthetic process No
GO:0019637 organophosphate metabolic process No
GO:0006796 phosphate-containing compound metabolic process No
GO:0044237 cellular metabolic process No
GO:0090407 organophosphate biosynthetic process No
GO:0006793 phosphorus metabolic process No
GO:0071704 organic substance metabolic process No
GO:0006629 lipid metabolic process No
GO:0044238 primary metabolic process No
GO:0008152 metabolic process No
GO:0008150 biological_process No
GO:0008610 lipid biosynthetic process No
GO:0044255 cellular lipid metabolic process No
GO:0016740 transferase activity No
GO:0003674 molecular_function No
GO:0016772 transferase activity, transferring phosphorus-containing groups No
GO:0005575 cellular_component No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 43 0.5

Transmembrane Domains

Domain # Start End Length
1 50 72 22
2 138 157 19
3 177 199 22
4 219 241 22
5 262 281 19
6 285 305 20
7 318 340 22
8 355 377 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|9003
MVYVRQRNLPALKEYKYSAVDRSLVSKYVLKPFYTHVVIKCFPMRMAPNLITLTGFMFVVANVLTMLWYTPTLDQ
DCPPWVYYSWAVGLFLYQTFDAVDGAQARRTKQSGPLGELFDHGVDALNTCLEVLLFAASQNLGQGWKTVATLFA
SLFTFYVQTWDEYHTKTLTLGIVNGPVEGVLLLASVFALTGYLGGAHVWQQSAMETLGVPATLGLPRVLYRLSFT
EWYMLQGFVVIVLNTLESSSNVIRARRARGDRSRGALLGLVPFFAVWALIVAYLALQPGILHGHLVPFVFLAGLV
NAYSVGQMITAHLVRMRFPYWNVLALPLAFAVVDSLGPLLQRRLGAGWPSALGDGVYQVAYLFCMLGAAVGVYGS
FVVDVIVTICDYLDIWCLTIKHPHVDPPSPAASPAAANGKTKRV*
Coding >Hirsu2|9003
ATGGTCTACGTCCGCCAGCGCAACCTCCCCGCGCTCAAGGAGTACAAGTACTCGGCCGTGGACCGGTCGCTCGTG
TCGAAATACGTGCTCAAGCCCTTCTACACCCATGTCGTCATCAAGTGCTTCCCGATGCGCATGGCGCCCAACCTC
ATCACCCTGACCGGCTTCATGTTCGTCGTCGCCAACGTCCTGACCATGCTGTGGTACACGCCGACGCTCGACCAG
GACTGCCCGCCCTGGGTCTACTACAGCTGGGCCGTCGGCCTCTTCCTCTACCAGACCTTTGATGCCGTCGACGGC
GCCCAGGCCCGGCGCACCAAGCAGTCCGGCCCGCTGGGCGAGCTGTTCGACCACGGCGTCGACGCCCTCAACACC
TGTCTCGAGGTCCTCCTCTTCGCCGCCTCGCAGAACCTGGGCCAGGGCTGGAAAACGGTCGCCACCCTCTTCGCG
TCCCTCTTCACCTTCTACGTCCAGACGTGGGACGAATACCACACCAAGACGCTGACGCTCGGCATCGTCAACGGC
CCCGTCGAGGGCGTGCTGCTGCTGGCGAGCGTCTTCGCCCTGACGGGCTACCTCGGGGGCGCGCACGTGTGGCAG
CAGAGCGCGATGGAGACGCTGGGGGTGCCGGCGACGCTGGGCCTGCCGCGGGTGCTGTACCGGCTGTCCTTCACG
GAGTGGTACATGCTGCAGGGCTTCGTCGTCATCGTCCTCAACACGCTCGAGTCGTCGTCCAACGTGATCCGGGCG
CGGCGGGCGCGCGGCGACCGGTCGCGCGGCGCCCTGCTCGGCCTCGTCCCCTTCTTCGCCGTCTGGGCCCTCATC
GTCGCCTACCTGGCGCTGCAGCCCGGCATCCTGCACGGCCACCTGGTGCCCTTCGTCTTCCTGGCCGGCCTGGTC
AACGCGTACAGCGTCGGGCAGATGATCACGGCCCACCTGGTGCGCATGCGCTTCCCCTACTGGAACGTGCTGGCG
CTGCCCCTCGCCTTCGCCGTCGTCGACTCGCTCGGCCCCCTGCTGCAGCGCCGCCTCGGCGCCGGCTGGCCCAGC
GCCCTCGGCGACGGCGTCTACCAGGTCGCCTACCTCTTCTGCATGCTCGGCGCCGCCGTCGGCGTCTACGGCAGC
TTCGTCGTCGACGTCATCGTCACCATCTGCGACTACCTCGACATCTGGTGCCTCACCATCAAGCACCCCCACGTC
GACCCGCCGTCCCCGGCCGCCTCCCCCGCCGCCGCCAACGGCAAGACCAAGCGCGTCTGA
Transcript >Hirsu2|9003
ATGGTCTACGTCCGCCAGCGCAACCTCCCCGCGCTCAAGGAGTACAAGTACTCGGCCGTGGACCGGTCGCTCGTG
TCGAAATACGTGCTCAAGCCCTTCTACACCCATGTCGTCATCAAGTGCTTCCCGATGCGCATGGCGCCCAACCTC
ATCACCCTGACCGGCTTCATGTTCGTCGTCGCCAACGTCCTGACCATGCTGTGGTACACGCCGACGCTCGACCAG
GACTGCCCGCCCTGGGTCTACTACAGCTGGGCCGTCGGCCTCTTCCTCTACCAGACCTTTGATGCCGTCGACGGC
GCCCAGGCCCGGCGCACCAAGCAGTCCGGCCCGCTGGGCGAGCTGTTCGACCACGGCGTCGACGCCCTCAACACC
TGTCTCGAGGTCCTCCTCTTCGCCGCCTCGCAGAACCTGGGCCAGGGCTGGAAAACGGTCGCCACCCTCTTCGCG
TCCCTCTTCACCTTCTACGTCCAGACGTGGGACGAATACCACACCAAGACGCTGACGCTCGGCATCGTCAACGGC
CCCGTCGAGGGCGTGCTGCTGCTGGCGAGCGTCTTCGCCCTGACGGGCTACCTCGGGGGCGCGCACGTGTGGCAG
CAGAGCGCGATGGAGACGCTGGGGGTGCCGGCGACGCTGGGCCTGCCGCGGGTGCTGTACCGGCTGTCCTTCACG
GAGTGGTACATGCTGCAGGGCTTCGTCGTCATCGTCCTCAACACGCTCGAGTCGTCGTCCAACGTGATCCGGGCG
CGGCGGGCGCGCGGCGACCGGTCGCGCGGCGCCCTGCTCGGCCTCGTCCCCTTCTTCGCCGTCTGGGCCCTCATC
GTCGCCTACCTGGCGCTGCAGCCCGGCATCCTGCACGGCCACCTGGTGCCCTTCGTCTTCCTGGCCGGCCTGGTC
AACGCGTACAGCGTCGGGCAGATGATCACGGCCCACCTGGTGCGCATGCGCTTCCCCTACTGGAACGTGCTGGCG
CTGCCCCTCGCCTTCGCCGTCGTCGACTCGCTCGGCCCCCTGCTGCAGCGCCGCCTCGGCGCCGGCTGGCCCAGC
GCCCTCGGCGACGGCGTCTACCAGGTCGCCTACCTCTTCTGCATGCTCGGCGCCGCCGTCGGCGTCTACGGCAGC
TTCGTCGTCGACGTCATCGTCACCATCTGCGACTACCTCGACATCTGGTGCCTCACCATCAAGCACCCCCACGTC
GACCCGCCGTCCCCGGCCGCCTCCCCCGCCGCCGCCAACGGCAAGACCAAGCGCGTCTGA
Gene >Hirsu2|9003
ATGGTCTACGTCCGCCAGCGCAACCTCCCCGCGCTCAAGGAGTACAAGTACTCGGCCGTGGACCGGTCGCTCGTG
TCGAAATACGTGCTCAAGCCCTTCTACACCCATGTCGTCATCAAGTGCTTCCCGATGCGCATGGCGCCCAACCTC
ATCACCCTGACCGGCTTCATGTTCGTCGTCGCCAACGTCCTGACCATGCTGTGGTACACGCCGACGCTCGACCAG
GACTGCCCGCCCTGGGTCTACTACAGCTGGGCCGTCGGCCTCTTCCTCTACCAGACCTTTGATGCCGTCGACGGC
GCCCAGGCGTGCGTCCCCGCCCTCCGCCTAATTCTCCTCCCCTCGCGTGCTGACCCGCCGACCTCGTCCAGCCGG
CGCACCAAGCAGTCCGGCCCGCTGGGCGAGCTGTTCGACCACGGCGTCGACGCCCTCAACACCTGTCTCGAGGTC
CTCCTCTTCGCCGCCTCGCAGAACCTGGGCCAGGGCTGGAAAACGGTCGCCACCCTCTTCGCGTGTACGCCCCCC
CTTCTGCTTTTTGTCGCAAAAAAAAAAAAAAAGACTGACGTTTTTTTTTTTTTTTTGGCGACGCGCTCGCTCCAG
CCCTCTTCACCTTCTACGTCCAGACGTGGGACGAATACCACACCAAGACGCTGACGCTCGGCATCGTCAACGGCC
CCGTCGAGGGCGTGCTGCTGCTGGCGAGCGTCTTCGCCCTGACGGGCTACCTCGGGGGCGCGCACGTGTGGCAGC
AGAGCGCGATGGAGACGCTGGGGGTGCCGGCGACGCTGGGCCTGCCGCGGGTGCTGTACCGGCTGTCCTTCACGG
AGTGGTACATGCTGCAGGGCTTCGTCGTCATCGTCCTCAACACGCTCGAGTCGTCGTCCAACGTGATCCGGGCGC
GGCGGGCGCGCGGCGACCGGTCGCGCGGCGCCCTGCTCGGCCTCGTCCCCTTCTTCGCCGTCTGGGCCCTCATCG
TCGCCTACCTGGCGCTGCAGCCCGGCATCCTGCACGGCCACCTGGTGCCCTTCGTCTTCCTGGCCGGCCTGGTCA
ACGCGTACAGCGTCGGGCAGATGATCACGGCCCACCTGGTGCGCATGCGCTTCCCCTACTGGAACGTGCTGGCGC
TGCCCCTCGCCTTCGCCGTCGTCGACTCGCTCGGCCCCCTGCTGCAGCGCCGCCTCGGCGCCGGCTGGCCCAGCG
CCCTCGGCGACGGCGTCTACCAGGTCGCCTACCTCTTCTGCATGCTCGGCGCCGCCGTCGGCGTCTACGGCAGCT
TCGTCGTCGACGTCATCGTCACCATCTGCGACTACCTCGACATCTGGTGCCTCACCATCAAGCACCCCCACGTCG
ACCCGCCGTCCCCGGCCGCCTCCCCCGCCGCCGCCAACGGCAAGACCAAGCGCGTCTGA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail