Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|8983
Gene name
LocationContig_620:12114..14791
Strand+
Gene length (bp)2677
Transcript length (bp)2616
Coding sequence length (bp)2616
Protein length (aa) 872

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04082 Fungal_trans Fungal specific transcription factor domain 6.4E-50 342 637
PF00096 zf-C2H2 Zinc finger, C2H2 type 6.2E-03 30 54
PF00096 zf-C2H2 Zinc finger, C2H2 type 3.6E-03 60 84

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9US36|KLF1_SCHPO Zinc finger protein klf1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=klf1 PE=2 SV=1 20 779 1.0E-41
sp|Q12139|YP022_YEAST Zinc finger protein YPR022C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YPR022C PE=1 SV=1 328 778 1.0E-26
sp|Q9UTS5|ZAS1_SCHPO Zinc finger protein zas1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=zas1 PE=2 SV=1 314 855 1.0E-18
sp|Q12139|YP022_YEAST Zinc finger protein YPR022C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YPR022C PE=1 SV=1 29 143 2.0E-13
sp|P49953|WT1_SMIMA Wilms tumor protein homolog (Fragment) OS=Sminthopsis macroura GN=WT1 PE=2 SV=1 19 85 2.0E-10
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9US36|KLF1_SCHPO Zinc finger protein klf1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=klf1 PE=2 SV=1 20 779 1.0E-41
sp|Q12139|YP022_YEAST Zinc finger protein YPR022C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YPR022C PE=1 SV=1 328 778 1.0E-26
sp|Q9UTS5|ZAS1_SCHPO Zinc finger protein zas1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=zas1 PE=2 SV=1 314 855 1.0E-18
sp|Q12139|YP022_YEAST Zinc finger protein YPR022C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YPR022C PE=1 SV=1 29 143 2.0E-13
sp|P49953|WT1_SMIMA Wilms tumor protein homolog (Fragment) OS=Sminthopsis macroura GN=WT1 PE=2 SV=1 19 85 2.0E-10
sp|O62651|WT1_PIG Wilms tumor protein homolog OS=Sus scrofa GN=WT1 PE=2 SV=1 19 85 5.0E-10
sp|P19544|WT1_HUMAN Wilms tumor protein OS=Homo sapiens GN=WT1 PE=1 SV=2 19 85 5.0E-10
sp|Q8TD94|KLF14_HUMAN Krueppel-like factor 14 OS=Homo sapiens GN=KLF14 PE=2 SV=1 19 85 5.0E-10
sp|P22561|WT1_MOUSE Wilms tumor protein homolog OS=Mus musculus GN=Wt1 PE=1 SV=1 19 85 5.0E-10
sp|P49952|WT1_RAT Wilms tumor protein homolog OS=Rattus norvegicus GN=Wt1 PE=2 SV=1 19 85 5.0E-10
sp|P50902|WT1_ALLMI Wilms tumor protein homolog (Fragment) OS=Alligator mississippiensis GN=WT1 PE=2 SV=1 19 85 8.0E-10
sp|P79958|WT1B_XENLA Wilms tumor protein homolog B OS=Xenopus laevis GN=wt1-b PE=2 SV=1 20 85 9.0E-10
sp|B7ZSG3|WT1A_XENLA Wilms tumor protein homolog A OS=Xenopus laevis GN=wt1-a PE=2 SV=1 20 85 9.0E-10
sp|Q19A40|KLF14_PANTR Krueppel-like factor 14 OS=Pan troglodytes GN=KLF14 PE=3 SV=1 26 85 1.0E-09
sp|Q14V87|KLF14_GORGO Krueppel-like factor 14 OS=Gorilla gorilla gorilla GN=KLF14 PE=3 SV=1 26 85 1.0E-09
sp|B5DE03|WT1_XENTR Wilms tumor protein homolog OS=Xenopus tropicalis GN=wt1 PE=2 SV=1 28 85 3.0E-09
sp|Q19A41|KLF14_MOUSE Krueppel-like factor 14 OS=Mus musculus GN=Klf14 PE=2 SV=1 18 85 3.0E-09
sp|P46099|KLF1_MOUSE Krueppel-like factor 1 OS=Mus musculus GN=Klf1 PE=1 SV=2 19 85 4.0E-08
sp|Q13887|KLF5_HUMAN Krueppel-like factor 5 OS=Homo sapiens GN=KLF5 PE=1 SV=2 11 85 6.0E-08
sp|Q8K1S5|KLF11_MOUSE Krueppel-like factor 11 OS=Mus musculus GN=Klf11 PE=2 SV=3 22 85 7.0E-08
sp|P39768|OPA_DROME Pair-rule protein odd-paired OS=Drosophila melanogaster GN=opa PE=2 SV=2 30 105 1.0E-07
sp|O08584|KLF6_MOUSE Krueppel-like factor 6 OS=Mus musculus GN=Klf6 PE=2 SV=3 9 87 2.0E-07
sp|Q9Y2Y9|KLF13_HUMAN Krueppel-like factor 13 OS=Homo sapiens GN=KLF13 PE=1 SV=1 28 85 2.0E-07
sp|O14901|KLF11_HUMAN Krueppel-like factor 11 OS=Homo sapiens GN=KLF11 PE=1 SV=2 22 85 2.0E-07
sp|Q13118|KLF10_HUMAN Krueppel-like factor 10 OS=Homo sapiens GN=KLF10 PE=1 SV=1 28 85 3.0E-07
sp|O08876|KLF10_RAT Krueppel-like factor 10 OS=Rattus norvegicus GN=Klf10 PE=2 SV=1 28 85 4.0E-07
sp|O89091|KLF10_MOUSE Krueppel-like factor 10 OS=Mus musculus GN=Klf10 PE=1 SV=1 28 85 4.0E-07
sp|Q9JJZ6|KLF13_MOUSE Krueppel-like factor 13 OS=Mus musculus GN=Klf13 PE=1 SV=2 28 85 8.0E-07
sp|Q9UTS5|ZAS1_SCHPO Zinc finger protein zas1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=zas1 PE=2 SV=1 20 83 1.0E-06
sp|Q9Z0Z7|KLF5_MOUSE Krueppel-like factor 5 OS=Mus musculus GN=Klf5 PE=2 SV=2 20 85 1.0E-06
sp|O35819|KLF6_RAT Krueppel-like factor 6 OS=Rattus norvegicus GN=Klf6 PE=2 SV=2 9 85 2.0E-06
sp|Q60793|KLF4_MOUSE Krueppel-like factor 4 OS=Mus musculus GN=Klf4 PE=1 SV=3 23 85 2.0E-06
sp|Q13351|KLF1_HUMAN Krueppel-like factor 1 OS=Homo sapiens GN=KLF1 PE=1 SV=1 19 85 2.0E-06
sp|Q8K1S5|KLF11_MOUSE Krueppel-like factor 11 OS=Mus musculus GN=Klf11 PE=2 SV=3 28 87 3.0E-06
sp|P57682|KLF3_HUMAN Krueppel-like factor 3 OS=Homo sapiens GN=KLF3 PE=1 SV=1 32 85 3.0E-06
sp|Q7TQ40|ZIC5_MOUSE Zinc finger protein ZIC 5 OS=Mus musculus GN=Zic5 PE=1 SV=1 28 105 3.0E-06
sp|O43474|KLF4_HUMAN Krueppel-like factor 4 OS=Homo sapiens GN=KLF4 PE=1 SV=3 20 85 3.0E-06
sp|O95600|KLF8_HUMAN Krueppel-like factor 8 OS=Homo sapiens GN=KLF8 PE=1 SV=2 4 85 3.0E-06
sp|Q60980|KLF3_MOUSE Krueppel-like factor 3 OS=Mus musculus GN=Klf3 PE=1 SV=1 32 85 3.0E-06
sp|Q96T25|ZIC5_HUMAN Zinc finger protein ZIC 5 OS=Homo sapiens GN=ZIC5 PE=1 SV=2 28 105 3.0E-06
sp|Q8CFA7|KLF17_MOUSE Krueppel-like factor 17 OS=Mus musculus GN=Klf17 PE=1 SV=2 21 85 3.0E-06
sp|Q9Y4X4|KLF12_HUMAN Krueppel-like factor 12 OS=Homo sapiens GN=KLF12 PE=1 SV=2 1 85 3.0E-06
sp|P58334|KLF16_MOUSE Krueppel-like factor 16 OS=Mus musculus GN=Klf16 PE=1 SV=2 25 85 3.0E-06
sp|O14901|KLF11_HUMAN Krueppel-like factor 11 OS=Homo sapiens GN=KLF11 PE=1 SV=2 30 124 4.0E-06
sp|Q90WR8|SP3_CHICK Transcription factor Sp3 OS=Gallus gallus GN=SP3 PE=1 SV=1 17 85 4.0E-06
sp|Q99612|KLF6_HUMAN Krueppel-like factor 6 OS=Homo sapiens GN=KLF6 PE=1 SV=3 17 85 5.0E-06
sp|P34708|TRA1_CAEEL Sex-determining transformer protein 1 OS=Caenorhabditis elegans GN=tra-1 PE=1 SV=1 32 105 6.0E-06
sp|Q99JB0|KLF7_MOUSE Krueppel-like factor 7 OS=Mus musculus GN=Klf7 PE=2 SV=1 10 85 6.0E-06
sp|Q17308|TRA1_CAEBR Sex-determining transformer protein 1 OS=Caenorhabditis briggsae GN=tra-1 PE=1 SV=1 32 90 7.0E-06
sp|Q02447|SP3_HUMAN Transcription factor Sp3 OS=Homo sapiens GN=SP3 PE=1 SV=3 17 85 8.0E-06
sp|Q8C8V1|ZXDC_MOUSE Zinc finger protein ZXDC OS=Mus musculus GN=Zxdc PE=2 SV=1 28 95 8.0E-06
sp|A0JC51|ZIC4_XENLA Zinc finger protein ZIC 4 OS=Xenopus laevis GN=zic4 PE=2 SV=1 28 105 9.0E-06
sp|O35738|KLF12_MOUSE Krueppel-like factor 12 OS=Mus musculus GN=Klf12 PE=1 SV=2 32 85 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0003677 DNA binding Yes
GO:0006351 transcription, DNA-templated Yes
GO:0003676 nucleic acid binding Yes
GO:0005634 nucleus Yes
GO:0008270 zinc ion binding Yes
GO:0044238 primary metabolic process No
GO:0097659 nucleic acid-templated transcription No
GO:0044237 cellular metabolic process No
GO:0043170 macromolecule metabolic process No
GO:0097159 organic cyclic compound binding No
GO:0016070 RNA metabolic process No
GO:0032774 RNA biosynthetic process No
GO:0071704 organic substance metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0005488 binding No
GO:0043229 intracellular organelle No
GO:0046872 metal ion binding No
GO:0008152 metabolic process No
GO:0043169 cation binding No
GO:0008150 biological_process No
GO:0044260 cellular macromolecule metabolic process No
GO:0046483 heterocycle metabolic process No
GO:0043226 organelle No
GO:0003674 molecular_function No
GO:0005575 cellular_component No
GO:0090304 nucleic acid metabolic process No
GO:0043227 membrane-bounded organelle No
GO:0009987 cellular process No
GO:1901363 heterocyclic compound binding No
GO:0043167 ion binding No
GO:0018130 heterocycle biosynthetic process No
GO:1901362 organic cyclic compound biosynthetic process No
GO:0044424 intracellular part No
GO:0034645 cellular macromolecule biosynthetic process No
GO:0009059 macromolecule biosynthetic process No
GO:0044249 cellular biosynthetic process No
GO:0044271 cellular nitrogen compound biosynthetic process No
GO:0019438 aromatic compound biosynthetic process No
GO:0006725 cellular aromatic compound metabolic process No
GO:0009058 biosynthetic process No
GO:0034654 nucleobase-containing compound biosynthetic process No
GO:0044464 cell part No
GO:1901576 organic substance biosynthetic process No
GO:0043231 intracellular membrane-bounded organelle No
GO:0006139 nucleobase-containing compound metabolic process No
GO:1901360 organic cyclic compound metabolic process No
GO:0046914 transition metal ion binding No
GO:0034641 cellular nitrogen compound metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 30 0.45

Transmembrane Domains

(None)

Transcription Factor Class

Transcription Factor Class
(based on PFAM domains)
Fungal Specific TF
C2H2 zinc finger

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|8983
MASQQQPASSVSSRAGGYKRASRRGAPRRFACDHPGCDKIYSRAEHLQRHQLNHNPKEIFRCDVGDCDQEFVRLD
LLARHKKRHTSSYTPRNRIPSFDYRTTAPAKPQHRPRPQQPFVHHPTSSAGPHDSAILLTPNANPEPAPAFLHHP
LPGATSHAATAWSPAGQRRERGNPMAMQQQVFYAGRPDVGPEPVAAPAPAPAPVPAPAPAPAPAFANVAFPADDQ
LLPGNFAAWLFDPQTTYPDISLAGIPFLEGGLESAFNNKLHYDYESLNSLSPNEQASRQSEAADAWITEPRRQEL
LSWFQVFCKKQPRYESLMGSLVHESNGDMTALSLDMLQDCLREFWDNVSPRLPIVHQHTFFVRDCHVFLLLVMLA
LGAASLCRRDPTGRRSEYGAFADVIIASARWEILTADDATPPVGLWVAQALLLLEFYEKLCSSRRFHERAHIYHP
AFLTLLRRGSPLIGRTGSESPPEPDNAGPQRQALAVSLDSRTWWIRWAERESMHRVVYAAFMLDIIHAAMFGHTA
DMAAHEIRLPLPCDDSLWTAGSPDVVRQLDANFRMYGLKQVSFLDGLKSALHGKDVKTHSFGRMIIVCGLLSVGW
HLDHKETHLKWLELRTSPAETQGNWRKTLLRALGRWKENFDMAACDGAAETPGRPAVSSGPIDSASLLFHLAHIS
LHADIVDCQVYAGARRLLGRKVSSRDYTNAVTRMGAWARQPSTRHAILHAFKLLHGVLVAPSAGGETGGGGRGGG
GAAQYSLRGETDPHRPWIMYYAVLAIWAFIQAVGRPAGKGFPLRPSQMGHSTYARMAEYLSAVARLPELDERTAA
TLHEGLPELLDVMESILDEAGTELLREARERLGVCRDKLLGGSTHG*
Coding >Hirsu2|8983
ATGGCGTCGCAACAGCAGCCGGCGAGCTCTGTCTCCTCCAGGGCCGGAGGCTACAAGAGGGCCAGCCGCAGAGGC
GCGCCCCGGCGCTTTGCCTGCGATCATCCGGGCTGCGACAAAATCTACTCGAGGGCCGAGCACCTGCAGCGCCAT
CAGCTGAACCACAATCCCAAGGAGATCTTCCGCTGCGACGTTGGCGACTGCGACCAGGAGTTTGTCCGCCTCGAT
CTGCTCGCGCGCCACAAGAAACGCCATACCTCCTCCTACACGCCGCGGAATCGCATCCCCAGCTTCGACTACCGA
ACGACGGCACCGGCCAAGCCTCAGCACCGGCCTCGCCCGCAACAGCCCTTCGTCCACCATCCGACATCCTCCGCC
GGGCCCCACGACTCGGCCATCCTCCTCACTCCGAATGCGAACCCGGAGCCCGCCCCGGCCTTCCTCCACCACCCG
CTGCCGGGCGCCACGAGCCACGCGGCGACAGCATGGAGCCCTGCCGGCCAGAGGAGGGAGCGGGGGAACCCCATG
GCCATGCAGCAGCAGGTCTTTTACGCCGGCCGCCCAGACGTCGGACCGGAACCCGTTGCCGCGCCCGCTCCCGCG
CCCGCTCCCGTGCCCGCTCCCGCGCCCGCTCCCGCCCCGGCCTTCGCTAATGTCGCCTTCCCCGCCGACGACCAG
CTTTTGCCGGGCAACTTCGCCGCCTGGCTCTTCGACCCTCAGACCACGTATCCCGACATCAGCCTGGCGGGGATC
CCCTTCCTCGAGGGCGGTCTGGAGTCGGCCTTCAACAACAAACTGCATTACGACTACGAGTCGCTCAACAGCCTC
TCGCCGAACGAACAGGCGTCGCGCCAGTCCGAGGCCGCCGACGCCTGGATCACGGAGCCTCGCCGCCAGGAGCTG
CTGTCCTGGTTCCAGGTCTTCTGCAAGAAGCAGCCCCGATACGAGAGCCTCATGGGCAGCCTCGTGCACGAGAGC
AACGGCGACATGACGGCGCTGAGCCTCGACATGCTGCAGGACTGTCTCAGGGAGTTTTGGGACAACGTATCTCCT
CGGCTGCCCATCGTACACCAACACACCTTCTTCGTCAGGGACTGCCACGTCTTCCTCCTCCTCGTCATGCTGGCC
CTGGGTGCGGCGTCGCTCTGCCGCCGGGACCCGACCGGTCGGCGGTCCGAGTACGGCGCGTTCGCCGACGTCATC
ATTGCCAGCGCGAGGTGGGAGATATTGACGGCGGACGATGCGACGCCCCCGGTTGGCCTCTGGGTCGCACAGGCG
CTCCTCCTGCTCGAGTTCTACGAGAAGCTGTGCTCGTCGAGACGGTTCCACGAGCGAGCCCACATATACCACCCC
GCCTTCTTGACCCTGCTCCGGCGCGGAAGCCCTCTGATTGGGAGGACCGGCAGCGAATCGCCGCCGGAGCCGGAC
AACGCCGGGCCCCAGCGGCAGGCGCTCGCCGTGTCTCTCGACTCGCGCACGTGGTGGATCCGCTGGGCCGAGAGG
GAGTCGATGCACCGCGTCGTCTACGCCGCCTTCATGCTCGACATCATCCATGCCGCCATGTTCGGCCACACGGCC
GACATGGCGGCGCACGAGATACGCCTGCCGCTGCCCTGCGACGACAGCCTATGGACGGCCGGCAGCCCCGACGTC
GTCCGGCAGCTCGACGCCAACTTCCGCATGTACGGCCTCAAGCAGGTCTCCTTCCTCGACGGCCTCAAGAGCGCC
CTGCACGGCAAGGACGTCAAGACGCACTCCTTCGGCCGCATGATCATCGTCTGCGGGCTGCTGAGCGTGGGCTGG
CACCTGGACCACAAGGAGACGCACCTCAAGTGGCTCGAGCTGCGGACGTCGCCGGCGGAGACGCAGGGCAACTGG
AGGAAGACGCTGCTCCGGGCGCTGGGCCGGTGGAAGGAGAACTTCGACATGGCCGCCTGCGACGGCGCCGCCGAG
ACGCCCGGGCGCCCCGCCGTGTCCAGCGGGCCGATCGACAGCGCCTCGCTACTCTTCCACCTGGCTCACATCAGC
CTGCACGCCGACATCGTTGACTGCCAGGTCTACGCCGGCGCCCGGCGGCTGCTGGGCCGCAAGGTGTCGTCGAGG
GACTACACGAACGCGGTGACGCGCATGGGCGCCTGGGCGCGGCAGCCGTCGACGCGGCACGCCATCCTACACGCC
TTCAAGCTGCTCCACGGCGTGCTGGTGGCGCCGTCAGCCGGCGGCGAGACCGGCGGCGGCGGCCGCGGCGGCGGG
GGAGCGGCGCAGTACTCGCTGCGCGGCGAGACGGACCCGCACCGGCCGTGGATCATGTACTACGCCGTGCTGGCC
ATCTGGGCCTTCATCCAGGCCGTCGGCCGGCCGGCCGGCAAGGGCTTCCCGCTGCGGCCGTCGCAGATGGGCCAC
AGCACGTACGCGCGCATGGCCGAGTACCTGTCGGCCGTGGCCCGGCTGCCAGAGCTGGACGAGCGGACGGCGGCG
ACGCTGCACGAGGGGCTGCCGGAGCTGCTCGACGTCATGGAGAGCATCCTGGACGAGGCCGGCACGGAGCTGCTG
CGCGAGGCGCGCGAGCGGCTCGGCGTCTGCCGCGACAAGCTCCTCGGCGGCTCTACGCATGGCTGA
Transcript >Hirsu2|8983
ATGGCGTCGCAACAGCAGCCGGCGAGCTCTGTCTCCTCCAGGGCCGGAGGCTACAAGAGGGCCAGCCGCAGAGGC
GCGCCCCGGCGCTTTGCCTGCGATCATCCGGGCTGCGACAAAATCTACTCGAGGGCCGAGCACCTGCAGCGCCAT
CAGCTGAACCACAATCCCAAGGAGATCTTCCGCTGCGACGTTGGCGACTGCGACCAGGAGTTTGTCCGCCTCGAT
CTGCTCGCGCGCCACAAGAAACGCCATACCTCCTCCTACACGCCGCGGAATCGCATCCCCAGCTTCGACTACCGA
ACGACGGCACCGGCCAAGCCTCAGCACCGGCCTCGCCCGCAACAGCCCTTCGTCCACCATCCGACATCCTCCGCC
GGGCCCCACGACTCGGCCATCCTCCTCACTCCGAATGCGAACCCGGAGCCCGCCCCGGCCTTCCTCCACCACCCG
CTGCCGGGCGCCACGAGCCACGCGGCGACAGCATGGAGCCCTGCCGGCCAGAGGAGGGAGCGGGGGAACCCCATG
GCCATGCAGCAGCAGGTCTTTTACGCCGGCCGCCCAGACGTCGGACCGGAACCCGTTGCCGCGCCCGCTCCCGCG
CCCGCTCCCGTGCCCGCTCCCGCGCCCGCTCCCGCCCCGGCCTTCGCTAATGTCGCCTTCCCCGCCGACGACCAG
CTTTTGCCGGGCAACTTCGCCGCCTGGCTCTTCGACCCTCAGACCACGTATCCCGACATCAGCCTGGCGGGGATC
CCCTTCCTCGAGGGCGGTCTGGAGTCGGCCTTCAACAACAAACTGCATTACGACTACGAGTCGCTCAACAGCCTC
TCGCCGAACGAACAGGCGTCGCGCCAGTCCGAGGCCGCCGACGCCTGGATCACGGAGCCTCGCCGCCAGGAGCTG
CTGTCCTGGTTCCAGGTCTTCTGCAAGAAGCAGCCCCGATACGAGAGCCTCATGGGCAGCCTCGTGCACGAGAGC
AACGGCGACATGACGGCGCTGAGCCTCGACATGCTGCAGGACTGTCTCAGGGAGTTTTGGGACAACGTATCTCCT
CGGCTGCCCATCGTACACCAACACACCTTCTTCGTCAGGGACTGCCACGTCTTCCTCCTCCTCGTCATGCTGGCC
CTGGGTGCGGCGTCGCTCTGCCGCCGGGACCCGACCGGTCGGCGGTCCGAGTACGGCGCGTTCGCCGACGTCATC
ATTGCCAGCGCGAGGTGGGAGATATTGACGGCGGACGATGCGACGCCCCCGGTTGGCCTCTGGGTCGCACAGGCG
CTCCTCCTGCTCGAGTTCTACGAGAAGCTGTGCTCGTCGAGACGGTTCCACGAGCGAGCCCACATATACCACCCC
GCCTTCTTGACCCTGCTCCGGCGCGGAAGCCCTCTGATTGGGAGGACCGGCAGCGAATCGCCGCCGGAGCCGGAC
AACGCCGGGCCCCAGCGGCAGGCGCTCGCCGTGTCTCTCGACTCGCGCACGTGGTGGATCCGCTGGGCCGAGAGG
GAGTCGATGCACCGCGTCGTCTACGCCGCCTTCATGCTCGACATCATCCATGCCGCCATGTTCGGCCACACGGCC
GACATGGCGGCGCACGAGATACGCCTGCCGCTGCCCTGCGACGACAGCCTATGGACGGCCGGCAGCCCCGACGTC
GTCCGGCAGCTCGACGCCAACTTCCGCATGTACGGCCTCAAGCAGGTCTCCTTCCTCGACGGCCTCAAGAGCGCC
CTGCACGGCAAGGACGTCAAGACGCACTCCTTCGGCCGCATGATCATCGTCTGCGGGCTGCTGAGCGTGGGCTGG
CACCTGGACCACAAGGAGACGCACCTCAAGTGGCTCGAGCTGCGGACGTCGCCGGCGGAGACGCAGGGCAACTGG
AGGAAGACGCTGCTCCGGGCGCTGGGCCGGTGGAAGGAGAACTTCGACATGGCCGCCTGCGACGGCGCCGCCGAG
ACGCCCGGGCGCCCCGCCGTGTCCAGCGGGCCGATCGACAGCGCCTCGCTACTCTTCCACCTGGCTCACATCAGC
CTGCACGCCGACATCGTTGACTGCCAGGTCTACGCCGGCGCCCGGCGGCTGCTGGGCCGCAAGGTGTCGTCGAGG
GACTACACGAACGCGGTGACGCGCATGGGCGCCTGGGCGCGGCAGCCGTCGACGCGGCACGCCATCCTACACGCC
TTCAAGCTGCTCCACGGCGTGCTGGTGGCGCCGTCAGCCGGCGGCGAGACCGGCGGCGGCGGCCGCGGCGGCGGG
GGAGCGGCGCAGTACTCGCTGCGCGGCGAGACGGACCCGCACCGGCCGTGGATCATGTACTACGCCGTGCTGGCC
ATCTGGGCCTTCATCCAGGCCGTCGGCCGGCCGGCCGGCAAGGGCTTCCCGCTGCGGCCGTCGCAGATGGGCCAC
AGCACGTACGCGCGCATGGCCGAGTACCTGTCGGCCGTGGCCCGGCTGCCAGAGCTGGACGAGCGGACGGCGGCG
ACGCTGCACGAGGGGCTGCCGGAGCTGCTCGACGTCATGGAGAGCATCCTGGACGAGGCCGGCACGGAGCTGCTG
CGCGAGGCGCGCGAGCGGCTCGGCGTCTGCCGCGACAAGCTCCTCGGCGGCTCTACGCATGGCTGA
Gene >Hirsu2|8983
ATGGCGTCGCAACAGCAGCCGGCGAGCTCTGTCTCCTCCAGGGCCGGAGGCTACAAGAGGGCCAGCCGCAGAGGC
GCGCCCCGGCGCTTTGCCTGCGATCATCCGGGCTGCGACAAAATCTACTCGAGGGCCGAGCACCTGCAGCGCCAT
CAGCTGAACCGTGAGCACCCGGCCGAGTCGACCTTGCGCCCGTGCCCCAGCTTGCTGACCGGCCCGAGCAGACAA
TCCCAAGGAGATCTTCCGCTGCGACGTTGGCGACTGCGACCAGGAGTTTGTCCGCCTCGATCTGCTCGCGCGCCA
CAAGAAACGCCATACCTCCTCCTACACGCCGCGGAATCGCATCCCCAGCTTCGACTACCGAACGACGGCACCGGC
CAAGCCTCAGCACCGGCCTCGCCCGCAACAGCCCTTCGTCCACCATCCGACATCCTCCGCCGGGCCCCACGACTC
GGCCATCCTCCTCACTCCGAATGCGAACCCGGAGCCCGCCCCGGCCTTCCTCCACCACCCGCTGCCGGGCGCCAC
GAGCCACGCGGCGACAGCATGGAGCCCTGCCGGCCAGAGGAGGGAGCGGGGGAACCCCATGGCCATGCAGCAGCA
GGTCTTTTACGCCGGCCGCCCAGACGTCGGACCGGAACCCGTTGCCGCGCCCGCTCCCGCGCCCGCTCCCGTGCC
CGCTCCCGCGCCCGCTCCCGCCCCGGCCTTCGCTAATGTCGCCTTCCCCGCCGACGACCAGCTTTTGCCGGGCAA
CTTCGCCGCCTGGCTCTTCGACCCTCAGACCACGTATCCCGACATCAGCCTGGCGGGGATCCCCTTCCTCGAGGG
CGGTCTGGAGTCGGCCTTCAACAACAAACTGCATTACGACTACGAGTCGCTCAACAGCCTCTCGCCGAACGAACA
GGCGTCGCGCCAGTCCGAGGCCGCCGACGCCTGGATCACGGAGCCTCGCCGCCAGGAGCTGCTGTCCTGGTTCCA
GGTCTTCTGCAAGAAGCAGCCCCGATACGAGAGCCTCATGGGCAGCCTCGTGCACGAGAGCAACGGCGACATGAC
GGCGCTGAGCCTCGACATGCTGCAGGACTGTCTCAGGGAGTTTTGGGACAACGTATCTCCTCGGCTGCCCATCGT
ACACCAACACACCTTCTTCGTCAGGGACTGCCACGTCTTCCTCCTCCTCGTCATGCTGGCCCTGGGTGCGGCGTC
GCTCTGCCGCCGGGACCCGACCGGTCGGCGGTCCGAGTACGGCGCGTTCGCCGACGTCATCATTGCCAGCGCGAG
GTGGGAGATATTGACGGCGGACGATGCGACGCCCCCGGTTGGCCTCTGGGTCGCACAGGCGCTCCTCCTGCTCGA
GTTCTACGAGAAGCTGTGCTCGTCGAGACGGTTCCACGAGCGAGCCCACATATACCACCCCGCCTTCTTGACCCT
GCTCCGGCGCGGAAGCCCTCTGATTGGGAGGACCGGCAGCGAATCGCCGCCGGAGCCGGACAACGCCGGGCCCCA
GCGGCAGGCGCTCGCCGTGTCTCTCGACTCGCGCACGTGGTGGATCCGCTGGGCCGAGAGGGAGTCGATGCACCG
CGTCGTCTACGCCGCCTTCATGCTCGACATCATCCATGCCGCCATGTTCGGCCACACGGCCGACATGGCGGCGCA
CGAGATACGCCTGCCGCTGCCCTGCGACGACAGCCTATGGACGGCCGGCAGCCCCGACGTCGTCCGGCAGCTCGA
CGCCAACTTCCGCATGTACGGCCTCAAGCAGGTCTCCTTCCTCGACGGCCTCAAGAGCGCCCTGCACGGCAAGGA
CGTCAAGACGCACTCCTTCGGCCGCATGATCATCGTCTGCGGGCTGCTGAGCGTGGGCTGGCACCTGGACCACAA
GGAGACGCACCTCAAGTGGCTCGAGCTGCGGACGTCGCCGGCGGAGACGCAGGGCAACTGGAGGAAGACGCTGCT
CCGGGCGCTGGGCCGGTGGAAGGAGAACTTCGACATGGCCGCCTGCGACGGCGCCGCCGAGACGCCCGGGCGCCC
CGCCGTGTCCAGCGGGCCGATCGACAGCGCCTCGCTACTCTTCCACCTGGCTCACATCAGCCTGCACGCCGACAT
CGTTGACTGCCAGGTCTACGCCGGCGCCCGGCGGCTGCTGGGCCGCAAGGTGTCGTCGAGGGACTACACGAACGC
GGTGACGCGCATGGGCGCCTGGGCGCGGCAGCCGTCGACGCGGCACGCCATCCTACACGCCTTCAAGCTGCTCCA
CGGCGTGCTGGTGGCGCCGTCAGCCGGCGGCGAGACCGGCGGCGGCGGCCGCGGCGGCGGGGGAGCGGCGCAGTA
CTCGCTGCGCGGCGAGACGGACCCGCACCGGCCGTGGATCATGTACTACGCCGTGCTGGCCATCTGGGCCTTCAT
CCAGGCCGTCGGCCGGCCGGCCGGCAAGGGCTTCCCGCTGCGGCCGTCGCAGATGGGCCACAGCACGTACGCGCG
CATGGCCGAGTACCTGTCGGCCGTGGCCCGGCTGCCAGAGCTGGACGAGCGGACGGCGGCGACGCTGCACGAGGG
GCTGCCGGAGCTGCTCGACGTCATGGAGAGCATCCTGGACGAGGCCGGCACGGAGCTGCTGCGCGAGGCGCGCGA
GCGGCTCGGCGTCTGCCGCGACAAGCTCCTCGGCGGCTCTACGCATGGCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail