Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|8995
Gene name
LocationContig_622:7776..8670
Strand+
Gene length (bp)894
Transcript length (bp)894
Coding sequence length (bp)894
Protein length (aa) 298

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13649 Methyltransf_25 Methyltransferase domain 3.8E-13 65 160
PF08241 Methyltransf_11 Methyltransferase domain 3.4E-09 66 162
PF08242 Methyltransf_12 Methyltransferase domain 4.6E-07 66 161
PF13489 Methyltransf_23 Methyltransferase domain 4.8E-07 48 200

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9RX93|TAM_DEIRA Trans-aconitate 2-methyltransferase OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=tam PE=3 SV=1 61 184 5.0E-09
sp|B8ISV4|TAM_METNO Trans-aconitate 2-methyltransferase OS=Methylobacterium nodulans (strain ORS2060 / LMG 21967) GN=tam PE=3 SV=1 26 121 1.0E-06
sp|B0UPF4|TAM_METS4 Trans-aconitate 2-methyltransferase OS=Methylobacterium sp. (strain 4-46) GN=tam PE=3 SV=1 56 121 3.0E-06
sp|Q39SM1|CMOA_GEOMG tRNA (cmo5U34)-methyltransferase OS=Geobacter metallireducens (strain GS-15 / ATCC 53774 / DSM 7210) GN=cmoA PE=3 SV=2 27 165 3.0E-06
sp|A6WZN1|TAM_OCHA4 Trans-aconitate 2-methyltransferase OS=Ochrobactrum anthropi (strain ATCC 49188 / DSM 6882 / NCTC 12168) GN=tam PE=3 SV=1 56 164 4.0E-06
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9RX93|TAM_DEIRA Trans-aconitate 2-methyltransferase OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=tam PE=3 SV=1 61 184 5.0E-09
sp|B8ISV4|TAM_METNO Trans-aconitate 2-methyltransferase OS=Methylobacterium nodulans (strain ORS2060 / LMG 21967) GN=tam PE=3 SV=1 26 121 1.0E-06
sp|B0UPF4|TAM_METS4 Trans-aconitate 2-methyltransferase OS=Methylobacterium sp. (strain 4-46) GN=tam PE=3 SV=1 56 121 3.0E-06
sp|Q39SM1|CMOA_GEOMG tRNA (cmo5U34)-methyltransferase OS=Geobacter metallireducens (strain GS-15 / ATCC 53774 / DSM 7210) GN=cmoA PE=3 SV=2 27 165 3.0E-06
sp|A6WZN1|TAM_OCHA4 Trans-aconitate 2-methyltransferase OS=Ochrobactrum anthropi (strain ATCC 49188 / DSM 6882 / NCTC 12168) GN=tam PE=3 SV=1 56 164 4.0E-06
sp|C5CSI6|TAM_VARPS Trans-aconitate 2-methyltransferase OS=Variovorax paradoxus (strain S110) GN=tam PE=3 SV=1 62 164 5.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0008168 methyltransferase activity Yes
GO:0016740 transferase activity No
GO:0003674 molecular_function No
GO:0016741 transferase activity, transferring one-carbon groups No
GO:0003824 catalytic activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 33 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|8995
MALEASRGEAAQDGRSAAADDSRRAWDDVAAIYAERSLKSTPACAALLIEEAHRLLPFSSPGAHVLDVGCGPGAV
AVALSSRFPDVGVLASDFSPRMLAILAGRRLPNVQVTEADGMDLSPVLARHPQRFSHVLSAFMNQFTPDPVQPVR
EMMAATRPGGVVGLASWGTYDKERIFTAAARSIDPSWDSPGMWSTMDFPEDAAGLQQLFKSLGLEQVRSSRKTIV
FELDSAESCVDLFFGSNNPAFNKVIHTFRSLHGDDGVQEARRRMPEIMERDGWDLAKIQCEAFITVGCKPAP*
Coding >Hirsu2|8995
ATGGCCCTTGAAGCGAGCCGGGGTGAGGCAGCGCAAGACGGGCGCTCAGCGGCAGCGGACGACAGCCGTCGGGCT
TGGGACGACGTGGCGGCCATCTATGCCGAGCGATCGCTGAAATCTACGCCGGCCTGTGCCGCCCTGCTGATCGAA
GAGGCACATCGACTGCTCCCCTTTTCGTCGCCCGGCGCCCACGTCCTGGACGTTGGCTGCGGGCCGGGCGCCGTC
GCCGTCGCGCTCTCGTCGAGATTCCCCGACGTCGGAGTCCTGGCTTCCGACTTCTCCCCGCGCATGCTGGCCATC
CTCGCGGGCCGACGACTGCCCAACGTCCAGGTCACGGAAGCGGACGGCATGGACTTGTCGCCCGTCCTGGCGCGG
CACCCGCAGCGCTTCAGCCACGTCCTCAGCGCCTTTATGAACCAGTTCACGCCGGACCCCGTCCAGCCCGTCCGG
GAGATGATGGCGGCAACCCGCCCCGGCGGCGTCGTCGGGCTGGCGAGCTGGGGCACCTACGACAAGGAGCGTATC
TTCACCGCCGCGGCGCGGTCCATAGACCCGTCCTGGGACTCCCCCGGTATGTGGTCCACGATGGACTTCCCCGAG
GATGCGGCCGGCCTGCAGCAGCTCTTTAAGTCTCTGGGGCTCGAGCAGGTCCGGTCGAGCAGGAAGACGATCGTG
TTCGAGCTCGACAGCGCGGAGAGCTGTGTGGACCTCTTCTTCGGCAGCAACAATCCTGCTTTCAACAAGGTTATC
CACACTTTCCGGAGCCTTCATGGAGACGACGGCGTGCAGGAGGCGAGGAGGCGGATGCCCGAAATCATGGAGCGG
GACGGGTGGGATCTCGCCAAGATCCAGTGCGAGGCATTCATCACTGTCGGCTGCAAGCCTGCGCCCTGA
Transcript >Hirsu2|8995
ATGGCCCTTGAAGCGAGCCGGGGTGAGGCAGCGCAAGACGGGCGCTCAGCGGCAGCGGACGACAGCCGTCGGGCT
TGGGACGACGTGGCGGCCATCTATGCCGAGCGATCGCTGAAATCTACGCCGGCCTGTGCCGCCCTGCTGATCGAA
GAGGCACATCGACTGCTCCCCTTTTCGTCGCCCGGCGCCCACGTCCTGGACGTTGGCTGCGGGCCGGGCGCCGTC
GCCGTCGCGCTCTCGTCGAGATTCCCCGACGTCGGAGTCCTGGCTTCCGACTTCTCCCCGCGCATGCTGGCCATC
CTCGCGGGCCGACGACTGCCCAACGTCCAGGTCACGGAAGCGGACGGCATGGACTTGTCGCCCGTCCTGGCGCGG
CACCCGCAGCGCTTCAGCCACGTCCTCAGCGCCTTTATGAACCAGTTCACGCCGGACCCCGTCCAGCCCGTCCGG
GAGATGATGGCGGCAACCCGCCCCGGCGGCGTCGTCGGGCTGGCGAGCTGGGGCACCTACGACAAGGAGCGTATC
TTCACCGCCGCGGCGCGGTCCATAGACCCGTCCTGGGACTCCCCCGGTATGTGGTCCACGATGGACTTCCCCGAG
GATGCGGCCGGCCTGCAGCAGCTCTTTAAGTCTCTGGGGCTCGAGCAGGTCCGGTCGAGCAGGAAGACGATCGTG
TTCGAGCTCGACAGCGCGGAGAGCTGTGTGGACCTCTTCTTCGGCAGCAACAATCCTGCTTTCAACAAGGTTATC
CACACTTTCCGGAGCCTTCATGGAGACGACGGCGTGCAGGAGGCGAGGAGGCGGATGCCCGAAATCATGGAGCGG
GACGGGTGGGATCTCGCCAAGATCCAGTGCGAGGCATTCATCACTGTCGGCTGCAAGCCTGCGCCCTGA
Gene >Hirsu2|8995
ATGGCCCTTGAAGCGAGCCGGGGTGAGGCAGCGCAAGACGGGCGCTCAGCGGCAGCGGACGACAGCCGTCGGGCT
TGGGACGACGTGGCGGCCATCTATGCCGAGCGATCGCTGAAATCTACGCCGGCCTGTGCCGCCCTGCTGATCGAA
GAGGCACATCGACTGCTCCCCTTTTCGTCGCCCGGCGCCCACGTCCTGGACGTTGGCTGCGGGCCGGGCGCCGTC
GCCGTCGCGCTCTCGTCGAGATTCCCCGACGTCGGAGTCCTGGCTTCCGACTTCTCCCCGCGCATGCTGGCCATC
CTCGCGGGCCGACGACTGCCCAACGTCCAGGTCACGGAAGCGGACGGCATGGACTTGTCGCCCGTCCTGGCGCGG
CACCCGCAGCGCTTCAGCCACGTCCTCAGCGCCTTTATGAACCAGTTCACGCCGGACCCCGTCCAGCCCGTCCGG
GAGATGATGGCGGCAACCCGCCCCGGCGGCGTCGTCGGGCTGGCGAGCTGGGGCACCTACGACAAGGAGCGTATC
TTCACCGCCGCGGCGCGGTCCATAGACCCGTCCTGGGACTCCCCCGGTATGTGGTCCACGATGGACTTCCCCGAG
GATGCGGCCGGCCTGCAGCAGCTCTTTAAGTCTCTGGGGCTCGAGCAGGTCCGGTCGAGCAGGAAGACGATCGTG
TTCGAGCTCGACAGCGCGGAGAGCTGTGTGGACCTCTTCTTCGGCAGCAACAATCCTGCTTTCAACAAGGTTATC
CACACTTTCCGGAGCCTTCATGGAGACGACGGCGTGCAGGAGGCGAGGAGGCGGATGCCCGAAATCATGGAGCGG
GACGGGTGGGATCTCGCCAAGATCCAGTGCGAGGCATTCATCACTGTCGGCTGCAAGCCTGCGCCCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail