Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|899
Gene name
LocationContig_119:1152..2236
Strand+
Gene length (bp)1084
Transcript length (bp)960
Coding sequence length (bp)960
Protein length (aa) 320

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05739 SNARE SNARE domain 5.8E-13 264 315
PF11416 Syntaxin-5_N Syntaxin-5 N-terminal, Sly1p-binding domain 9.3E-08 5 23

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O13644|SED5_SCHPO Integral membrane protein sed5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sed5 PE=3 SV=1 5 318 3.0E-84
sp|Q01590|SED5_YEAST Integral membrane protein SED5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SED5 PE=1 SV=1 5 318 5.0E-58
sp|Q08DB5|STX5_BOVIN Syntaxin-5 OS=Bos taurus GN=STX5 PE=2 SV=1 5 302 8.0E-55
sp|Q8K1E0|STX5_MOUSE Syntaxin-5 OS=Mus musculus GN=Stx5 PE=1 SV=3 5 302 2.0E-54
sp|Q13190|STX5_HUMAN Syntaxin-5 OS=Homo sapiens GN=STX5 PE=1 SV=2 5 302 9.0E-54
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O13644|SED5_SCHPO Integral membrane protein sed5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sed5 PE=3 SV=1 5 318 3.0E-84
sp|Q01590|SED5_YEAST Integral membrane protein SED5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SED5 PE=1 SV=1 5 318 5.0E-58
sp|Q08DB5|STX5_BOVIN Syntaxin-5 OS=Bos taurus GN=STX5 PE=2 SV=1 5 302 8.0E-55
sp|Q8K1E0|STX5_MOUSE Syntaxin-5 OS=Mus musculus GN=Stx5 PE=1 SV=3 5 302 2.0E-54
sp|Q13190|STX5_HUMAN Syntaxin-5 OS=Homo sapiens GN=STX5 PE=1 SV=2 5 302 9.0E-54
sp|Q08851|STX5_RAT Syntaxin-5 OS=Rattus norvegicus GN=Stx5 PE=1 SV=2 5 302 4.0E-53
sp|Q24509|STX5_DROME Syntaxin-5 OS=Drosophila melanogaster GN=Syx5 PE=2 SV=2 54 303 6.0E-53
sp|Q9LK09|SYP32_ARATH Syntaxin-32 OS=Arabidopsis thaliana GN=SYP32 PE=2 SV=1 4 316 3.0E-49
sp|Q9FFK1|SYP31_ARATH Syntaxin-31 OS=Arabidopsis thaliana GN=SYP31 PE=1 SV=1 5 316 2.0E-42
sp|Q20797|STX5_CAEEL Putative syntaxin-5 OS=Caenorhabditis elegans GN=syx-5 PE=3 SV=1 42 302 2.0E-39
sp|O14662|STX16_HUMAN Syntaxin-16 OS=Homo sapiens GN=STX16 PE=1 SV=3 62 299 8.0E-07
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 39 0.45

Transmembrane Domains

Domain # Start End Length
1 298 317 19

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|899
MAVGSIQDRTAEFKSVLAQAQRQQNSSKAGSQRRALLNDAQKAAADGDARPRRSDFARKAAEIGRGISATMGKLE
KLAQLAKRRTLFDDRPIEINELTFVIKQDLSSLNQQIGALQTLSKQQHPKADQEGEHNKNVVYLLQGKLTDVSVN
FKDVLEARTKNIQASRSRTENFISTVTQHAQPSLQQSASPLYGTPNRASPAPGSDTLSLNPVGEQQLLMMEEAQP
SNTYIQQRGEAIEAIEKTISELGSIFGQLATMVSEQSDMIQRIDANTEDVVDNVDGAQRELMKYWSRVSSNRWLI
AKMFGVLMIFFLLWVLVSG*
Coding >Hirsu2|899
ATGGCGGTCGGATCGATCCAAGACCGCACGGCCGAGTTCAAGTCGGTCCTAGCCCAGGCCCAGCGCCAGCAGAAC
TCGAGCAAGGCCGGGTCGCAGAGGAGAGCGCTCCTGAACGATGCCCAGAAGGCGGCGGCGGATGGAGATGCGAGG
CCTCGGCGGTCCGACTTCGCGCGCAAAGCTGCCGAGATCGGACGTGGCATCTCCGCCACCATGGGCAAGCTCGAG
AAGCTGGCGCAGCTCGCCAAGCGCCGCACCCTGTTCGACGACCGGCCCATCGAGATCAACGAGCTCACCTTCGTC
ATCAAGCAAGACCTGTCGTCGCTGAATCAACAAATCGGAGCGCTCCAGACGCTCTCGAAGCAGCAGCACCCCAAG
GCCGACCAAGAAGGCGAACACAACAAGAACGTCGTATACCTGCTGCAAGGTAAGCTGACCGACGTCTCGGTCAAC
TTCAAGGACGTGCTCGAGGCCCGGACCAAGAACATCCAGGCGTCGAGGTCGAGGACGGAAAACTTCATCTCGACC
GTGACCCAGCATGCGCAGCCGTCGCTGCAGCAGTCGGCCTCGCCCCTCTACGGCACGCCCAACCGCGCCTCCCCG
GCCCCGGGCTCCGACACGCTCTCGCTCAACCCGGTCGGCGAGCAGCAGCTGCTGATGATGGAGGAGGCCCAGCCA
TCCAACACCTACATACAGCAGCGCGGAGAGGCCATCGAGGCCATCGAGAAGACCATCAGTGAGCTGGGCAGCATC
TTCGGCCAACTGGCGACCATGGTCTCGGAGCAGAGCGACATGATCCAGCGCATCGACGCCAACACCGAGGACGTG
GTCGACAACGTCGACGGCGCTCAGCGGGAGCTCATGAAATATTGGTCGCGCGTCTCGAGCAACCGGTGGCTGATA
GCCAAGATGTTTGGCGTCTTGATGATATTCTTCCTACTCTGGGTTCTTGTCTCGGGCTGA
Transcript >Hirsu2|899
ATGGCGGTCGGATCGATCCAAGACCGCACGGCCGAGTTCAAGTCGGTCCTAGCCCAGGCCCAGCGCCAGCAGAAC
TCGAGCAAGGCCGGGTCGCAGAGGAGAGCGCTCCTGAACGATGCCCAGAAGGCGGCGGCGGATGGAGATGCGAGG
CCTCGGCGGTCCGACTTCGCGCGCAAAGCTGCCGAGATCGGACGTGGCATCTCCGCCACCATGGGCAAGCTCGAG
AAGCTGGCGCAGCTCGCCAAGCGCCGCACCCTGTTCGACGACCGGCCCATCGAGATCAACGAGCTCACCTTCGTC
ATCAAGCAAGACCTGTCGTCGCTGAATCAACAAATCGGAGCGCTCCAGACGCTCTCGAAGCAGCAGCACCCCAAG
GCCGACCAAGAAGGCGAACACAACAAGAACGTCGTATACCTGCTGCAAGGTAAGCTGACCGACGTCTCGGTCAAC
TTCAAGGACGTGCTCGAGGCCCGGACCAAGAACATCCAGGCGTCGAGGTCGAGGACGGAAAACTTCATCTCGACC
GTGACCCAGCATGCGCAGCCGTCGCTGCAGCAGTCGGCCTCGCCCCTCTACGGCACGCCCAACCGCGCCTCCCCG
GCCCCGGGCTCCGACACGCTCTCGCTCAACCCGGTCGGCGAGCAGCAGCTGCTGATGATGGAGGAGGCCCAGCCA
TCCAACACCTACATACAGCAGCGCGGAGAGGCCATCGAGGCCATCGAGAAGACCATCAGTGAGCTGGGCAGCATC
TTCGGCCAACTGGCGACCATGGTCTCGGAGCAGAGCGACATGATCCAGCGCATCGACGCCAACACCGAGGACGTG
GTCGACAACGTCGACGGCGCTCAGCGGGAGCTCATGAAATATTGGTCGCGCGTCTCGAGCAACCGGTGGCTGATA
GCCAAGATGTTTGGCGTCTTGATGATATTCTTCCTACTCTGGGTTCTTGTCTCGGGCTGA
Gene >Hirsu2|899
ATGGCGGTCGGATCGATCCAAGACCGCACGGCCGAGTTCAAGTCGGTCCTAGCCCAGGCCCAGCGCCAGCAGAAC
TCGAGCAAGGCCGGGTCGCAGAGGAGAGCGCTCCTGAACGATGCCCAGAAGGCGGCGGCGGATGGAGATGCGAGG
CCTCGGCGGTCCGACTTCGCGCGCAAAGCTGCCGAGATCGGACGTGGCATCTCCGCCACCATGGGCAAGCTCGAG
AAGCTGGCGCAGCGTGAGTCGGGTCACACGGCGCGTCCTGTTGACTCGTCGCCTACTGACATGACGAGCCCACAG
TCGCCAAGCGCCGCACCCTGTTCGACGACCGGCCCATCGAGATCAACGAGCTCACCTTCGTCATCAAGCAAGACC
TGTCGTCGCTGAATCAACAAATCGGAGCGCTCCAGACGCTCTCGAAGCAGCAGCACCCCAAGGCCGACCAAGAAG
GCGAACACAACAAGAACGTCGTATACCTGCTGCAAGGTAAGCTGACCGACGTCTCGGTCAACTTCAAGGACGTGC
TCGAGGCCCGGACCAAGAACATCCAGGCGTCGAGGTCGAGGACGGAAAACTTCATCTCGACCGTGACCCAGCATG
CGCAGCCGTCGCTGCAGCAGTCGGCCTCGCCCCTCTACGGCACGCCCAACCGCGCCTCCCCGGCCCCGGGCTCCG
ACACGCTCTCGCTCAACCCGGTCGGCGAGCAGCAGCTGCTGATGATGGAGGAGGCCCAGCCATCCAACACCTACA
TACAGCAGCGCGGAGAGGCCATCGAGGCCATCGAGAAGACCATCAGTGAGCTGGGCAGCATCTTCGGCCAACTGG
CGACCATGGTCTCGGAGCAGAGCGACATGATCCAGCGCATCGACGCCAACACCGAGGACGTGGTCGACAACGTCG
ACGGCGCTCAGCGGGAGCTCATGAAATATTGGTCGCGCGTCTCGAGCAACCGGTGGCTGATAGCCAAGATGTTTG
GCGTCTTGATGATATTCTTCCTGTCGGTGGCGCCCGTCCCGTGCGCGCGCGCGCGATGCCACGCTAACCTGTCGT
TTCTGCCAGACTCTGGGTTCTTGTCTCGGGCTGA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail