Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|8975
Gene name
LocationContig_62:34292..35148
Strand+
Gene length (bp)856
Transcript length (bp)780
Coding sequence length (bp)780
Protein length (aa) 260

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08552 Kei1 Inositolphosphorylceramide synthase subunit Kei1 4.5E-52 16 187

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|O13994|KEI1_SCHPO Inositol phoshorylceramide synthase regulatory subunit kei1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=kei1 PE=3 SV=1 15 185 6.0E-16
sp|Q06346|KEI1_YEAST Inositol phosphorylceramide synthase regulatory subunit KEI1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KEI1 PE=1 SV=2 14 187 3.0E-09

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 28 0.5

Transmembrane Domains

Domain # Start End Length
1 17 39 22
2 54 76 22
3 88 110 22
4 158 180 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|8975
MLKLTRLSLRTPRPQSLLGIVSLQTGTELVAMALVFNKATGVYGLLAILTGYQLSLLQLSTYVYSILVLSVLVYL
IPHIRRQSPCECLALAWVYLLDTFINGLYTALFGLDLYFAGIAADGTDSASAASLPNVVAKELGGFTQETQTSSA
PVSQETVTSVLLIVGLTLIRVYFSIVVMSYARQVLQRHMQLLAVEGPVVDEQQGPFAAGLPCGDGRRGWMGRFMV
RYGRRYWLEVDEADYWKRNPHSKPSARDTFDGEN*
Coding >Hirsu2|8975
ATGCTCAAGTTAACGAGGCTGTCACTGCGGACACCCCGTCCCCAGAGCCTGCTGGGCATCGTCAGCCTCCAAACC
GGCACTGAGCTTGTCGCGATGGCCCTCGTCTTCAACAAGGCCACCGGGGTGTATGGGCTGTTAGCGATCCTGACG
GGCTATCAACTGTCACTCCTGCAACTCTCGACATACGTGTATTCGATCCTCGTGCTCTCCGTCCTCGTTTACCTG
ATCCCTCACATTCGGAGGCAGAGCCCGTGCGAGTGCCTGGCGCTGGCATGGGTGTACCTGCTTGACACGTTCATC
AACGGACTCTACACGGCGTTGTTTGGGCTTGACTTGTACTTCGCCGGTATCGCCGCTGACGGCACCGATTCAGCC
TCGGCGGCATCTCTTCCCAACGTCGTGGCCAAAGAACTTGGAGGCTTTACGCAAGAGACGCAGACGAGTAGCGCG
CCCGTGTCGCAGGAGACCGTCACGAGCGTGCTCCTGATTGTGGGGTTGACGCTGATACGGGTGTACTTCAGCATC
GTGGTCATGTCCTACGCCCGGCAAGTTCTGCAAAGGCACATGCAGCTGCTGGCAGTCGAGGGTCCCGTGGTGGAC
GAGCAGCAAGGACCCTTCGCCGCGGGTCTCCCCTGCGGCGATGGACGCAGGGGGTGGATGGGAAGGTTCATGGTC
CGTTACGGCAGAAGATACTGGCTGGAGGTGGATGAGGCGGATTATTGGAAGAGGAACCCGCACAGCAAACCCAGT
GCCAGAGATACGTTTGATGGGGAGAACTGA
Transcript >Hirsu2|8975
ATGCTCAAGTTAACGAGGCTGTCACTGCGGACACCCCGTCCCCAGAGCCTGCTGGGCATCGTCAGCCTCCAAACC
GGCACTGAGCTTGTCGCGATGGCCCTCGTCTTCAACAAGGCCACCGGGGTGTATGGGCTGTTAGCGATCCTGACG
GGCTATCAACTGTCACTCCTGCAACTCTCGACATACGTGTATTCGATCCTCGTGCTCTCCGTCCTCGTTTACCTG
ATCCCTCACATTCGGAGGCAGAGCCCGTGCGAGTGCCTGGCGCTGGCATGGGTGTACCTGCTTGACACGTTCATC
AACGGACTCTACACGGCGTTGTTTGGGCTTGACTTGTACTTCGCCGGTATCGCCGCTGACGGCACCGATTCAGCC
TCGGCGGCATCTCTTCCCAACGTCGTGGCCAAAGAACTTGGAGGCTTTACGCAAGAGACGCAGACGAGTAGCGCG
CCCGTGTCGCAGGAGACCGTCACGAGCGTGCTCCTGATTGTGGGGTTGACGCTGATACGGGTGTACTTCAGCATC
GTGGTCATGTCCTACGCCCGGCAAGTTCTGCAAAGGCACATGCAGCTGCTGGCAGTCGAGGGTCCCGTGGTGGAC
GAGCAGCAAGGACCCTTCGCCGCGGGTCTCCCCTGCGGCGATGGACGCAGGGGGTGGATGGGAAGGTTCATGGTC
CGTTACGGCAGAAGATACTGGCTGGAGGTGGATGAGGCGGATTATTGGAAGAGGAACCCGCACAGCAAACCCAGT
GCCAGAGATACGTTTGATGGGGAGAACTGA
Gene >Hirsu2|8975
ATGCTCAAGTTAACGAGGCTGTCACTGCGGACACCCCGTCCCCAGGTGAGTCCGACCTGGCGGGCAGGACGGGCA
CCGCAACTGGACGAGTCCTCGGAATGAGCGCTTACACGATGGATAGAGCCTGCTGGGCATCGTCAGCCTCCAAAC
CGGCACTGAGCTTGTCGCGATGGCCCTCGTCTTCAACAAGGCCACCGGGGTGTATGGGCTGTTAGCGATCCTGAC
GGGCTATCAACTGTCACTCCTGCAACTCTCGACATACGTGTATTCGATCCTCGTGCTCTCCGTCCTCGTTTACCT
GATCCCTCACATTCGGAGGCAGAGCCCGTGCGAGTGCCTGGCGCTGGCATGGGTGTACCTGCTTGACACGTTCAT
CAACGGACTCTACACGGCGTTGTTTGGGCTTGACTTGTACTTCGCCGGTATCGCCGCTGACGGCACCGATTCAGC
CTCGGCGGCATCTCTTCCCAACGTCGTGGCCAAAGAACTTGGAGGCTTTACGCAAGAGACGCAGACGAGTAGCGC
GCCCGTGTCGCAGGAGACCGTCACGAGCGTGCTCCTGATTGTGGGGTTGACGCTGATACGGGTGTACTTCAGCAT
CGTGGTCATGTCCTACGCCCGGCAAGTTCTGCAAAGGCACATGCAGCTGCTGGCAGTCGAGGGTCCCGTGGTGGA
CGAGCAGCAAGGACCCTTCGCCGCGGGTCTCCCCTGCGGCGATGGACGCAGGGGGTGGATGGGAAGGTTCATGGT
CCGTTACGGCAGAAGATACTGGCTGGAGGTGGATGAGGCGGATTATTGGAAGAGGAACCCGCACAGCAAACCCAG
TGCCAGAGATACGTTTGATGGGGAGAACTGA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail