Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|8976
Gene name
LocationContig_62:36751..40981
Strand+
Gene length (bp)4230
Transcript length (bp)4152
Coding sequence length (bp)4152
Protein length (aa) 1384

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01077 NIR_SIR Nitrite and sulphite reductase 4Fe-4S domain 2.5E-48 969 1133
PF03460 NIR_SIR_ferr Nitrite/Sulfite reductase ferredoxin-like half domain 2.2E-13 874 933
PF03460 NIR_SIR_ferr Nitrite/Sulfite reductase ferredoxin-like half domain 2.4E-13 1152 1220
PF00258 Flavodoxin_1 Flavodoxin 5.1E-29 646 788

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P47169|MET5_YEAST Sulfite reductase [NADPH] subunit beta OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MET5 PE=1 SV=1 199 1378 0.0E+00
sp|Q1K9C2|MET5_SCHPO Sulfite reductase [NADPH] subunit beta OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sir1 PE=3 SV=1 163 1378 0.0E+00
sp|A4IMT6|CYSI_GEOTN Sulfite reductase [NADPH] hemoprotein beta-component OS=Geobacillus thermodenitrificans (strain NG80-2) GN=cysI PE=3 SV=1 809 1373 0.0E+00
sp|Q5L041|CYSI_GEOKA Sulfite reductase [NADPH] hemoprotein beta-component OS=Geobacillus kaustophilus (strain HTA426) GN=cysI PE=3 SV=1 800 1373 0.0E+00
sp|B7GJU8|CYSI_ANOFW Sulfite reductase [NADPH] hemoprotein beta-component OS=Anoxybacillus flavithermus (strain DSM 21510 / WK1) GN=cysI PE=3 SV=1 809 1373 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P47169|MET5_YEAST Sulfite reductase [NADPH] subunit beta OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MET5 PE=1 SV=1 199 1378 0.0E+00
sp|Q1K9C2|MET5_SCHPO Sulfite reductase [NADPH] subunit beta OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sir1 PE=3 SV=1 163 1378 0.0E+00
sp|A4IMT6|CYSI_GEOTN Sulfite reductase [NADPH] hemoprotein beta-component OS=Geobacillus thermodenitrificans (strain NG80-2) GN=cysI PE=3 SV=1 809 1373 0.0E+00
sp|Q5L041|CYSI_GEOKA Sulfite reductase [NADPH] hemoprotein beta-component OS=Geobacillus kaustophilus (strain HTA426) GN=cysI PE=3 SV=1 800 1373 0.0E+00
sp|B7GJU8|CYSI_ANOFW Sulfite reductase [NADPH] hemoprotein beta-component OS=Anoxybacillus flavithermus (strain DSM 21510 / WK1) GN=cysI PE=3 SV=1 809 1373 0.0E+00
sp|C0Z9X2|CYSI_BREBN Sulfite reductase [NADPH] hemoprotein beta-component OS=Brevibacillus brevis (strain 47 / JCM 6285 / NBRC 100599) GN=cysI PE=3 SV=1 814 1373 0.0E+00
sp|Q9KF75|CYSI_BACHD Sulfite reductase [NADPH] hemoprotein beta-component OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=cysI PE=3 SV=1 807 1373 0.0E+00
sp|Q4L9F1|CYSI_STAHJ Sulfite reductase [NADPH] hemoprotein beta-component OS=Staphylococcus haemolyticus (strain JCSC1435) GN=cysI PE=3 SV=1 814 1372 0.0E+00
sp|A7Z8R5|CYSI_BACMF Sulfite reductase [NADPH] hemoprotein beta-component OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=cysI PE=3 SV=1 807 1373 0.0E+00
sp|Q65L57|CYSI_BACLD Sulfite reductase [NADPH] hemoprotein beta-component OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=cysI PE=3 SV=1 807 1373 0.0E+00
sp|B9DLM4|CYSI_STACT Sulfite reductase [NADPH] hemoprotein beta-component OS=Staphylococcus carnosus (strain TM300) GN=cysI PE=3 SV=1 817 1371 0.0E+00
sp|Q5WKE7|CYSI_BACSK Sulfite reductase [NADPH] hemoprotein beta-component OS=Bacillus clausii (strain KSM-K16) GN=cysI PE=3 SV=1 806 1372 0.0E+00
sp|Q8EQP0|CYSI_OCEIH Sulfite reductase [NADPH] hemoprotein beta-component OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=cysI PE=3 SV=1 814 1372 0.0E+00
sp|O32213|CYSI_BACSU Sulfite reductase [NADPH] hemoprotein beta-component OS=Bacillus subtilis (strain 168) GN=cysI PE=1 SV=1 810 1373 0.0E+00
sp|Q8CMX5|CYSI_STAES Sulfite reductase [NADPH] hemoprotein beta-component OS=Staphylococcus epidermidis (strain ATCC 12228) GN=cysI PE=3 SV=1 814 1372 0.0E+00
sp|Q5HKZ7|CYSI_STAEQ Sulfite reductase [NADPH] hemoprotein beta-component OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=cysI PE=3 SV=1 814 1372 0.0E+00
sp|Q49UL9|CYSI_STAS1 Sulfite reductase [NADPH] hemoprotein beta-component OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=cysI PE=3 SV=1 814 1372 0.0E+00
sp|Q3JBJ1|CYSI_NITOC Sulfite reductase [NADPH] hemoprotein beta-component OS=Nitrosococcus oceani (strain ATCC 19707 / NCIMB 11848) GN=cysI PE=3 SV=1 814 1378 0.0E+00
sp|B1HXC1|CYSI_LYSSC Sulfite reductase [NADPH] hemoprotein beta-component OS=Lysinibacillus sphaericus (strain C3-41) GN=cysI PE=3 SV=1 805 1372 0.0E+00
sp|C6CXN6|CYSI_PAESJ Sulfite reductase [NADPH] hemoprotein beta-component OS=Paenibacillus sp. (strain JDR-2) GN=cysI PE=3 SV=1 805 1373 0.0E+00
sp|A8FDY3|CYSI_BACP2 Sulfite reductase [NADPH] hemoprotein beta-component OS=Bacillus pumilus (strain SAFR-032) GN=cysI PE=3 SV=1 807 1372 0.0E+00
sp|B8IRY2|CYSI_METNO Sulfite reductase [NADPH] hemoprotein beta-component OS=Methylobacterium nodulans (strain ORS2060 / LMG 21967) GN=cysI PE=3 SV=1 813 1373 0.0E+00
sp|C5APZ1|CYSI_METEA Sulfite reductase [NADPH] hemoprotein beta-component OS=Methylobacterium extorquens (strain ATCC 14718 / DSM 1338 / AM1) GN=cysI PE=3 SV=1 813 1373 0.0E+00
sp|B7L0Y4|CYSI_METC4 Sulfite reductase [NADPH] hemoprotein beta-component OS=Methylobacterium extorquens (strain CM4 / NCIMB 13688) GN=cysI PE=3 SV=1 813 1373 0.0E+00
sp|A9W4X6|CYSI_METEP Sulfite reductase [NADPH] hemoprotein beta-component OS=Methylobacterium extorquens (strain PA1) GN=cysI PE=3 SV=2 813 1373 0.0E+00
sp|B0U8Y9|CYSI_METS4 Sulfite reductase [NADPH] hemoprotein beta-component OS=Methylobacterium sp. (strain 4-46) GN=cysI PE=3 SV=1 813 1373 0.0E+00
sp|B1Z7C5|CYSI_METPB Sulfite reductase [NADPH] hemoprotein beta-component OS=Methylobacterium populi (strain ATCC BAA-705 / NCIMB 13946 / BJ001) GN=cysI PE=3 SV=1 813 1373 0.0E+00
sp|Q07Y86|CYSI_SHEFN Sulfite reductase [NADPH] hemoprotein beta-component OS=Shewanella frigidimarina (strain NCIMB 400) GN=cysI PE=3 SV=1 813 1372 0.0E+00
sp|Q0HYB3|CYSI_SHESR Sulfite reductase [NADPH] hemoprotein beta-component OS=Shewanella sp. (strain MR-7) GN=cysI PE=3 SV=1 813 1372 0.0E+00
sp|A0KTH5|CYSI_SHESA Sulfite reductase [NADPH] hemoprotein beta-component OS=Shewanella sp. (strain ANA-3) GN=cysI PE=3 SV=1 813 1372 0.0E+00
sp|B1LS97|CYSI_METRJ Sulfite reductase [NADPH] hemoprotein beta-component OS=Methylobacterium radiotolerans (strain ATCC 27329 / DSM 1819 / JCM 2831) GN=cysI PE=3 SV=1 813 1373 0.0E+00
sp|Q0HFL7|CYSI_SHESM Sulfite reductase [NADPH] hemoprotein beta-component OS=Shewanella sp. (strain MR-4) GN=cysI PE=3 SV=1 813 1372 0.0E+00
sp|Q1QU16|CYSI_CHRSD Sulfite reductase [NADPH] hemoprotein beta-component OS=Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768) GN=cysI PE=3 SV=1 813 1372 0.0E+00
sp|Q8EB00|CYSI_SHEON Sulfite reductase [NADPH] hemoprotein beta-component OS=Shewanella oneidensis (strain MR-1) GN=cysI PE=3 SV=1 813 1372 0.0E+00
sp|Q12QQ5|CYSI_SHEDO Sulfite reductase [NADPH] hemoprotein beta-component OS=Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013) GN=cysI PE=3 SV=1 812 1372 0.0E+00
sp|A1RGD7|CYSI_SHESW Sulfite reductase [NADPH] hemoprotein beta-component OS=Shewanella sp. (strain W3-18-1) GN=cysI PE=3 SV=1 813 1372 0.0E+00
sp|A4Y9Z3|CYSI_SHEPC Sulfite reductase [NADPH] hemoprotein beta-component OS=Shewanella putrefaciens (strain CN-32 / ATCC BAA-453) GN=cysI PE=3 SV=1 813 1372 0.0E+00
sp|A8FZY7|CYSI_SHESH Sulfite reductase [NADPH] hemoprotein beta-component OS=Shewanella sediminis (strain HAW-EB3) GN=cysI PE=3 SV=2 813 1373 0.0E+00
sp|Q1D9W9|CYSI_MYXXD Sulfite reductase [NADPH] hemoprotein beta-component OS=Myxococcus xanthus (strain DK 1622) GN=cysI PE=3 SV=1 804 1362 0.0E+00
sp|A6WJT5|CYSI_SHEB8 Sulfite reductase [NADPH] hemoprotein beta-component OS=Shewanella baltica (strain OS185) GN=cysI PE=3 SV=1 813 1372 0.0E+00
sp|A9L2P8|CYSI_SHEB9 Sulfite reductase [NADPH] hemoprotein beta-component OS=Shewanella baltica (strain OS195) GN=cysI PE=3 SV=1 813 1372 0.0E+00
sp|A3D829|CYSI_SHEB5 Sulfite reductase [NADPH] hemoprotein beta-component OS=Shewanella baltica (strain OS155 / ATCC BAA-1091) GN=cysI PE=3 SV=1 813 1372 0.0E+00
sp|A3QAP0|CYSI_SHELP Sulfite reductase [NADPH] hemoprotein beta-component OS=Shewanella loihica (strain ATCC BAA-1088 / PV-4) GN=cysI PE=3 SV=1 812 1372 0.0E+00
sp|B1KE86|CYSI_SHEWM Sulfite reductase [NADPH] hemoprotein beta-component OS=Shewanella woodyi (strain ATCC 51908 / MS32) GN=cysI PE=3 SV=2 812 1373 0.0E+00
sp|B8EE51|CYSI_SHEB2 Sulfite reductase [NADPH] hemoprotein beta-component OS=Shewanella baltica (strain OS223) GN=cysI PE=3 SV=1 813 1372 0.0E+00
sp|B0TTE4|CYSI_SHEHH Sulfite reductase [NADPH] hemoprotein beta-component OS=Shewanella halifaxensis (strain HAW-EB4) GN=cysI PE=3 SV=1 812 1372 0.0E+00
sp|B8EKI5|CYSI_METSB Sulfite reductase [NADPH] hemoprotein beta-component OS=Methylocella silvestris (strain BL2 / DSM 15510 / NCIMB 13906) GN=cysI PE=3 SV=1 813 1373 0.0E+00
sp|B8CJV9|CYSI_SHEPW Sulfite reductase [NADPH] hemoprotein beta-component OS=Shewanella piezotolerans (strain WP3 / JCM 13877) GN=cysI PE=3 SV=1 812 1372 0.0E+00
sp|A8H094|CYSI_SHEPA Sulfite reductase [NADPH] hemoprotein beta-component OS=Shewanella pealeana (strain ATCC 700345 / ANG-SQ1) GN=cysI PE=3 SV=1 812 1372 4.0E-180
sp|B5EQW2|CYSI_ACIF5 Sulfite reductase [NADPH] hemoprotein beta-component OS=Acidithiobacillus ferrooxidans (strain ATCC 53993) GN=cysI PE=3 SV=1 814 1362 3.0E-179
sp|B7JAM6|CYSI_ACIF2 Sulfite reductase [NADPH] hemoprotein beta-component OS=Acidithiobacillus ferrooxidans (strain ATCC 23270 / DSM 14882 / CIP 104768 / NCIMB 8455) GN=cysI PE=3 SV=1 814 1362 3.0E-179
sp|Q1QQC7|CYSI_NITHX Sulfite reductase [NADPH] hemoprotein beta-component OS=Nitrobacter hamburgensis (strain X14 / DSM 10229) GN=cysI PE=3 SV=1 813 1373 1.0E-178
sp|A9IT77|CYSI_BORPD Sulfite reductase [NADPH] hemoprotein beta-component OS=Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448) GN=cysI PE=3 SV=1 804 1372 2.0E-178
sp|Q3SV33|CYSI_NITWN Sulfite reductase [NADPH] hemoprotein beta-component OS=Nitrobacter winogradskyi (strain Nb-255 / ATCC 25391) GN=cysI PE=3 SV=1 813 1373 6.0E-177
sp|Q47UW8|CYSI_COLP3 Sulfite reductase [NADPH] hemoprotein beta-component OS=Colwellia psychrerythraea (strain 34H / ATCC BAA-681) GN=cysI PE=3 SV=1 813 1372 2.0E-176
sp|B4RYS6|CYSI_ALTMD Sulfite reductase [NADPH] hemoprotein beta-component OS=Alteromonas macleodii (strain DSM 17117 / Deep ecotype) GN=cysI1 PE=3 SV=1 813 1373 4.0E-174
sp|Q1LTP2|CYSI_BAUCH Sulfite reductase [NADPH] hemoprotein beta-component OS=Baumannia cicadellinicola subsp. Homalodisca coagulata GN=cysI PE=3 SV=1 813 1373 2.0E-173
sp|Q7VQH1|CYSI_BLOFL Sulfite reductase [NADPH] hemoprotein beta-component OS=Blochmannia floridanus GN=cysI PE=3 SV=1 813 1372 1.0E-172
sp|Q5NRM2|CYSI_ZYMMO Sulfite reductase [NADPH] hemoprotein beta-component OS=Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4) GN=cysI PE=3 SV=1 814 1373 1.0E-172
sp|B6JCW3|CYSI_OLICO Sulfite reductase [NADPH] hemoprotein beta-component OS=Oligotropha carboxidovorans (strain ATCC 49405 / DSM 1227 / OM5) GN=cysI PE=3 SV=1 813 1373 1.0E-172
sp|Q2NVN3|CYSI_SODGM Sulfite reductase [NADPH] hemoprotein beta-component OS=Sodalis glossinidius (strain morsitans) GN=cysI PE=3 SV=1 813 1373 3.0E-172
sp|B0U6W0|CYSI_XYLFM Sulfite reductase [NADPH] hemoprotein beta-component OS=Xylella fastidiosa (strain M12) GN=cysI PE=3 SV=1 814 1362 5.0E-172
sp|Q87DH0|CYSI_XYLFT Sulfite reductase [NADPH] hemoprotein beta-component OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=cysI PE=3 SV=2 814 1362 2.0E-171
sp|B2IA31|CYSI_XYLF2 Sulfite reductase [NADPH] hemoprotein beta-component OS=Xylella fastidiosa (strain M23) GN=cysI PE=3 SV=1 814 1362 2.0E-171
sp|A1S9I4|CYSI_SHEAM Sulfite reductase [NADPH] hemoprotein beta-component OS=Shewanella amazonensis (strain ATCC BAA-1098 / SB2B) GN=cysI PE=3 SV=1 813 1372 3.0E-171
sp|Q9PD81|CYSI_XYLFA Sulfite reductase [NADPH] hemoprotein beta-component OS=Xylella fastidiosa (strain 9a5c) GN=cysI PE=3 SV=2 814 1362 1.0E-170
sp|C6CAW9|CYSI_DICDC Sulfite reductase [NADPH] hemoprotein beta-component OS=Dickeya dadantii (strain Ech703) GN=cysI PE=3 SV=1 814 1373 1.0E-170
sp|A1JJS3|CYSI_YERE8 Sulfite reductase [NADPH] hemoprotein beta-component OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=cysI PE=3 SV=1 814 1373 2.0E-170
sp|C4L9J8|CYSI_TOLAT Sulfite reductase [NADPH] hemoprotein beta-component OS=Tolumonas auensis (strain DSM 9187 / TA4) GN=cysI PE=3 SV=1 813 1372 2.0E-170
sp|Q82W45|CYSI_NITEU Sulfite reductase [NADPH] hemoprotein beta-component OS=Nitrosomonas europaea (strain ATCC 19718 / NBRC 14298) GN=cysI PE=3 SV=1 813 1373 4.0E-170
sp|A9N2E5|CYSI_SALPB Sulfite reductase [NADPH] hemoprotein beta-component OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=cysI PE=3 SV=1 814 1371 5.0E-170
sp|Q8P608|CYSI_XANCP Sulfite reductase [NADPH] hemoprotein beta-component OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=cysI PE=3 SV=1 814 1362 8.0E-170
sp|Q57KH8|CYSI_SALCH Sulfite reductase [NADPH] hemoprotein beta-component OS=Salmonella choleraesuis (strain SC-B67) GN=cysI PE=3 SV=3 814 1375 1.0E-169
sp|B0RPG6|CYSI_XANCB Sulfite reductase [NADPH] hemoprotein beta-component OS=Xanthomonas campestris pv. campestris (strain B100) GN=cysI PE=3 SV=2 814 1362 1.0E-169
sp|Q4UY08|CYSI_XANC8 Sulfite reductase [NADPH] hemoprotein beta-component OS=Xanthomonas campestris pv. campestris (strain 8004) GN=cysI PE=3 SV=1 814 1362 1.0E-169
sp|A8G9X7|CYSI_SERP5 Sulfite reductase [NADPH] hemoprotein beta-component OS=Serratia proteamaculans (strain 568) GN=cysI PE=3 SV=1 814 1373 2.0E-169
sp|Q87L91|CYSI_VIBPA Sulfite reductase [NADPH] hemoprotein beta-component OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=cysI PE=3 SV=1 804 1372 2.0E-169
sp|C0PXC5|CYSI_SALPC Sulfite reductase [NADPH] hemoprotein beta-component OS=Salmonella paratyphi C (strain RKS4594) GN=cysI PE=3 SV=1 814 1371 3.0E-169
sp|Q7MHA6|CYSI_VIBVY Sulfite reductase [NADPH] hemoprotein beta-component OS=Vibrio vulnificus (strain YJ016) GN=cysI PE=3 SV=1 813 1372 1.0E-168
sp|B7VI85|CYSI_VIBTL Sulfite reductase [NADPH] hemoprotein beta-component OS=Vibrio tasmaniensis (strain LGP32) GN=cysI PE=3 SV=1 809 1372 1.0E-168
sp|C3LRB7|CYSI_VIBCM Sulfite reductase [NADPH] hemoprotein beta-component OS=Vibrio cholerae serotype O1 (strain M66-2) GN=cysI PE=3 SV=1 813 1372 1.0E-168
sp|Q9KUX3|CYSI_VIBCH Sulfite reductase [NADPH] hemoprotein beta-component OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=cysI PE=3 SV=1 813 1372 1.0E-168
sp|Q0AGU3|CYSI_NITEC Sulfite reductase [NADPH] hemoprotein beta-component OS=Nitrosomonas eutropha (strain C91) GN=cysI PE=3 SV=1 813 1373 1.0E-168
sp|B4T474|CYSI_SALNS Sulfite reductase [NADPH] hemoprotein beta-component OS=Salmonella newport (strain SL254) GN=cysI PE=3 SV=1 814 1371 1.0E-168
sp|A1T054|CYSI_PSYIN Sulfite reductase [NADPH] hemoprotein beta-component OS=Psychromonas ingrahamii (strain 37) GN=cysI PE=3 SV=1 813 1373 1.0E-168
sp|B4TTX8|CYSI_SALSV Sulfite reductase [NADPH] hemoprotein beta-component OS=Salmonella schwarzengrund (strain CVM19633) GN=cysI PE=3 SV=1 814 1371 2.0E-168
sp|B4TFY4|CYSI_SALHS Sulfite reductase [NADPH] hemoprotein beta-component OS=Salmonella heidelberg (strain SL476) GN=cysI PE=3 SV=1 814 1371 2.0E-168
sp|C6CLS0|CYSI_DICZE Sulfite reductase [NADPH] hemoprotein beta-component OS=Dickeya zeae (strain Ech1591) GN=cysI PE=3 SV=1 814 1373 2.0E-168
sp|A0KNL0|CYSI_AERHH Sulfite reductase [NADPH] hemoprotein beta-component OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240) GN=cysI PE=3 SV=1 805 1372 2.0E-168
sp|A7MSZ7|CYSI_VIBCB Sulfite reductase [NADPH] hemoprotein beta-component OS=Vibrio campbellii (strain ATCC BAA-1116 / BB120) GN=cysI PE=3 SV=1 809 1372 3.0E-168
sp|Q8PHC8|CYSI_XANAC Sulfite reductase [NADPH] hemoprotein beta-component OS=Xanthomonas axonopodis pv. citri (strain 306) GN=cysI PE=3 SV=1 814 1362 3.0E-168
sp|Q6LM59|CYSI_PHOPR Sulfite reductase [NADPH] hemoprotein beta-component OS=Photobacterium profundum GN=cysI PE=3 SV=1 813 1372 3.0E-168
sp|B5QW35|CYSI_SALEP Sulfite reductase [NADPH] hemoprotein beta-component OS=Salmonella enteritidis PT4 (strain P125109) GN=cysI PE=3 SV=1 814 1371 4.0E-168
sp|Q66ED3|CYSI_YERPS Sulfite reductase [NADPH] hemoprotein beta-component OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=cysI PE=3 SV=1 814 1373 5.0E-168
sp|B2K566|CYSI_YERPB Sulfite reductase [NADPH] hemoprotein beta-component OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=cysI PE=3 SV=1 814 1373 5.0E-168
sp|B1JK04|CYSI_YERPY Sulfite reductase [NADPH] hemoprotein beta-component OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=cysI PE=3 SV=1 814 1373 6.0E-168
sp|A7FLY9|CYSI_YERP3 Sulfite reductase [NADPH] hemoprotein beta-component OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=cysI PE=3 SV=1 814 1373 6.0E-168
sp|C6DDH3|CYSI2_PECCP Sulfite reductase [NADPH] hemoprotein beta-component 2 OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=cysI2 PE=3 SV=1 814 1373 6.0E-168
sp|B5XV25|CYSI1_KLEP3 Sulfite reductase [NADPH] hemoprotein beta-component 1 OS=Klebsiella pneumoniae (strain 342) GN=cysI1 PE=3 SV=1 814 1371 9.0E-168
sp|Q8Z459|CYSI_SALTI Sulfite reductase [NADPH] hemoprotein beta-component OS=Salmonella typhi GN=cysI PE=3 SV=3 814 1371 1.0E-167
sp|B5FTU2|CYSI_SALDC Sulfite reductase [NADPH] hemoprotein beta-component OS=Salmonella dublin (strain CT_02021853) GN=cysI PE=3 SV=1 814 1371 1.0E-167
sp|P17845|CYSI_SALTY Sulfite reductase [NADPH] hemoprotein beta-component OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=cysI PE=3 SV=3 814 1371 1.0E-167
sp|A4TPY6|CYSI_YERPP Sulfite reductase [NADPH] hemoprotein beta-component OS=Yersinia pestis (strain Pestoides F) GN=cysI PE=3 SV=1 814 1373 2.0E-167
sp|Q1CLS7|CYSI_YERPN Sulfite reductase [NADPH] hemoprotein beta-component OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=cysI PE=3 SV=1 814 1373 2.0E-167
sp|Q8ZBN7|CYSI_YERPE Sulfite reductase [NADPH] hemoprotein beta-component OS=Yersinia pestis GN=cysI PE=3 SV=1 814 1373 2.0E-167
sp|Q1C3Z1|CYSI_YERPA Sulfite reductase [NADPH] hemoprotein beta-component OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=cysI PE=3 SV=1 814 1373 2.0E-167
sp|Q8KQT8|CYSI_XANOR Sulfite reductase [NADPH] hemoprotein beta-component OS=Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85) GN=cysI PE=1 SV=2 814 1362 2.0E-167
sp|B2SI05|CYSI_XANOP Sulfite reductase [NADPH] hemoprotein beta-component OS=Xanthomonas oryzae pv. oryzae (strain PXO99A) GN=cysI PE=3 SV=1 814 1362 2.0E-167
sp|Q2P0H2|CYSI_XANOM Sulfite reductase [NADPH] hemoprotein beta-component OS=Xanthomonas oryzae pv. oryzae (strain MAFF 311018) GN=cysI PE=3 SV=2 814 1362 2.0E-167
sp|A6TD48|CYSI_KLEP7 Sulfite reductase [NADPH] hemoprotein beta-component OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=cysI PE=3 SV=1 814 1371 2.0E-167
sp|Q8DCK1|CYSI_VIBVU Sulfite reductase [NADPH] hemoprotein beta-component OS=Vibrio vulnificus (strain CMCP6) GN=cysI PE=3 SV=1 813 1372 2.0E-167
sp|A5F3I5|CYSI_VIBC3 Sulfite reductase [NADPH] hemoprotein beta-component OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) GN=cysI PE=3 SV=1 813 1372 3.0E-167
sp|B5RDS0|CYSI_SALG2 Sulfite reductase [NADPH] hemoprotein beta-component OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=cysI PE=3 SV=1 814 1371 4.0E-167
sp|B5F430|CYSI_SALA4 Sulfite reductase [NADPH] hemoprotein beta-component OS=Salmonella agona (strain SL483) GN=cysI PE=3 SV=1 814 1371 7.0E-167
sp|Q5E840|CYSI_VIBF1 Sulfite reductase [NADPH] hemoprotein beta-component OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=cysI PE=3 SV=1 809 1372 2.0E-166
sp|Q15NK1|CYSI_PSEA6 Sulfite reductase [NADPH] hemoprotein beta-component OS=Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087) GN=cysI PE=3 SV=1 813 1372 3.0E-166
sp|A8ANX0|CYSI_CITK8 Sulfite reductase [NADPH] hemoprotein beta-component OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=cysI PE=3 SV=1 814 1371 3.0E-166
sp|Q6D1A2|CYSI_PECAS Sulfite reductase [NADPH] hemoprotein beta-component OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=cysI PE=3 SV=1 814 1373 1.0E-165
sp|A7MJ64|CYSI_CROS8 Sulfite reductase [NADPH] hemoprotein beta-component OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=cysI PE=3 SV=1 814 1371 1.0E-165
sp|A9MF17|CYSI_SALAR Sulfite reductase [NADPH] hemoprotein beta-component OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=cysI PE=3 SV=1 814 1371 2.0E-165
sp|Q3BPY4|CYSI_XANC5 Sulfite reductase [NADPH] hemoprotein beta-component OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=cysI PE=3 SV=2 814 1362 2.0E-165
sp|B1LQ86|CYSI_ECOSM Sulfite reductase [NADPH] hemoprotein beta-component OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=cysI PE=3 SV=1 814 1373 4.0E-165
sp|B6ELM5|CYSI_ALISL Sulfite reductase [NADPH] hemoprotein beta-component OS=Aliivibrio salmonicida (strain LFI1238) GN=cysI PE=3 SV=1 809 1372 4.0E-165
sp|B7NTA0|CYSI_ECO7I Sulfite reductase [NADPH] hemoprotein beta-component OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=cysI PE=3 SV=1 814 1373 4.0E-165
sp|B5BEZ8|CYSI_SALPK Sulfite reductase [NADPH] hemoprotein beta-component OS=Salmonella paratyphi A (strain AKU_12601) GN=cysI PE=3 SV=1 814 1371 6.0E-165
sp|Q5PEH8|CYSI_SALPA Sulfite reductase [NADPH] hemoprotein beta-component OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=cysI PE=3 SV=3 814 1371 6.0E-165
sp|B5FGI9|CYSI_VIBFM Sulfite reductase [NADPH] hemoprotein beta-component OS=Vibrio fischeri (strain MJ11) GN=cysI PE=3 SV=1 809 1372 7.0E-165
sp|C6UCN7|CYSI_ECOBR Sulfite reductase [NADPH] hemoprotein beta-component OS=Escherichia coli (strain B / REL606) GN=cysI PE=3 SV=1 814 1373 9.0E-165
sp|C5W865|CYSI_ECOBD Sulfite reductase [NADPH] hemoprotein beta-component OS=Escherichia coli (strain B / BL21-DE3) GN=cysI PE=3 SV=1 814 1373 9.0E-165
sp|Q9JS33|CYSI_NEIMB Sulfite reductase [NADPH] hemoprotein beta-component OS=Neisseria meningitidis serogroup B (strain MC58) GN=cysI1 PE=3 SV=1 800 1363 1.0E-164
sp|Q0T1I7|CYSI_SHIF8 Sulfite reductase [NADPH] hemoprotein beta-component OS=Shigella flexneri serotype 5b (strain 8401) GN=cysI PE=3 SV=1 814 1373 1.0E-164
sp|Q8FEI8|CYSI_ECOL6 Sulfite reductase [NADPH] hemoprotein beta-component OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=cysI PE=3 SV=3 814 1373 1.0E-164
sp|A8A3P4|CYSI_ECOHS Sulfite reductase [NADPH] hemoprotein beta-component OS=Escherichia coli O9:H4 (strain HS) GN=cysI PE=3 SV=1 814 1373 1.0E-164
sp|B2TZH1|CYSI_SHIB3 Sulfite reductase [NADPH] hemoprotein beta-component OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=cysI PE=3 SV=1 814 1373 1.0E-164
sp|B6I6F7|CYSI_ECOSE Sulfite reductase [NADPH] hemoprotein beta-component OS=Escherichia coli (strain SE11) GN=cysI PE=3 SV=1 814 1373 1.0E-164
sp|B7N6Z7|CYSI_ECOLU Sulfite reductase [NADPH] hemoprotein beta-component OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=cysI PE=3 SV=1 814 1373 1.0E-164
sp|B7LXH6|CYSI_ECO8A Sulfite reductase [NADPH] hemoprotein beta-component OS=Escherichia coli O8 (strain IAI1) GN=cysI PE=3 SV=1 814 1373 1.0E-164
sp|B5Z3C6|CYSI_ECO5E Sulfite reductase [NADPH] hemoprotein beta-component OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=cysI PE=3 SV=1 814 1373 1.0E-164
sp|Q8X7U2|CYSI_ECO57 Sulfite reductase [NADPH] hemoprotein beta-component OS=Escherichia coli O157:H7 GN=cysI PE=3 SV=3 814 1373 1.0E-164
sp|B7LEI2|CYSI_ECO55 Sulfite reductase [NADPH] hemoprotein beta-component OS=Escherichia coli (strain 55989 / EAEC) GN=cysI PE=3 SV=1 814 1373 1.0E-164
sp|A7ZQK6|CYSI_ECO24 Sulfite reductase [NADPH] hemoprotein beta-component OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=cysI PE=3 SV=1 814 1373 1.0E-164
sp|Q3YY95|CYSI_SHISS Sulfite reductase [NADPH] hemoprotein beta-component OS=Shigella sonnei (strain Ss046) GN=cysI PE=3 SV=1 814 1373 1.0E-164
sp|Q32CG4|CYSI_SHIDS Sulfite reductase [NADPH] hemoprotein beta-component OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=cysI PE=3 SV=1 814 1373 2.0E-164
sp|Q31XM5|CYSI_SHIBS Sulfite reductase [NADPH] hemoprotein beta-component OS=Shigella boydii serotype 4 (strain Sb227) GN=cysI PE=3 SV=1 814 1373 2.0E-164
sp|Q83QE0|CYSI_SHIFL Sulfite reductase [NADPH] hemoprotein beta-component OS=Shigella flexneri GN=cysI PE=3 SV=3 814 1373 3.0E-164
sp|P52673|CYSI_THIRO Sulfite reductase [NADPH] hemoprotein beta-component OS=Thiocapsa roseopersicina GN=cysI PE=3 SV=1 809 1373 3.0E-164
sp|B3GZ95|CYSI_ACTP7 Sulfite reductase [NADPH] hemoprotein beta-component OS=Actinobacillus pleuropneumoniae serotype 7 (strain AP76) GN=cysI PE=3 SV=1 800 1362 3.0E-164
sp|B7LWN9|CYSI_ESCF3 Sulfite reductase [NADPH] hemoprotein beta-component OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=cysI PE=3 SV=1 814 1373 4.0E-164
sp|A4WDW0|CYSI_ENT38 Sulfite reductase [NADPH] hemoprotein beta-component OS=Enterobacter sp. (strain 638) GN=cysI PE=3 SV=1 814 1371 4.0E-164
sp|B7UHH5|CYSI_ECO27 Sulfite reductase [NADPH] hemoprotein beta-component OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=cysI PE=3 SV=1 814 1373 5.0E-164
sp|A9LZ72|CYSI_NEIM0 Sulfite reductase [NADPH] hemoprotein beta-component OS=Neisseria meningitidis serogroup C (strain 053442) GN=cysI PE=3 SV=1 800 1363 5.0E-164
sp|Q1R7T5|CYSI_ECOUT Sulfite reductase [NADPH] hemoprotein beta-component OS=Escherichia coli (strain UTI89 / UPEC) GN=cysI PE=3 SV=1 814 1373 7.0E-164
sp|Q0TEA3|CYSI_ECOL5 Sulfite reductase [NADPH] hemoprotein beta-component OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=cysI PE=3 SV=1 814 1373 7.0E-164
sp|A1AEU9|CYSI_ECOK1 Sulfite reductase [NADPH] hemoprotein beta-component OS=Escherichia coli O1:K1 / APEC GN=cysI PE=3 SV=1 814 1373 7.0E-164
sp|B7MYR1|CYSI_ECO81 Sulfite reductase [NADPH] hemoprotein beta-component OS=Escherichia coli O81 (strain ED1a) GN=cysI PE=3 SV=1 814 1373 7.0E-164
sp|B7MKN0|CYSI_ECO45 Sulfite reductase [NADPH] hemoprotein beta-component OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=cysI PE=3 SV=1 814 1373 7.0E-164
sp|Q8VSR0|CYSI_ACTPL Sulfite reductase [NADPH] hemoprotein beta-component OS=Actinobacillus pleuropneumoniae GN=cysI PE=3 SV=1 800 1362 9.0E-164
sp|Q9JUD9|CYSI_NEIMA Sulfite reductase [NADPH] hemoprotein beta-component OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=cysI PE=3 SV=1 800 1363 9.0E-164
sp|B0BT17|CYSI_ACTPJ Sulfite reductase [NADPH] hemoprotein beta-component OS=Actinobacillus pleuropneumoniae serotype 3 (strain JL03) GN=cysI PE=3 SV=1 800 1362 9.0E-164
sp|B1IU78|CYSI_ECOLC Sulfite reductase [NADPH] hemoprotein beta-component OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=cysI PE=3 SV=1 814 1373 9.0E-164
sp|P17846|CYSI_ECOLI Sulfite reductase [NADPH] hemoprotein beta-component OS=Escherichia coli (strain K12) GN=cysI PE=1 SV=4 814 1373 1.0E-163
sp|C4ZZR7|CYSI_ECOBW Sulfite reductase [NADPH] hemoprotein beta-component OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=cysI PE=3 SV=1 814 1373 1.0E-163
sp|A1KU05|CYSI_NEIMF Sulfite reductase [NADPH] hemoprotein beta-component OS=Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18) GN=cysI PE=3 SV=1 800 1373 1.0E-163
sp|Q3IFM1|CYSI_PSEHT Sulfite reductase [NADPH] hemoprotein beta-component OS=Pseudoalteromonas haloplanktis (strain TAC 125) GN=cysI PE=3 SV=1 813 1362 1.0E-163
sp|A3N3D8|CYSI_ACTP2 Sulfite reductase [NADPH] hemoprotein beta-component OS=Actinobacillus pleuropneumoniae serotype 5b (strain L20) GN=cysI PE=3 SV=1 800 1362 2.0E-163
sp|Q493N3|CYSI_BLOPB Sulfite reductase [NADPH] hemoprotein beta-component OS=Blochmannia pennsylvanicus (strain BPEN) GN=cysI PE=3 SV=1 813 1373 2.0E-163
sp|Q7N8L5|CYSI_PHOLL Sulfite reductase [NADPH] hemoprotein beta-component OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=cysI PE=3 SV=1 813 1373 4.0E-163
sp|B2VG06|CYSI_ERWT9 Sulfite reductase [NADPH] hemoprotein beta-component OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=cysI PE=3 SV=1 814 1371 4.0E-163
sp|Q65T54|CYSI_MANSM Sulfite reductase [NADPH] hemoprotein beta-component OS=Mannheimia succiniciproducens (strain MBEL55E) GN=cysI PE=3 SV=1 800 1363 1.0E-160
sp|B4F234|CYSI_PROMH Sulfite reductase [NADPH] hemoprotein beta-component OS=Proteus mirabilis (strain HI4320) GN=cysI PE=3 SV=1 813 1373 3.0E-157
sp|B0SNL6|CYSI_LEPBP Sulfite reductase [NADPH] hemoprotein beta-component OS=Leptospira biflexa serovar Patoc (strain Patoc 1 / ATCC 23582 / Paris) GN=cysI PE=3 SV=1 814 1363 2.0E-156
sp|B0SF75|CYSI_LEPBA Sulfite reductase [NADPH] hemoprotein beta-component OS=Leptospira biflexa serovar Patoc (strain Patoc 1 / Ames) GN=cysI PE=3 SV=1 814 1363 2.0E-156
sp|A6VPZ1|CYSI_ACTSZ Sulfite reductase [NADPH] hemoprotein beta-component OS=Actinobacillus succinogenes (strain ATCC 55618 / 130Z) GN=cysI PE=3 SV=1 813 1363 1.0E-154
sp|C6DCZ7|CYSI1_PECCP Sulfite reductase [NADPH] hemoprotein beta-component 1 OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=cysI1 PE=3 SV=1 813 1375 2.0E-152
sp|B5Y1B5|CYSI2_KLEP3 Sulfite reductase [NADPH] hemoprotein beta-component 2 OS=Klebsiella pneumoniae (strain 342) GN=cysI2 PE=3 SV=1 813 1363 5.0E-150
sp|P0C0B2|CYSI_BUCAP Putative sulfite reductase [NADPH] hemoprotein beta-component OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=cysI PE=5 SV=1 814 1363 2.0E-148
sp|P57502|CYSI_BUCAI Sulfite reductase [NADPH] hemoprotein beta-component OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=cysI PE=3 SV=1 814 1363 7.0E-148
sp|B8D9K5|CYSI_BUCA5 Sulfite reductase [NADPH] hemoprotein beta-component OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain 5A) GN=cysI PE=3 SV=1 814 1363 7.0E-148
sp|B8D7V7|CYSI_BUCAT Sulfite reductase [NADPH] hemoprotein beta-component OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain Tuc7) GN=cysI PE=3 SV=1 814 1363 9.0E-148
sp|P30008|SIR_SYNE7 Sulfite reductase [ferredoxin] OS=Synechococcus elongatus (strain PCC 7942) GN=sir PE=3 SV=2 814 1361 6.0E-130
sp|P72854|SIR_SYNY3 Sulfite reductase [ferredoxin] OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=sir PE=1 SV=1 805 1361 2.0E-128
sp|O82802|SIR1_TOBAC Sulfite reductase 1 [ferredoxin], chloroplastic OS=Nicotiana tabacum GN=SIR1 PE=1 SV=1 807 1380 3.0E-111
sp|Q75NZ0|SIR_PEA Sulfite reductase [ferredoxin], chloroplastic OS=Pisum sativum GN=SIR PE=1 SV=2 814 1361 2.0E-108
sp|O23813|SIR_MAIZE Sulfite reductase [ferredoxin], chloroplastic OS=Zea mays GN=SIR PE=1 SV=1 814 1361 2.0E-105
sp|Q9LZ66|SIR_ARATH Assimilatory sulfite reductase (ferredoxin), chloroplastic OS=Arabidopsis thaliana GN=SIR PE=1 SV=1 814 1361 2.0E-104
sp|Q9AWB2|SIR_SOYBN Sulfite reductase [ferredoxin], chloroplastic (Fragment) OS=Glycine max GN=SIR PE=1 SV=1 814 1311 1.0E-99
sp|Q94IN5|PNO_EUGGR Pyruvate dehydrogenase [NADP(+)], mitochondrial OS=Euglena gracilis GN=PNO PE=1 SV=1 317 796 6.0E-68
sp|Q968X7|PNO_CRYPV Pyruvate dehydrogenase [NADP(+)] OS=Cryptosporidium parvum GN=PFOR PE=2 SV=1 317 796 2.0E-64
sp|P03833|NIFJ_KLEPN Pyruvate-flavodoxin oxidoreductase OS=Klebsiella pneumoniae GN=nifJ PE=3 SV=2 317 638 8.0E-42
sp|P19543|NIFJ_ENTAG Pyruvate-flavodoxin oxidoreductase OS=Enterobacter agglomerans GN=nifJ PE=3 SV=3 317 623 3.0E-39
sp|P52965|NIFJ_SYNY3 Putative pyruvate-flavodoxin oxidoreductase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=nifJ PE=3 SV=1 317 623 9.0E-38
sp|P94692|POR_DESAF Pyruvate synthase OS=Desulfovibrio africanus GN=por PE=1 SV=1 317 639 2.0E-37
sp|Q06879|NIFJ_NOSS1 Pyruvate-flavodoxin oxidoreductase OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=nifJ PE=2 SV=2 317 623 3.0E-34
sp|Q3M8N0|NIFJ_ANAVT Pyruvate-flavodoxin oxidoreductase OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937) GN=nifJ PE=3 SV=1 317 638 5.0E-34
sp|P52647|NIFJ_ECOLI Probable pyruvate-flavodoxin oxidoreductase OS=Escherichia coli (strain K12) GN=ydbK PE=3 SV=2 317 623 6.0E-32
sp|Q53046|NIFJ_RHORT Pyruvate-flavodoxin oxidoreductase OS=Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1) GN=nifJ PE=3 SV=2 317 623 2.0E-29
sp|P9WJ03|SIR_MYCTU Sulfite reductase [ferredoxin] OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=sir PE=1 SV=1 842 1359 1.0E-28
sp|P9WJ02|SIR_MYCTO Sulfite reductase [ferredoxin] OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=sir PE=3 SV=1 842 1359 1.0E-28
sp|Q7TYP6|SIR_MYCBO Sulfite reductase [ferredoxin] OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=sir PE=3 SV=2 842 1359 1.0E-28
sp|Q73YC1|SIR1_MYCPA Sulfite reductase [ferredoxin] 1 OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=sir1 PE=3 SV=1 842 1359 1.0E-28
sp|Q42997|NIR_ORYSJ Ferredoxin--nitrite reductase, chloroplastic OS=Oryza sativa subsp. japonica GN=Os01g0357100 PE=2 SV=1 875 1353 9.0E-26
sp|Q51879|NIR_PHOLA Ferredoxin--nitrite reductase OS=Phormidium laminosum GN=nirA PE=3 SV=1 875 1346 3.0E-25
sp|P17847|NIR_MAIZE Ferredoxin--nitrite reductase, chloroplastic (Fragment) OS=Zea mays GN=NIR PE=2 SV=1 813 1353 7.0E-25
sp|Q73XV0|SIR2_MYCPA Sulfite reductase [ferredoxin] 2 OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=sir2 PE=3 SV=1 869 1359 8.0E-25
sp|P39661|NIR_SYNE7 Ferredoxin--nitrite reductase OS=Synechococcus elongatus (strain PCC 7942) GN=nirA PE=3 SV=1 875 1345 7.0E-23
sp|Q6NPS8|NDOR1_ARATH NADPH-dependent diflavin oxidoreductase 1 OS=Arabidopsis thaliana GN=ATR3 PE=1 SV=1 644 796 6.0E-21
sp|P05314|NIR_SPIOL Ferredoxin--nitrite reductase, chloroplastic OS=Spinacia oleracea GN=NIR PE=1 SV=1 814 1339 4.0E-20
sp|P38500|NIR_BETPN Ferredoxin--nitrite reductase, chloroplastic OS=Betula pendula GN=NIR1 PE=2 SV=1 875 1342 7.0E-19
sp|Q39161|NIR_ARATH Ferredoxin--nitrite reductase, chloroplastic OS=Arabidopsis thaliana GN=NIR1 PE=1 SV=1 813 1339 8.0E-18
sp|Q1JPJ0|NDOR1_BOVIN NADPH-dependent diflavin oxidoreductase 1 OS=Bos taurus GN=NDOR1 PE=2 SV=2 642 833 1.0E-17
sp|Q9KUX4|CYSJ_VIBCH Sulfite reductase [NADPH] flavoprotein alpha-component OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=cysJ PE=3 SV=1 644 796 1.0E-17
sp|A5F3I4|CYSJ_VIBC3 Sulfite reductase [NADPH] flavoprotein alpha-component OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) GN=cysJ PE=3 SV=1 644 796 2.0E-17
sp|O94613|NDOR1_SCHPO NADPH-dependent diflavin oxidoreductase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tah18 PE=3 SV=2 644 909 2.0E-17
sp|P0CP12|NDOR1_CRYNJ NADPH-dependent diflavin oxidoreductase 1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=TAH18 PE=3 SV=1 646 788 5.0E-16
sp|P0CP13|NDOR1_CRYNB NADPH-dependent diflavin oxidoreductase 1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=TAH18 PE=3 SV=1 646 788 5.0E-16
sp|Q6BR77|NDOR1_DEBHA NADPH-dependent diflavin oxidoreductase 1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=TAH18 PE=3 SV=2 644 805 8.0E-16
sp|Q9UHB4|NDOR1_HUMAN NADPH-dependent diflavin oxidoreductase 1 OS=Homo sapiens GN=NDOR1 PE=1 SV=1 644 842 4.0E-15
sp|Q6CCH0|NDOR1_YARLI NADPH-dependent diflavin oxidoreductase 1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=TAH18 PE=3 SV=1 638 862 2.0E-14
sp|Q968X7|PNO_CRYPV Pyruvate dehydrogenase [NADP(+)] OS=Cryptosporidium parvum GN=PFOR PE=2 SV=1 153 301 3.0E-14
sp|Q4HZQ1|NDOR1_GIBZE NADPH-dependent diflavin oxidoreductase 1 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=TAH18 PE=3 SV=2 646 793 3.0E-14
sp|P16435|NCPR_HUMAN NADPH--cytochrome P450 reductase OS=Homo sapiens GN=POR PE=1 SV=2 641 796 5.0E-14
sp|Q6PFP6|NDOR1_DANRE NADPH-dependent diflavin oxidoreductase 1 OS=Danio rerio GN=ndor1 PE=2 SV=1 641 823 8.0E-14
sp|Q3M8N0|NIFJ_ANAVT Pyruvate-flavodoxin oxidoreductase OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937) GN=nifJ PE=3 SV=1 157 301 9.0E-14
sp|Q9APC2|NIFJ_NOSSO Pyruvate-flavodoxin oxidoreductase (Fragment) OS=Nostoc sp. (strain ATCC 29151 / PCC 7119) GN=nifJ PE=3 SV=1 157 301 1.0E-13
sp|P52965|NIFJ_SYNY3 Putative pyruvate-flavodoxin oxidoreductase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=nifJ PE=3 SV=1 147 301 2.0E-13
sp|P52647|NIFJ_ECOLI Probable pyruvate-flavodoxin oxidoreductase OS=Escherichia coli (strain K12) GN=ydbK PE=3 SV=2 118 328 2.0E-13
sp|P52674|CYSJ_THIRO Sulfite reductase [NADPH] flavoprotein alpha-component OS=Thiocapsa roseopersicina GN=cysJ PE=3 SV=1 644 770 2.0E-13
sp|P37039|NCPR_CAVPO NADPH--cytochrome P450 reductase OS=Cavia porcellus GN=Por PE=2 SV=2 641 796 2.0E-13
sp|Q65T53|CYSJ_MANSM Sulfite reductase [NADPH] flavoprotein alpha-component OS=Mannheimia succiniciproducens (strain MBEL55E) GN=cysJ PE=3 SV=1 644 768 5.0E-13
sp|P00388|NCPR_RAT NADPH--cytochrome P450 reductase OS=Rattus norvegicus GN=Por PE=1 SV=3 641 796 5.0E-13
sp|P37040|NCPR_MOUSE NADPH--cytochrome P450 reductase OS=Mus musculus GN=Por PE=1 SV=2 641 796 5.0E-13
sp|P37201|NCPR_CANTR NADPH--cytochrome P450 reductase OS=Candida tropicalis GN=NCP1 PE=3 SV=1 646 799 6.0E-13
sp|Q87L90|CYSJ_VIBPA Sulfite reductase [NADPH] flavoprotein alpha-component OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=cysJ PE=3 SV=1 644 769 8.0E-13
sp|Q7MHA5|CYSJ_VIBVY Sulfite reductase [NADPH] flavoprotein alpha-component OS=Vibrio vulnificus (strain YJ016) GN=cysJ PE=3 SV=2 644 769 8.0E-13
sp|Q27597|NCPR_DROME NADPH--cytochrome P450 reductase OS=Drosophila melanogaster GN=Cpr PE=2 SV=2 641 796 8.0E-13
sp|Q8DCK2|CYSJ_VIBVU Sulfite reductase [NADPH] flavoprotein alpha-component OS=Vibrio vulnificus (strain CMCP6) GN=cysJ PE=3 SV=1 644 769 8.0E-13
sp|P04175|NCPR_PIG NADPH--cytochrome P450 reductase OS=Sus scrofa GN=POR PE=1 SV=2 641 796 1.0E-12
sp|P00389|NCPR_RABIT NADPH--cytochrome P450 reductase OS=Oryctolagus cuniculus GN=POR PE=1 SV=1 641 796 1.0E-12
sp|Q94IN5|PNO_EUGGR Pyruvate dehydrogenase [NADP(+)], mitochondrial OS=Euglena gracilis GN=PNO PE=1 SV=1 140 301 2.0E-12
sp|Q5AD27|NDOR1_CANAL NADPH-dependent diflavin oxidoreductase 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=TAH18 PE=3 SV=1 644 796 2.0E-12
sp|A2AI05|NDOR1_MOUSE NADPH-dependent diflavin oxidoreductase 1 OS=Mus musculus GN=Ndor1 PE=2 SV=1 644 798 2.0E-12
sp|P50126|NCPR_CANMA NADPH--cytochrome P450 reductase OS=Candida maltosa GN=NCP1 PE=2 SV=1 646 799 2.0E-12
sp|Q6NRG5|NDOR1_XENLA NADPH-dependent diflavin oxidoreductase 1 OS=Xenopus laevis GN=ndor1 PE=2 SV=1 644 822 3.0E-12
sp|Q06879|NIFJ_NOSS1 Pyruvate-flavodoxin oxidoreductase OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=nifJ PE=2 SV=2 157 301 5.0E-12
sp|Q07994|NCPR_MUSDO NADPH--cytochrome P450 reductase OS=Musca domestica PE=2 SV=1 641 796 6.0E-12
sp|Q4P3D8|NDOR1_USTMA NADPH-dependent diflavin oxidoreductase 1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=TAH18 PE=3 SV=2 641 824 6.0E-12
sp|Q3SYT8|NCPR_BOVIN NADPH--cytochrome P450 reductase OS=Bos taurus GN=POR PE=2 SV=3 641 796 6.0E-12
sp|Q8K9D3|CYSJ_BUCAP Sulfite reductase [NADPH] flavoprotein alpha-component OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=cysJ PE=3 SV=1 644 802 7.0E-12
sp|Q0CMM0|NCPR_ASPTN NADPH--cytochrome P450 reductase OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=cprA PE=3 SV=1 627 843 8.0E-12
sp|Q6LM58|CYSJ_PHOPR Sulfite reductase [NADPH] flavoprotein alpha-component OS=Photobacterium profundum GN=cysJ PE=3 SV=1 644 769 1.0E-11
sp|Q54JL0|NDOR1_DICDI NADPH-dependent diflavin oxidoreductase 1 OS=Dictyostelium discoideum GN=redC PE=2 SV=1 640 796 1.0E-11
sp|Q53046|NIFJ_RHORT Pyruvate-flavodoxin oxidoreductase OS=Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1) GN=nifJ PE=3 SV=2 157 301 2.0E-11
sp|O32214|CYSJ_BACSU Sulfite reductase [NADPH] flavoprotein alpha-component OS=Bacillus subtilis (strain 168) GN=cysJ PE=1 SV=1 644 767 2.0E-11
sp|P19618|NCPR_SALTR NADPH--cytochrome P450 reductase (Fragments) OS=Salmo trutta GN=por PE=1 SV=1 641 796 2.0E-11
sp|O08336|CYPB_BACSU Bifunctional cytochrome P450/NADPH--P450 reductase 2 OS=Bacillus subtilis (strain 168) GN=cypB PE=1 SV=1 641 794 4.0E-11
sp|Q1LTP1|CYSJ_BAUCH Sulfite reductase [NADPH] flavoprotein alpha-component OS=Baumannia cicadellinicola subsp. Homalodisca coagulata GN=cysJ PE=3 SV=1 644 821 8.0E-11
sp|Q4WM67|NCPR_ASPFU NADPH--cytochrome P450 reductase OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=cprA PE=1 SV=1 627 796 1.0E-10
sp|I3R637|NASD_HALMT Assimilatory ferredoxin-dependent nitrite reductase OS=Haloferax mediterranei (strain ATCC 33500 / DSM 1411 / JCM 8866 / NBRC 14739 / NCIMB 2177 / R-4) GN=nasD PE=1 SV=1 875 1352 1.0E-10
sp|Q2NVN4|CYSJ_SODGM Sulfite reductase [NADPH] flavoprotein alpha-component OS=Sodalis glossinidius (strain morsitans) GN=cysJ PE=3 SV=1 644 796 2.0E-10
sp|Q5BFT5|NCPR_EMENI NADPH--cytochrome P450 reductase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=cprA PE=3 SV=1 627 796 3.0E-10
sp|Q4WU59|NDOR1_ASPFU NADPH-dependent diflavin oxidoreductase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=tah18 PE=3 SV=1 646 861 3.0E-10
sp|P57503|CYSJ_BUCAI Sulfite reductase [NADPH] flavoprotein alpha-component OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=cysJ PE=3 SV=1 644 797 3.0E-10
sp|Q54B10|REDA_DICDI NADPH oxidoreductase A OS=Dictyostelium discoideum GN=redA PE=2 SV=1 610 767 4.0E-10
sp|Q5NRM1|CYSJ_ZYMMO Sulfite reductase [NADPH] flavoprotein alpha-component OS=Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4) GN=cysJ PE=3 SV=1 644 796 6.0E-10
sp|Q32CG3|CYSJ_SHIDS Sulfite reductase [NADPH] flavoprotein alpha-component OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=cysJ PE=3 SV=1 644 796 7.0E-10
sp|Q00141|NCPR_ASPNG NADPH--cytochrome P450 reductase OS=Aspergillus niger GN=cprA PE=1 SV=2 627 843 7.0E-10
sp|Q5PEH7|CYSJ_SALPA Sulfite reductase [NADPH] flavoprotein alpha-component OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=cysJ PE=3 SV=3 644 796 2.0E-09
sp|A8A3P5|CYSJ_ECOHS Sulfite reductase [NADPH] flavoprotein alpha-component OS=Escherichia coli O9:H4 (strain HS) GN=cysJ PE=3 SV=1 644 796 2.0E-09
sp|A1KU06|CYSJ_NEIMF Sulfite reductase [NADPH] flavoprotein alpha-component OS=Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18) GN=cysJ PE=3 SV=1 644 769 2.0E-09
sp|Q83QD9|CYSJ_SHIFL Sulfite reductase [NADPH] flavoprotein alpha-component OS=Shigella flexneri GN=cysJ PE=3 SV=3 644 796 2.0E-09
sp|Q0T1I8|CYSJ_SHIF8 Sulfite reductase [NADPH] flavoprotein alpha-component OS=Shigella flexneri serotype 5b (strain 8401) GN=cysJ PE=3 SV=1 644 796 2.0E-09
sp|Q8FEI7|CYSJ_ECOL6 Sulfite reductase [NADPH] flavoprotein alpha-component OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=cysJ PE=3 SV=3 644 796 2.0E-09
sp|Q3YY94|CYSJ_SHISS Sulfite reductase [NADPH] flavoprotein alpha-component OS=Shigella sonnei (strain Ss046) GN=cysJ PE=3 SV=1 644 796 2.0E-09
sp|Q1R7T4|CYSJ_ECOUT Sulfite reductase [NADPH] flavoprotein alpha-component OS=Escherichia coli (strain UTI89 / UPEC) GN=cysJ PE=3 SV=1 644 796 2.0E-09
sp|Q0TEA2|CYSJ_ECOL5 Sulfite reductase [NADPH] flavoprotein alpha-component OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=cysJ PE=3 SV=1 644 796 2.0E-09
sp|A1AEV0|CYSJ_ECOK1 Sulfite reductase [NADPH] flavoprotein alpha-component OS=Escherichia coli O1:K1 / APEC GN=cysJ PE=3 SV=1 644 796 2.0E-09
sp|B1IU77|CYSJ_ECOLC Sulfite reductase [NADPH] flavoprotein alpha-component OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=cysJ PE=3 SV=1 644 796 2.0E-09
sp|A7ZQK7|CYSJ_ECO24 Sulfite reductase [NADPH] flavoprotein alpha-component OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=cysJ PE=3 SV=1 644 796 2.0E-09
sp|P38038|CYSJ_ECOLI Sulfite reductase [NADPH] flavoprotein alpha-component OS=Escherichia coli (strain K12) GN=cysJ PE=1 SV=4 644 796 2.0E-09
sp|A8ANX1|CYSJ_CITK8 Sulfite reductase [NADPH] flavoprotein alpha-component OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=cysJ PE=3 SV=1 644 792 2.0E-09
sp|Q9JS45|CYSJ_NEIMB Sulfite reductase [NADPH] flavoprotein alpha-component OS=Neisseria meningitidis serogroup B (strain MC58) GN=cysJ1 PE=3 SV=1 644 769 2.0E-09
sp|Q31XM4|CYSJ_SHIBS Sulfite reductase [NADPH] flavoprotein alpha-component OS=Shigella boydii serotype 4 (strain Sb227) GN=cysJ PE=3 SV=1 644 796 2.0E-09
sp|Q5E841|CYSJ_VIBF1 Sulfite reductase [NADPH] flavoprotein alpha-component OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=cysJ PE=3 SV=1 644 769 3.0E-09
sp|Q8EAZ9|CYSJ_SHEON Sulfite reductase [NADPH] flavoprotein alpha-component OS=Shewanella oneidensis (strain MR-1) GN=cysJ PE=3 SV=1 644 765 3.0E-09
sp|O08394|CYPD_BACSU Bifunctional cytochrome P450/NADPH--P450 reductase 1 OS=Bacillus subtilis (strain 168) GN=cypD PE=1 SV=1 624 793 3.0E-09
sp|A9LZ73|CYSJ_NEIM0 Sulfite reductase [NADPH] flavoprotein alpha-component OS=Neisseria meningitidis serogroup C (strain 053442) GN=cysJ PE=3 SV=1 644 769 4.0E-09
sp|Q9JUD8|CYSJ_NEIMA Sulfite reductase [NADPH] flavoprotein alpha-component OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=cysJ PE=3 SV=1 644 769 4.0E-09
sp|Q7VQH2|CYSJ_BLOFL Sulfite reductase [NADPH] flavoprotein alpha-component OS=Blochmannia floridanus GN=cysJ PE=3 SV=1 639 792 5.0E-09
sp|O54705|NOS2_CAVPO Nitric oxide synthase, inducible OS=Cavia porcellus GN=NOS2 PE=2 SV=1 645 795 5.0E-09
sp|P19543|NIFJ_ENTAG Pyruvate-flavodoxin oxidoreductase OS=Enterobacter agglomerans GN=nifJ PE=3 SV=3 145 323 6.0E-09
sp|Q9SUM3|NCPR2_ARATH NADPH--cytochrome P450 reductase 2 OS=Arabidopsis thaliana GN=ATR2 PE=1 SV=1 644 796 6.0E-09
sp|Q8X7U1|CYSJ_ECO57 Sulfite reductase [NADPH] flavoprotein alpha-component OS=Escherichia coli O157:H7 GN=cysJ PE=3 SV=3 644 796 8.0E-09
sp|A9N2E6|CYSJ_SALPB Sulfite reductase [NADPH] flavoprotein alpha-component OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=cysJ PE=3 SV=1 644 796 8.0E-09
sp|P38039|CYSJ_SALTY Sulfite reductase [NADPH] flavoprotein alpha-component OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=cysJ PE=3 SV=2 644 796 8.0E-09
sp|P94692|POR_DESAF Pyruvate synthase OS=Desulfovibrio africanus GN=por PE=1 SV=1 157 287 9.0E-09
sp|Q57KH7|CYSJ_SALCH Sulfite reductase [NADPH] flavoprotein alpha-component OS=Salmonella choleraesuis (strain SC-B67) GN=cysJ PE=3 SV=3 644 796 9.0E-09
sp|A6TD49|CYSJ_KLEP7 Sulfite reductase [NADPH] flavoprotein alpha-component OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=cysJ PE=3 SV=1 644 796 9.0E-09
sp|P29477|NOS2_MOUSE Nitric oxide synthase, inducible OS=Mus musculus GN=Nos2 PE=1 SV=1 645 795 9.0E-09
sp|P03833|NIFJ_KLEPN Pyruvate-flavodoxin oxidoreductase OS=Klebsiella pneumoniae GN=nifJ PE=3 SV=2 151 301 1.0E-08
sp|Q06518|NOS2_RAT Nitric oxide synthase, inducible OS=Rattus norvegicus GN=Nos2 PE=1 SV=2 645 795 1.0E-08
sp|Q8Z458|CYSJ_SALTI Sulfite reductase [NADPH] flavoprotein alpha-component OS=Salmonella typhi GN=cysJ PE=3 SV=3 644 788 2.0E-08
sp|Q5BB41|NDOR1_EMENI NADPH-dependent diflavin oxidoreductase 1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=tah18 PE=3 SV=3 646 788 3.0E-08
sp|A9MF16|CYSJ_SALAR Sulfite reductase [NADPH] flavoprotein alpha-component OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=cysJ PE=3 SV=1 638 796 3.0E-08
sp|Q90703|NOS2_CHICK Nitric oxide synthase, inducible OS=Gallus gallus GN=NOS2 PE=2 SV=1 635 788 4.0E-08
sp|Q9HDG2|NCPR_PHACH NADPH--cytochrome P450 reductase OS=Phanerochaete chrysosporium GN=CPR PE=2 SV=1 644 797 5.0E-08
sp|Q4JIJ2|MTRR_BOVIN Methionine synthase reductase OS=Bos taurus GN=MTRR PE=2 SV=1 646 796 5.0E-08
sp|P14779|CPXB_BACME Bifunctional cytochrome P450/NADPH--P450 reductase OS=Bacillus megaterium GN=cyp102A1 PE=1 SV=2 625 793 6.0E-08
sp|Q8RXN5|TYW1_ARATH S-adenosyl-L-methionine-dependent tRNA 4-demethylwyosine synthase OS=Arabidopsis thaliana GN=TYW1 PE=2 SV=1 646 788 6.0E-08
sp|P35228|NOS2_HUMAN Nitric oxide synthase, inducible OS=Homo sapiens GN=NOS2 PE=1 SV=2 644 795 8.0E-08
sp|Q9SB48|NCPR1_ARATH NADPH--cytochrome P450 reductase 1 OS=Arabidopsis thaliana GN=ATR1 PE=1 SV=1 628 796 9.0E-08
sp|O62699|NOS2_CANLF Nitric oxide synthase, inducible OS=Canis lupus familiaris GN=NOS2 PE=2 SV=2 644 795 1.0E-07
sp|Q92037|NOS2_CARAU Nitric oxide synthase, inducible (Fragment) OS=Carassius auratus GN=nos2 PE=2 SV=1 645 738 2.0E-07
sp|A1JJS2|CYSJ_YERE8 Sulfite reductase [NADPH] flavoprotein alpha-component OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=cysJ PE=3 SV=1 644 796 3.0E-07
sp|A7MJ63|CYSJ_CROS8 Sulfite reductase [NADPH] flavoprotein alpha-component OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=cysJ PE=3 SV=1 644 809 4.0E-07
sp|Q6D1A1|CYSJ_PECAS Sulfite reductase [NADPH] flavoprotein alpha-component OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=cysJ PE=3 SV=1 644 769 4.0E-07
sp|P16603|NCPR_YEAST NADPH--cytochrome P450 reductase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NCP1 PE=1 SV=3 646 796 5.0E-07
sp|P36587|NCPR_SCHPO NADPH--cytochrome P450 reductase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ccr1 PE=2 SV=1 631 775 5.0E-07
sp|Q7N8L6|CYSJ_PHOLL Sulfite reductase [NADPH] flavoprotein alpha-component OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=cysJ PE=3 SV=1 644 792 5.0E-07
sp|Q27995|NOS2_BOVIN Nitric oxide synthase, inducible OS=Bos taurus GN=NOS2 PE=2 SV=3 645 795 7.0E-07
sp|A4WDW1|CYSJ_ENT38 Sulfite reductase [NADPH] flavoprotein alpha-component OS=Enterobacter sp. (strain 638) GN=cysJ PE=3 SV=1 644 792 9.0E-07
sp|Q9UBK8|MTRR_HUMAN Methionine synthase reductase OS=Homo sapiens GN=MTRR PE=1 SV=3 646 816 1.0E-06
sp|Q55CT1|NCPR_DICDI NADPH--cytochrome P450 reductase OS=Dictyostelium discoideum GN=redB PE=2 SV=1 644 793 2.0E-06
sp|Q0HYB4|CYSJ_SHESR Sulfite reductase [NADPH] flavoprotein alpha-component OS=Shewanella sp. (strain MR-7) GN=cysJ PE=3 SV=1 644 765 2.0E-06
sp|Q0HFL6|CYSJ_SHESM Sulfite reductase [NADPH] flavoprotein alpha-component OS=Shewanella sp. (strain MR-4) GN=cysJ PE=3 SV=1 644 765 4.0E-06
sp|A0KTH4|CYSJ_SHESA Sulfite reductase [NADPH] flavoprotein alpha-component OS=Shewanella sp. (strain ANA-3) GN=cysJ PE=3 SV=1 644 770 4.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016491 oxidoreductase activity Yes
GO:0010181 FMN binding Yes
GO:0051536 iron-sulfur cluster binding Yes
GO:0020037 heme binding Yes
GO:1901265 nucleoside phosphate binding No
GO:0000166 nucleotide binding No
GO:0046906 tetrapyrrole binding No
GO:0003824 catalytic activity No
GO:0097159 organic cyclic compound binding No
GO:0097367 carbohydrate derivative binding No
GO:0005488 binding No
GO:1901363 heterocyclic compound binding No
GO:0043167 ion binding No
GO:0051540 metal cluster binding No
GO:0032553 ribonucleotide binding No
GO:0043168 anion binding No
GO:0003674 molecular_function No
GO:0036094 small molecule binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 16 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|8976
MAITAHALAVRTGKGVVHFFVSASSTGNEPIRLEDAAVVRAILDIESVRRFQSGGISASGIYADDGHVAVSSDHP
DTAPLNSGPGKNASLQHSVIADGPKATSTATSVKSSEASESSTPVAPSSVATTVEATPPQILSDDLYTCVTRIWA
QIRLALGRQYNAFEYTGPADAENCLFIFGSNTAMFLETVDRARPDDIFAKVGIVIPRLYRPWIGSKLVEALPRST
RRIAVLERINRATTRWGPLLIDILSSVSRGSGGGETIVGYQLGHLTPETVTQALRGVVQNLTVDKPVQNLEVGAP
DAPQPVADCELDSPQLETAYSKILDQLFGSHLYIANELASKHTGISPIVSASPEFGFGSLLARKEHRARFVGEVK
DASRSGSFASHDIKSWLARWAVNAESTEECNEVADQLIFRLENDGSEAAQALLSRRKLFHKESLWLMGSDAWAYD
LGNSGVHHVLASGENVNMLIIDSTPYSKRGVADSHRRKKDIGLYAMNFGNVYVASTAVYSSYTQVLQALLEAERF
PGPSVVLAYLPYFGETDSPLTVLQETKKAVDTGYWPLYRWNPENERKGEPSFSLDSELVKQELKAFLARDNHLTQ
LMKKEPSFSASLARDFGTEVRTRQKRKARDAYNQLLEGLLGAPLTILFASDNGNASAVAKRLGNRGRARGLKTVV
MAMEDYPVEDLPREENIVFITSTAGQGEFPQNGLPFWDAIKETTDMDLATVNFSVFGLGDSHYWPRKEDRIFYNK
PAKDLDRVLGNFGGRRFCEIGLGDDQDPDGYQTGYQTWEPKIWQALGVDKVDGLPEEPPPITNEDIKLASNYLRG
TIVEGLQDTTTGAISAHDQQLTKFHGTYMQDDRDVRDERKAQGLEPAYSFMIRCRLPGGVATPEQWVQMDDISNS
LGNETMKLTTRQTFQFHGVVKGKLKPAMQAINRALMTTIAACGDVNRNVMCSSLPTQARYHKQVQVCSQKISDHL
LPSTTAYHEIWLTNGDNEKKQLGGDVVQDFEPLYGPTYLPRKFKITIAIPPHNDTDVYAHDIGLIAIKGADGNLE
GFNVLAGGGMGATHNNKKTYPQTGRMLGFCSTENVHIVCEKIMLVQRDHGDRKNRKHARLKYTIDDMGLDVFRGK
VEELWGDRFGEERPFEFKSNIDTFGWQKDETGLNHFTFFIENGRIEDTPEFRMKTGLREIAKMRRGEFRLTGNQH
LILSNIRDEDVPTAKKMMKDYKLDNIQFSGLRLSSSACVAFPTCGLAMAESERYLPVLISKLEACLEENGLRQDS
IVMRMTGCPNGCARPWLAEVAFVGKAYGAYNMYLGGGYHGQRLNKLFRSSIKEDEILSIMKPLLKRYASERQAGE
RFGDFCIRAGFIRATGDGRDFHDGVAEEESGDE*
Coding >Hirsu2|8976
ATGGCCATTACAGCTCATGCCTTGGCTGTGCGCACCGGCAAGGGCGTGGTACACTTCTTCGTCTCCGCCTCGTCG
ACTGGCAACGAACCAATCCGGCTCGAGGACGCTGCTGTCGTGCGAGCAATTCTTGATATCGAGAGTGTGAGAAGA
TTCCAATCCGGCGGCATTTCAGCGTCTGGCATTTATGCCGATGATGGTCACGTGGCCGTCTCCTCAGACCACCCG
GACACGGCGCCGTTGAACAGCGGTCCGGGAAAGAATGCCAGCCTACAGCATTCTGTCATCGCCGACGGCCCCAAG
GCGACGTCTACAGCGACCTCAGTCAAGTCGAGCGAGGCTAGCGAGTCATCCACTCCCGTGGCCCCGTCATCTGTT
GCCACTACCGTCGAGGCCACCCCGCCCCAAATCCTGTCCGATGACCTCTACACCTGCGTGACCCGCATCTGGGCG
CAGATCAGACTGGCTCTCGGGAGGCAATACAATGCCTTCGAGTACACGGGGCCTGCCGATGCTGAGAACTGTCTC
TTCATCTTCGGGTCCAACACCGCCATGTTTCTGGAGACAGTGGATCGCGCTCGACCAGACGATATCTTCGCCAAA
GTCGGCATCGTCATCCCCCGCCTCTACCGGCCCTGGATCGGCTCTAAGCTCGTCGAAGCCCTACCTAGGTCAACA
AGGAGAATTGCAGTGCTGGAGCGAATTAACCGGGCAACGACGAGATGGGGGCCCCTTCTCATCGACATTCTATCC
TCCGTGAGCCGCGGGTCTGGTGGCGGCGAGACCATTGTTGGGTACCAGCTTGGGCACCTCACCCCTGAGACGGTC
ACCCAGGCGCTCCGTGGCGTGGTGCAGAATTTGACCGTCGACAAGCCGGTTCAGAACCTGGAAGTCGGGGCTCCG
GACGCTCCACAGCCTGTCGCCGACTGTGAATTGGATTCTCCGCAACTGGAGACTGCGTACTCGAAGATTCTAGAC
CAGCTCTTCGGATCCCACCTTTACATCGCCAACGAACTGGCTTCGAAGCACACGGGGATCTCACCAATAGTCTCG
GCGAGTCCGGAATTCGGTTTCGGGTCCCTGCTGGCCCGAAAAGAACATCGCGCTCGTTTCGTGGGCGAGGTAAAG
GATGCTTCCCGGAGTGGCTCGTTTGCGTCTCACGACATCAAGAGCTGGCTGGCTCGATGGGCAGTGAACGCTGAG
TCTACAGAGGAATGTAACGAAGTAGCGGATCAGCTCATCTTCCGCCTGGAAAACGACGGGTCAGAGGCAGCCCAG
GCCCTTCTTTCCAGGCGCAAGCTATTCCACAAGGAATCTCTGTGGCTTATGGGTTCCGATGCCTGGGCATACGAC
CTGGGAAATTCTGGCGTGCATCATGTTCTGGCATCGGGCGAGAACGTGAATATGCTTATCATTGACTCGACACCT
TACTCGAAACGAGGCGTCGCCGACTCACATCGCAGGAAGAAGGATATCGGCTTGTACGCAATGAATTTCGGAAAC
GTCTACGTGGCCTCGACCGCCGTATACAGCTCATACACCCAGGTCCTCCAGGCGCTGCTCGAAGCGGAACGGTTT
CCCGGGCCCTCGGTTGTCCTCGCCTATCTACCCTACTTTGGCGAGACGGACTCGCCTTTGACCGTTCTCCAAGAA
ACGAAAAAAGCTGTGGACACTGGCTACTGGCCCCTCTATCGATGGAACCCAGAGAATGAGCGGAAGGGAGAGCCC
AGCTTCTCGCTCGACTCGGAATTGGTCAAACAAGAGCTCAAAGCCTTCCTGGCGAGGGACAATCATCTGACCCAG
TTGATGAAGAAGGAGCCCTCATTCTCCGCCAGCCTAGCAAGGGACTTTGGAACGGAAGTCCGGACCCGACAGAAA
CGGAAGGCTAGGGACGCCTACAATCAGCTATTGGAAGGCCTCCTTGGAGCTCCTTTAACAATTTTGTTCGCCTCC
GACAATGGCAATGCTTCCGCAGTGGCTAAACGTCTGGGGAACAGGGGCAGGGCCCGTGGCTTGAAGACGGTGGTC
ATGGCCATGGAGGACTACCCGGTCGAGGATCTACCCAGGGAAGAGAACATTGTGTTCATCACGTCCACTGCTGGC
CAGGGAGAGTTTCCCCAAAACGGACTGCCCTTCTGGGATGCCATCAAAGAGACTACGGATATGGATTTGGCGACA
GTCAATTTCTCCGTCTTCGGCCTGGGCGATAGTCACTACTGGCCCCGGAAAGAAGACCGAATCTTCTACAACAAG
CCGGCCAAGGATCTTGACAGGGTGCTCGGAAATTTTGGAGGTAGGCGCTTCTGCGAAATTGGATTGGGCGATGAC
CAAGATCCCGATGGATATCAGACCGGCTATCAAACATGGGAGCCGAAGATATGGCAGGCTCTGGGGGTGGACAAG
GTTGACGGACTACCGGAAGAGCCGCCGCCAATAACGAATGAAGACATAAAGCTGGCGTCGAATTATCTTCGCGGG
ACGATTGTTGAGGGACTGCAAGACACGACTACCGGTGCCATATCGGCTCACGATCAGCAACTGACAAAGTTCCAT
GGCACGTACATGCAGGACGACCGCGACGTTCGCGACGAAAGAAAAGCTCAGGGGCTGGAGCCGGCCTACTCGTTC
ATGATTCGATGCAGGCTGCCCGGTGGTGTGGCGACGCCGGAGCAGTGGGTGCAGATGGACGATATAAGTAACTCG
CTGGGGAATGAAACGATGAAGCTCACTACGAGACAGACTTTCCAGTTCCATGGAGTCGTCAAAGGAAAGCTGAAG
CCTGCCATGCAGGCCATCAACCGGGCGCTCATGACGACCATCGCCGCGTGCGGAGACGTGAACCGCAACGTGATG
TGCAGCTCGCTGCCAACGCAAGCTCGCTACCACAAACAAGTCCAGGTCTGCTCGCAGAAAATAAGCGATCACCTG
CTTCCGTCCACAACTGCCTATCACGAAATCTGGCTCACCAACGGCGACAACGAGAAGAAGCAGTTGGGTGGCGAC
GTCGTCCAGGACTTCGAACCGCTCTACGGGCCGACGTACCTTCCCCGCAAGTTCAAAATCACAATAGCGATTCCC
CCACACAACGACACTGATGTATACGCGCACGACATCGGCTTGATTGCCATCAAGGGGGCGGATGGAAACCTGGAA
GGCTTCAACGTACTGGCTGGCGGCGGCATGGGCGCGACCCACAACAACAAAAAGACGTATCCCCAGACCGGTCGA
ATGCTCGGGTTCTGCTCAACAGAAAATGTCCACATCGTGTGCGAGAAGATCATGCTTGTGCAGCGCGACCACGGC
GACCGGAAGAACCGCAAGCACGCCCGCCTCAAGTACACCATCGACGACATGGGCCTGGACGTCTTCCGGGGCAAG
GTCGAGGAGCTGTGGGGTGACCGATTCGGCGAAGAGAGGCCGTTCGAGTTCAAGAGCAACATCGACACATTCGGC
TGGCAGAAGGACGAGACGGGCCTGAACCACTTCACCTTCTTCATCGAGAACGGGCGGATCGAAGACACGCCCGAG
TTCCGGATGAAGACGGGACTGCGCGAGATCGCCAAGATGCGGCGCGGCGAATTCCGCCTGACCGGCAACCAGCAT
CTGATCCTGAGCAACATCCGGGACGAGGACGTGCCGACGGCCAAGAAGATGATGAAGGACTATAAGCTCGACAAC
ATCCAGTTCTCGGGCCTGCGGCTGAGCTCATCTGCCTGCGTGGCCTTCCCCACCTGCGGGCTCGCCATGGCCGAG
TCGGAGCGGTACCTACCCGTGCTCATCTCCAAGCTCGAGGCGTGCCTGGAGGAGAATGGGCTCCGGCAGGACTCG
ATCGTCATGCGCATGACGGGCTGCCCCAACGGCTGCGCCCGGCCGTGGCTGGCGGAGGTGGCGTTCGTCGGGAAG
GCCTACGGCGCCTACAACATGTACCTAGGCGGCGGGTATCACGGTCAGCGGCTCAACAAGCTCTTCCGGTCGAGC
ATCAAGGAAGACGAGATCCTGTCCATCATGAAGCCCCTGCTCAAGAGGTACGCGTCGGAAAGACAGGCAGGCGAG
AGGTTCGGGGACTTTTGCATCCGCGCCGGCTTCATCCGAGCCACCGGAGACGGGCGAGACTTCCACGACGGGGTG
GCCGAAGAGGAATCTGGAGATGAGTAG
Transcript >Hirsu2|8976
ATGGCCATTACAGCTCATGCCTTGGCTGTGCGCACCGGCAAGGGCGTGGTACACTTCTTCGTCTCCGCCTCGTCG
ACTGGCAACGAACCAATCCGGCTCGAGGACGCTGCTGTCGTGCGAGCAATTCTTGATATCGAGAGTGTGAGAAGA
TTCCAATCCGGCGGCATTTCAGCGTCTGGCATTTATGCCGATGATGGTCACGTGGCCGTCTCCTCAGACCACCCG
GACACGGCGCCGTTGAACAGCGGTCCGGGAAAGAATGCCAGCCTACAGCATTCTGTCATCGCCGACGGCCCCAAG
GCGACGTCTACAGCGACCTCAGTCAAGTCGAGCGAGGCTAGCGAGTCATCCACTCCCGTGGCCCCGTCATCTGTT
GCCACTACCGTCGAGGCCACCCCGCCCCAAATCCTGTCCGATGACCTCTACACCTGCGTGACCCGCATCTGGGCG
CAGATCAGACTGGCTCTCGGGAGGCAATACAATGCCTTCGAGTACACGGGGCCTGCCGATGCTGAGAACTGTCTC
TTCATCTTCGGGTCCAACACCGCCATGTTTCTGGAGACAGTGGATCGCGCTCGACCAGACGATATCTTCGCCAAA
GTCGGCATCGTCATCCCCCGCCTCTACCGGCCCTGGATCGGCTCTAAGCTCGTCGAAGCCCTACCTAGGTCAACA
AGGAGAATTGCAGTGCTGGAGCGAATTAACCGGGCAACGACGAGATGGGGGCCCCTTCTCATCGACATTCTATCC
TCCGTGAGCCGCGGGTCTGGTGGCGGCGAGACCATTGTTGGGTACCAGCTTGGGCACCTCACCCCTGAGACGGTC
ACCCAGGCGCTCCGTGGCGTGGTGCAGAATTTGACCGTCGACAAGCCGGTTCAGAACCTGGAAGTCGGGGCTCCG
GACGCTCCACAGCCTGTCGCCGACTGTGAATTGGATTCTCCGCAACTGGAGACTGCGTACTCGAAGATTCTAGAC
CAGCTCTTCGGATCCCACCTTTACATCGCCAACGAACTGGCTTCGAAGCACACGGGGATCTCACCAATAGTCTCG
GCGAGTCCGGAATTCGGTTTCGGGTCCCTGCTGGCCCGAAAAGAACATCGCGCTCGTTTCGTGGGCGAGGTAAAG
GATGCTTCCCGGAGTGGCTCGTTTGCGTCTCACGACATCAAGAGCTGGCTGGCTCGATGGGCAGTGAACGCTGAG
TCTACAGAGGAATGTAACGAAGTAGCGGATCAGCTCATCTTCCGCCTGGAAAACGACGGGTCAGAGGCAGCCCAG
GCCCTTCTTTCCAGGCGCAAGCTATTCCACAAGGAATCTCTGTGGCTTATGGGTTCCGATGCCTGGGCATACGAC
CTGGGAAATTCTGGCGTGCATCATGTTCTGGCATCGGGCGAGAACGTGAATATGCTTATCATTGACTCGACACCT
TACTCGAAACGAGGCGTCGCCGACTCACATCGCAGGAAGAAGGATATCGGCTTGTACGCAATGAATTTCGGAAAC
GTCTACGTGGCCTCGACCGCCGTATACAGCTCATACACCCAGGTCCTCCAGGCGCTGCTCGAAGCGGAACGGTTT
CCCGGGCCCTCGGTTGTCCTCGCCTATCTACCCTACTTTGGCGAGACGGACTCGCCTTTGACCGTTCTCCAAGAA
ACGAAAAAAGCTGTGGACACTGGCTACTGGCCCCTCTATCGATGGAACCCAGAGAATGAGCGGAAGGGAGAGCCC
AGCTTCTCGCTCGACTCGGAATTGGTCAAACAAGAGCTCAAAGCCTTCCTGGCGAGGGACAATCATCTGACCCAG
TTGATGAAGAAGGAGCCCTCATTCTCCGCCAGCCTAGCAAGGGACTTTGGAACGGAAGTCCGGACCCGACAGAAA
CGGAAGGCTAGGGACGCCTACAATCAGCTATTGGAAGGCCTCCTTGGAGCTCCTTTAACAATTTTGTTCGCCTCC
GACAATGGCAATGCTTCCGCAGTGGCTAAACGTCTGGGGAACAGGGGCAGGGCCCGTGGCTTGAAGACGGTGGTC
ATGGCCATGGAGGACTACCCGGTCGAGGATCTACCCAGGGAAGAGAACATTGTGTTCATCACGTCCACTGCTGGC
CAGGGAGAGTTTCCCCAAAACGGACTGCCCTTCTGGGATGCCATCAAAGAGACTACGGATATGGATTTGGCGACA
GTCAATTTCTCCGTCTTCGGCCTGGGCGATAGTCACTACTGGCCCCGGAAAGAAGACCGAATCTTCTACAACAAG
CCGGCCAAGGATCTTGACAGGGTGCTCGGAAATTTTGGAGGTAGGCGCTTCTGCGAAATTGGATTGGGCGATGAC
CAAGATCCCGATGGATATCAGACCGGCTATCAAACATGGGAGCCGAAGATATGGCAGGCTCTGGGGGTGGACAAG
GTTGACGGACTACCGGAAGAGCCGCCGCCAATAACGAATGAAGACATAAAGCTGGCGTCGAATTATCTTCGCGGG
ACGATTGTTGAGGGACTGCAAGACACGACTACCGGTGCCATATCGGCTCACGATCAGCAACTGACAAAGTTCCAT
GGCACGTACATGCAGGACGACCGCGACGTTCGCGACGAAAGAAAAGCTCAGGGGCTGGAGCCGGCCTACTCGTTC
ATGATTCGATGCAGGCTGCCCGGTGGTGTGGCGACGCCGGAGCAGTGGGTGCAGATGGACGATATAAGTAACTCG
CTGGGGAATGAAACGATGAAGCTCACTACGAGACAGACTTTCCAGTTCCATGGAGTCGTCAAAGGAAAGCTGAAG
CCTGCCATGCAGGCCATCAACCGGGCGCTCATGACGACCATCGCCGCGTGCGGAGACGTGAACCGCAACGTGATG
TGCAGCTCGCTGCCAACGCAAGCTCGCTACCACAAACAAGTCCAGGTCTGCTCGCAGAAAATAAGCGATCACCTG
CTTCCGTCCACAACTGCCTATCACGAAATCTGGCTCACCAACGGCGACAACGAGAAGAAGCAGTTGGGTGGCGAC
GTCGTCCAGGACTTCGAACCGCTCTACGGGCCGACGTACCTTCCCCGCAAGTTCAAAATCACAATAGCGATTCCC
CCACACAACGACACTGATGTATACGCGCACGACATCGGCTTGATTGCCATCAAGGGGGCGGATGGAAACCTGGAA
GGCTTCAACGTACTGGCTGGCGGCGGCATGGGCGCGACCCACAACAACAAAAAGACGTATCCCCAGACCGGTCGA
ATGCTCGGGTTCTGCTCAACAGAAAATGTCCACATCGTGTGCGAGAAGATCATGCTTGTGCAGCGCGACCACGGC
GACCGGAAGAACCGCAAGCACGCCCGCCTCAAGTACACCATCGACGACATGGGCCTGGACGTCTTCCGGGGCAAG
GTCGAGGAGCTGTGGGGTGACCGATTCGGCGAAGAGAGGCCGTTCGAGTTCAAGAGCAACATCGACACATTCGGC
TGGCAGAAGGACGAGACGGGCCTGAACCACTTCACCTTCTTCATCGAGAACGGGCGGATCGAAGACACGCCCGAG
TTCCGGATGAAGACGGGACTGCGCGAGATCGCCAAGATGCGGCGCGGCGAATTCCGCCTGACCGGCAACCAGCAT
CTGATCCTGAGCAACATCCGGGACGAGGACGTGCCGACGGCCAAGAAGATGATGAAGGACTATAAGCTCGACAAC
ATCCAGTTCTCGGGCCTGCGGCTGAGCTCATCTGCCTGCGTGGCCTTCCCCACCTGCGGGCTCGCCATGGCCGAG
TCGGAGCGGTACCTACCCGTGCTCATCTCCAAGCTCGAGGCGTGCCTGGAGGAGAATGGGCTCCGGCAGGACTCG
ATCGTCATGCGCATGACGGGCTGCCCCAACGGCTGCGCCCGGCCGTGGCTGGCGGAGGTGGCGTTCGTCGGGAAG
GCCTACGGCGCCTACAACATGTACCTAGGCGGCGGGTATCACGGTCAGCGGCTCAACAAGCTCTTCCGGTCGAGC
ATCAAGGAAGACGAGATCCTGTCCATCATGAAGCCCCTGCTCAAGAGGTACGCGTCGGAAAGACAGGCAGGCGAG
AGGTTCGGGGACTTTTGCATCCGCGCCGGCTTCATCCGAGCCACCGGAGACGGGCGAGACTTCCACGACGGGGTG
GCCGAAGAGGAATCTGGAGATGAGTAG
Gene >Hirsu2|8976
ATGGCCATTACAGCTCATGCCTTGGCTGTGCGCACCGGCAAGGGCGTGGTACACTTCTTCGTCTCCGCCTCGTCG
ACTGGCAACGAACCAATCCGGCTCGAGGACGCTGCTGTCGTGCGAGCAATTCTTGATATCGAGAGTGTGAGAAGA
TTCCAATCCGGCGGCATTTCAGCGTCTGGCATTTATGCCGATGATGGTCACGTGGCCGTCTCCTCAGACCACCCG
GACACGGCGCCGTTGAACAGCGGTCCGGGAAAGAATGCCAGCCTACAGCATTCTGTCATCGCCGACGGCCCCAAG
GCGACGTCTACAGCGACCTCAGTCAAGTCGAGCGAGGCTAGCGAGTCATCCACTCCCGTGGCCCCGTCATCTGTT
GCCACTACCGTCGAGGCCACCCCGCCCCAAATCCTGTCCGATGACCTCTACACCTGCGTGACCCGCATCTGGGCG
CAGATCAGACTGGCTCTCGGGAGGCAATACAATGCCTTCGAGTACACGGGGCCTGCCGATGCTGAGAACTGTCTC
TTCATCTTCGGGTCCAACACCGCCATGTTTCTGGAGACAGTGGATCGCGCTCGACCAGACGATATCTTCGCCAAA
GTCGGCATCGTCATCCCCCGCCTCTACCGGCCCTGGATCGGCTCTAAGCTCGTCGAAGCCCTACCTAGGTCAACA
AGGAGAATTGCAGTGCTGGAGCGAATTAACCGGGCAACGACGAGATGGGGGCCCCTTCTCATCGACATTCTATCC
TCCGTGAGCCGCGGGTCTGGTGGCGGCGAGACCATTGTTGGGTACCAGCTTGGGCACCTCACCCCTGAGACGGTC
ACCCAGGCGCTCCGTGGCGTGGTGCAGAATTTGACCGTCGACAAGCCGGTTCAGAACCTGGAAGTCGGGGCTCCG
GACGCTCCACAGCCTGTCGCCGACTGTGAATTGGATTCTCCGCAACTGGAGACTGCGTACTCGAAGATTCTAGAC
CAGCTCTTCGGATCCCACCTTTACATCGCCAACGAACTGGCTTCGAAGCACACGGGGATCTCACCAATAGTCTCG
GCGAGTCCGGAATTCGGTTTCGGGTCCCTGCTGGCCCGAAAAGAACATCGCGCTCGTTTCGTGGGCGAGGTAAAG
GATGCTTCCCGGAGTGGCTCGTTTGCGTCTCACGACATCAAGAGCTGGCTGGCTCGATGGGCAGTGAACGCTGAG
TCTACAGAGGAATGTAACGAAGTAGCGGATCAGCTCATCTTCCGCCTGGAAAACGACGGGTCAGAGGCAGCCCAG
GCCCTTCTTTCCAGGCGCAAGCTATTCCACAAGGAATCTCTGTGGCTTATGGGTTCCGATGCCTGGGCATACGAC
CTGGGAAATTCTGGCGTGCATCATGTTCTGGCATCGGGCGAGAACGTGAATATGCTTATCATTGACTCGACACCT
TACTCGAAACGAGGCGTCGCCGACTCACATCGCAGGAAGAAGGATATCGGCTTGTACGCAATGAATTTCGGAAAC
GTCTACGTGGCCTCGACCGCCGTATACAGCTCATACACCCAGGTCCTCCAGGCGCTGCTCGAAGCGGAACGGTTT
CCCGGGCCCTCGGTTGTCCTCGCCTATCTACCCTACTTTGGCGAGACGGACTCGCCTTTGACCGTTCTCCAAGAA
ACGAAAAAAGCTGTGGACACTGGCTACTGGCCCCTCTATCGATGGAACCCAGAGAATGAGCGGAAGGGAGAGCCC
AGCTTCTCGCTCGACTCGGAATTGGTCAAACAAGAGCTCAAAGCCTTCCTGGCGAGGGACAATCATCTGACCCAG
TTGATGAAGAAGGAGCCCTCATTCTCCGCCAGCCTAGCAAGGGACTTTGGAACGGAAGTCCGGACCCGACAGAAA
CGGAAGGCTAGGGACGCCTACAATCAGCTATTGGAAGGCCTCCTTGGAGCTCCTTTAACAATTTTGTTCGCCTCC
GACAATGGCAATGCTTCCGCAGTGGCTAAACGTCTGGGGAACAGGGGCAGGGCCCGTGGCTTGAAGACGGTGGTC
ATGGCCATGGAGGACTACCCGGTCGAGGATCTACCCAGGGAAGAGAACATTGTGTTCATCACGTCCACTGCTGGC
CAGGGAGAGTTTCCCCAAAACGGACTGCCCTTCTGGGATGCCATCAAAGAGACTACGGATATGGATTTGGCGACA
GTCAATTTCTCCGTCTTCGGCCTGGGCGATAGTCACTACTGGCCCCGGAAAGAAGACCGAATCTTCTACAACAAG
CCGGCCAAGGATCTTGACAGGGTGCTCGGAAATTTTGGAGGTAGGCGCTTCTGCGAAATTGGATTGGGCGATGAC
CAAGATCCCGATGGATATCAGACCGGCTATCAAACATGGGAGCCGAAGATATGGCAGGCTCTGGGGGTGGACAAG
GTTGACGGACTACCGGAAGAGCCGCCGCCAATAACGAATGAAGACATAAAGCTGGCGTCGAATTATCTTCGCGGG
ACGATTGTTGAGGGACTGCAAGACACGACTACCGGTGCCATATCGGCTCACGATCAGCAACTGACAAAGTTCCAT
GGCACGTACATGCAGGACGACCGCGACGTTCGCGACGAAAGAAAAGCTCAGGGGCTGGAGCCGGCCTACTCGTTC
ATGATTCGATGCAGGCTGCCCGGTGGTGTGGCGACGCCGGAGCAGTGGGTGCAGATGGACGATATAAGTAACTCG
CTGGGGAATGAAACGATGAAGCTCACTACGAGACAGACTTTCCAGTTCCATGGAGTCGTCAAAGGAAAGCTGAAG
CCTGCCATGCAGGCCATCAACCGGGCGCTCATGACGACCATCGCCGCGTGCGGAGACGTGAACCGCAACGTGATG
TGCAGCTCGCTGCCAACGCAAGCTCGCTACCACAAACAAGTCCAGGTCTGCTCGCAGAAAATAAGCGATCACCTG
CTTCCGTCCACAACTGCCTATCACGAAATCTGGCTCACCAACGGCGACAACGAGAAGAAGCAGTTGGGTGGCGAC
GTCGTCCAGGACTTCGAACCGCTCTACGGGCCGACGTACCTTCCCCGCAAGTTCAAAATCACAATAGCGATTCCC
CCACACAACGACACTGATGTATACGCGCACGACATCGGCTTGATTGCCATCAAGGGGGCGGATGGAAACCTGGAA
GGCTTCAACGTACTGGCTGGCGGCGGCATGGGCGCGACCCACAACAACAAAAAGACGTATCCCCAGACCGGTCGA
ATGCTCGGGTTCTGCTCAACAGAAAATGTCCACATCGTGTGCGAGAAGATCATGCTTGTGCAGCGCGACCACGGC
GACCGGAAGAACCGCAAGCACGCCCGCCTCAAGTACACCATCGACGACATGGGCCTGGACGTCTTCCGGGGCAAG
GTCGAGGAGCTGTGGGGTGACCGATTCGGCGAAGAGAGGCCGTTCGAGTTCAAGAGCAACATCGACACATTCGGC
TGGCAGAAGGACGAGACGGGCCTGAACCACTTCACCTTCTTCATCGAGAACGGGCGGATCGAAGACACGCCCGAG
TTCCGGATGAAGACGGGACTGCGCGAGATCGCCAAGATGCGGCGCGGCGAATTCCGCCTGACCGGCAACCAGCAT
CTGATCCTGAGCAACATCCGGGACGAGGACGTGCCGACGGCCAAGAAGATGATGAAGGACTATAAGCTCGACAAC
ATCCAGTTCTCGGGCCTGCGGCTGAGCTCATCTGCCTGCGTGGCCTTCCCCACCTGCGGGCTCGCCATGGCCGAG
TCGGAGCGGTACCTACCCGTGCTCATCTCCAAGCTCGAGGCGTGCCTGGAGGAGAATGGGCTCCGGCAGGACTCG
ATCGTCATGCGCATGACGGGCTGCCCCAACGGCTGCGCCCGGCCGTGGCTGGCGGAGGTGGCGTTCGTCGGGAAG
GCCTACGGCGCCTACAACATGTACCTAGGCGGCGGGTATCACGGTCAGCGGCTCAACAAGCTCTTCCGGTCGAGC
ATCAAGGAAGACGAGATCCTGTCCATCATGAAGCCCCTGCTCAAGAGGTACGCGTCGGAAAGACAGGCAGGCGAG
AGGTTCGGGGACTTTTGCATCCGCGCCGGCTTCATCCGAGCCACCGGAGACGGGCGAGACTTCCACGACGGGGTA
AGTACCGGCTCCGAGAGCAGGAGAAGCCGGACGTCCGTTGGATATCACGGGACCCCCGCTAACGTTCAGCATCAG
GTGGCCGAAGAGGAATCTGGAGATGAGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail