Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|8990
Gene name
LocationContig_622:914..1467
Strand-
Gene length (bp)553
Transcript length (bp)336
Coding sequence length (bp)336
Protein length (aa) 112

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04137 ERO1 Endoplasmic Reticulum Oxidoreductin 1 (ERO1) 5.6E-14 54 108

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q7SEY9|ERO1_NEUCR Endoplasmic reticulum oxidoreductin-1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=ero-1 PE=3 SV=1 1 109 5.0E-47
sp|Q75BB5|ERO1_ASHGO Endoplasmic reticulum oxidoreductin-1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=ERO1 PE=3 SV=2 29 109 1.0E-13
sp|O74401|ERO11_SCHPO ERO1-like protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ero11 PE=1 SV=1 33 109 3.0E-12
sp|Q8NIP5|ERO1_KLULA Endoplasmic reticulum oxidoreductin-1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=ERO1 PE=3 SV=1 42 108 2.0E-11
sp|Q9Y7P1|ERO12_SCHPO ERO1-like protein 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ero12 PE=1 SV=2 34 109 4.0E-10
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q7SEY9|ERO1_NEUCR Endoplasmic reticulum oxidoreductin-1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=ero-1 PE=3 SV=1 1 109 5.0E-47
sp|Q75BB5|ERO1_ASHGO Endoplasmic reticulum oxidoreductin-1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=ERO1 PE=3 SV=2 29 109 1.0E-13
sp|O74401|ERO11_SCHPO ERO1-like protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ero11 PE=1 SV=1 33 109 3.0E-12
sp|Q8NIP5|ERO1_KLULA Endoplasmic reticulum oxidoreductin-1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=ERO1 PE=3 SV=1 42 108 2.0E-11
sp|Q9Y7P1|ERO12_SCHPO ERO1-like protein 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ero12 PE=1 SV=2 34 109 4.0E-10
sp|Q03103|ERO1_YEAST Endoplasmic oxidoreductin-1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ERO1 PE=1 SV=1 29 108 5.0E-08
sp|Q9C7S7|ERO1_ARATH Endoplasmic reticulum oxidoreductin-1 OS=Arabidopsis thaliana GN=AERO1 PE=1 SV=1 34 103 1.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0015035 protein-disulfide reductase activity Yes
GO:0005783 endoplasmic reticulum Yes
GO:0034975 protein folding in endoplasmic reticulum Yes
GO:0016972 thiol oxidase activity Yes
GO:0071949 FAD binding Yes
GO:0036094 small molecule binding No
GO:0009987 cellular process No
GO:1901363 heterocyclic compound binding No
GO:0043229 intracellular organelle No
GO:0016667 oxidoreductase activity, acting on a sulfur group of donors No
GO:0006457 protein folding No
GO:0015036 disulfide oxidoreductase activity No
GO:0003824 catalytic activity No
GO:0005488 binding No
GO:0043226 organelle No
GO:0016670 oxidoreductase activity, acting on a sulfur group of donors, oxygen as acceptor No
GO:0008150 biological_process No
GO:0097159 organic cyclic compound binding No
GO:0050660 flavin adenine dinucleotide binding No
GO:0043227 membrane-bounded organelle No
GO:1901265 nucleoside phosphate binding No
GO:0016491 oxidoreductase activity No
GO:0043167 ion binding No
GO:0000166 nucleotide binding No
GO:0043168 anion binding No
GO:0140096 catalytic activity, acting on a protein No
GO:0110165 cellular anatomical entity No
GO:0003674 molecular_function No
GO:0005575 cellular_component No
GO:0043231 intracellular membrane-bounded organelle No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 25 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|8990
MKSASRSFYLSVFALWASPSGCSAAEGDCVISPKSIVQDACVSYAALDKLNFEVKPALDHLVSSSDFFSHYRLNL
FHKRCPFWSDENGMCGNIGCAVETLDNEEDIPELRG*
Coding >Hirsu2|8990
ATGAAGTCGGCCAGCCGCTCGTTCTACCTCTCCGTCTTCGCCCTCTGGGCCTCGCCCTCAGGCTGCTCGGCCGCG
GAGGGCGACTGCGTCATCTCGCCCAAGTCCATCGTGCAGGATGCCTGCGTCTCGTACGCGGCGCTCGACAAGCTC
AACTTCGAGGTCAAGCCGGCGCTCGACCACCTGGTCTCGTCTTCCGACTTCTTCTCGCACTACCGGCTCAACCTC
TTCCACAAGCGATGCCCCTTCTGGAGCGACGAGAACGGCATGTGCGGCAACATAGGGTGCGCCGTCGAGACGCTC
GACAACGAGGAGGACATCCCTGAGCTGCGTGGTTGA
Transcript >Hirsu2|8990
ATGAAGTCGGCCAGCCGCTCGTTCTACCTCTCCGTCTTCGCCCTCTGGGCCTCGCCCTCAGGCTGCTCGGCCGCG
GAGGGCGACTGCGTCATCTCGCCCAAGTCCATCGTGCAGGATGCCTGCGTCTCGTACGCGGCGCTCGACAAGCTC
AACTTCGAGGTCAAGCCGGCGCTCGACCACCTGGTCTCGTCTTCCGACTTCTTCTCGCACTACCGGCTCAACCTC
TTCCACAAGCGATGCCCCTTCTGGAGCGACGAGAACGGCATGTGCGGCAACATAGGGTGCGCCGTCGAGACGCTC
GACAACGAGGAGGACATCCCTGAGCTGCGTGGTTGA
Gene >Hirsu2|8990
ATGAAGTCGGCCAGCCGCTCGTTCTACCTCTCCGTCTTCGCCCTCTGGGCCTCGCCCTCAGGCTGCTCGGCCGCG
GAGGGCGACTGCGTCGTACGTGCCGTCGCTTTCTCTCTTTTTCCCCCTTTTTTTCTGGTAGAGGAGACGGCTGAT
GTGAAGGGAGGGGGAAAAACCCCTCTGTCCAGATCTCGCCCAAGTCCATCGTGCAGGATGCCTGCGTCTCGTACG
CGGCGCTCGACAAGCTCAACTTCGAGGTCAAGCCGGCGCTCGACCACCTGGTCTCGTCTTCCGACTTCTTCTCGC
ACTACCGGCTCAACCTCTTCCACAAGCGATGCCCCTTCTGGAGCGACGAGAACGGCATGTGCGGCAACATAGGGT
GCGCCGTCGAGACGCTCGACAACGAGGAGGACATCCCTGAGGTGTGGCGGGCGCGCGAGCTCAGCAAGCTCGAGG
GCCCGCGCGCCCGCCACCCGGGCCGCCGCGAGCAGCGCCAGCACCCGGAGCGGCCGCTGCAGGGCGAGCTGGGCG
ACGAGGTCGGCGAGAGCTGCGTGGTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail