Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|8971
Gene name
LocationContig_62:25667..27360
Strand+
Gene length (bp)1693
Transcript length (bp)1191
Coding sequence length (bp)1191
Protein length (aa) 397

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00485 PRK Phosphoribulokinase / Uridine kinase family 6.8E-47 1 156
PF14681 UPRTase Uracil phosphoribosyltransferase 6.8E-40 201 380

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9NWZ5|UCKL1_HUMAN Uridine-cytidine kinase-like 1 OS=Homo sapiens GN=UCKL1 PE=1 SV=2 1 380 1.0E-106
sp|Q91YL3|UCKL1_MOUSE Uridine-cytidine kinase-like 1 OS=Mus musculus GN=Uckl1 PE=1 SV=1 1 380 1.0E-106
sp|P27515|URK1_YEAST Uridine kinase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=URK1 PE=1 SV=1 1 394 7.0E-102
sp|O74427|URK1_SCHPO Uridine kinase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=urk1 PE=3 SV=1 1 396 5.0E-94
sp|Q55EL3|UCKA_DICDI Uridine-cytidine kinase A OS=Dictyostelium discoideum GN=udkA PE=3 SV=1 1 380 8.0E-86
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9NWZ5|UCKL1_HUMAN Uridine-cytidine kinase-like 1 OS=Homo sapiens GN=UCKL1 PE=1 SV=2 1 380 1.0E-106
sp|Q91YL3|UCKL1_MOUSE Uridine-cytidine kinase-like 1 OS=Mus musculus GN=Uckl1 PE=1 SV=1 1 380 1.0E-106
sp|P27515|URK1_YEAST Uridine kinase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=URK1 PE=1 SV=1 1 394 7.0E-102
sp|O74427|URK1_SCHPO Uridine kinase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=urk1 PE=3 SV=1 1 396 5.0E-94
sp|Q55EL3|UCKA_DICDI Uridine-cytidine kinase A OS=Dictyostelium discoideum GN=udkA PE=3 SV=1 1 380 8.0E-86
sp|Q9LTY6|UKL5_ARATH Uridine kinase-like protein 5 OS=Arabidopsis thaliana GN=UKL5 PE=2 SV=1 2 380 6.0E-80
sp|Q9LK34|UKL2_ARATH Uridine kinase-like protein 2, chloroplastic OS=Arabidopsis thaliana GN=UKL2 PE=2 SV=1 2 380 6.0E-73
sp|Q9FKS0|UKL1_ARATH Uridine kinase-like protein 1, chloroplastic OS=Arabidopsis thaliana GN=UKL1 PE=1 SV=1 2 389 1.0E-72
sp|Q8VYB2|UKL3_ARATH Uridine kinase-like protein 3 OS=Arabidopsis thaliana GN=UKL3 PE=2 SV=1 2 380 4.0E-68
sp|O65583|UKL4_ARATH Uridine kinase-like protein 4 OS=Arabidopsis thaliana GN=UKL4 PE=2 SV=2 1 380 5.0E-68
sp|Q9QYG8|UCK2_RAT Uridine-cytidine kinase 2 OS=Rattus norvegicus GN=Uck2 PE=2 SV=2 2 166 4.0E-47
sp|Q99PM9|UCK2_MOUSE Uridine-cytidine kinase 2 OS=Mus musculus GN=Uck2 PE=1 SV=1 2 166 4.0E-47
sp|Q9BZX2|UCK2_HUMAN Uridine-cytidine kinase 2 OS=Homo sapiens GN=UCK2 PE=1 SV=1 2 166 5.0E-47
sp|B1H116|UCK2_XENTR Uridine-cytidine kinase 2 OS=Xenopus tropicalis GN=uck2 PE=2 SV=1 2 166 5.0E-45
sp|Q8T154|UCKB_DICDI Uridine-cytidine kinase B OS=Dictyostelium discoideum GN=udkB PE=3 SV=2 1 174 2.0E-44
sp|Q7SYM0|UCK2A_DANRE Uridine-cytidine kinase 2-A OS=Danio rerio GN=uck2a PE=2 SV=1 2 166 4.0E-44
sp|Q7ZV79|UCK2B_DANRE Uridine-cytidine kinase 2-B OS=Danio rerio GN=uck2b PE=2 SV=1 2 166 6.0E-42
sp|Q9HA47|UCK1_HUMAN Uridine-cytidine kinase 1 OS=Homo sapiens GN=UCK1 PE=1 SV=1 2 166 8.0E-42
sp|P52623|UCK1_MOUSE Uridine-cytidine kinase 1 OS=Mus musculus GN=Uck1 PE=1 SV=2 2 166 9.0E-42
sp|Q0P5A4|UCK1_BOVIN Uridine-cytidine kinase 1 OS=Bos taurus GN=UCK1 PE=2 SV=1 2 169 2.0E-41
sp|Q6PA79|UCK1A_XENLA Uridine-cytidine kinase 1-A OS=Xenopus laevis GN=uck1-a PE=2 SV=1 2 166 4.0E-40
sp|Q66I71|UCK1_DANRE Uridine-cytidine kinase 1 OS=Danio rerio GN=uck1 PE=2 SV=1 2 191 9.0E-40
sp|Q6GPD9|UCK1B_XENLA Uridine-cytidine kinase 1-B OS=Xenopus laevis GN=uck1-b PE=2 SV=1 2 166 4.0E-39
sp|Q4L6V8|URK_STAHJ Uridine kinase OS=Staphylococcus haemolyticus (strain JCSC1435) GN=udk PE=3 SV=1 2 166 2.0E-38
sp|Q8XJI6|URK_CLOPE Uridine kinase OS=Clostridium perfringens (strain 13 / Type A) GN=udk PE=3 SV=1 2 169 3.0E-38
sp|Q0TPI4|URK_CLOP1 Uridine kinase OS=Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) GN=udk PE=3 SV=1 2 169 3.0E-38
sp|Q8CSB2|URK_STAES Uridine kinase OS=Staphylococcus epidermidis (strain ATCC 12228) GN=udk PE=3 SV=1 2 172 3.0E-38
sp|Q5HNT9|URK_STAEQ Uridine kinase OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=udk PE=3 SV=1 2 172 3.0E-38
sp|Q0SS52|URK_CLOPS Uridine kinase OS=Clostridium perfringens (strain SM101 / Type A) GN=udk PE=3 SV=1 2 169 5.0E-38
sp|Q9VC99|UCK_DROME Probable uridine-cytidine kinase OS=Drosophila melanogaster GN=CG6364 PE=3 SV=1 2 187 2.0E-37
sp|B9E6Y9|URK_MACCJ Uridine kinase OS=Macrococcus caseolyticus (strain JCSC5402) GN=udk PE=3 SV=1 2 166 3.0E-37
sp|A7GGE1|URK_CLOBL Uridine kinase OS=Clostridium botulinum (strain Langeland / NCTC 10281 / Type F) GN=udk PE=3 SV=1 2 172 4.0E-37
sp|C1FSX6|URK_CLOBJ Uridine kinase OS=Clostridium botulinum (strain Kyoto / Type A2) GN=udk PE=3 SV=1 2 171 4.0E-37
sp|P67412|URK_STAAW Uridine kinase OS=Staphylococcus aureus (strain MW2) GN=udk PE=3 SV=1 2 166 4.0E-37
sp|A8Z4E9|URK_STAAT Uridine kinase OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=udk PE=3 SV=1 2 166 4.0E-37
sp|Q6G8V8|URK_STAAS Uridine kinase OS=Staphylococcus aureus (strain MSSA476) GN=udk PE=3 SV=1 2 166 4.0E-37
sp|Q6GG92|URK_STAAR Uridine kinase OS=Staphylococcus aureus (strain MRSA252) GN=udk PE=3 SV=1 2 166 4.0E-37
sp|P67411|URK_STAAN Uridine kinase OS=Staphylococcus aureus (strain N315) GN=udk PE=1 SV=1 2 166 4.0E-37
sp|P67410|URK_STAAM Uridine kinase OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=udk PE=3 SV=1 2 166 4.0E-37
sp|A6QHF2|URK_STAAE Uridine kinase OS=Staphylococcus aureus (strain Newman) GN=udk PE=3 SV=1 2 166 4.0E-37
sp|Q5HFF1|URK_STAAC Uridine kinase OS=Staphylococcus aureus (strain COL) GN=udk PE=3 SV=1 2 166 4.0E-37
sp|Q2YT67|URK_STAAB Uridine kinase OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=udk PE=3 SV=1 2 166 4.0E-37
sp|A5ITD6|URK_STAA9 Uridine kinase OS=Staphylococcus aureus (strain JH9) GN=udk PE=3 SV=1 2 166 4.0E-37
sp|Q2FXW6|URK_STAA8 Uridine kinase OS=Staphylococcus aureus (strain NCTC 8325) GN=udk PE=3 SV=1 2 166 4.0E-37
sp|Q2FGB5|URK_STAA3 Uridine kinase OS=Staphylococcus aureus (strain USA300) GN=udk PE=3 SV=1 2 166 4.0E-37
sp|A6U280|URK_STAA2 Uridine kinase OS=Staphylococcus aureus (strain JH1) GN=udk PE=3 SV=1 2 166 4.0E-37
sp|A7X320|URK_STAA1 Uridine kinase OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=udk PE=3 SV=1 2 166 4.0E-37
sp|C3L140|URK_CLOB6 Uridine kinase OS=Clostridium botulinum (strain 657 / Type Ba4) GN=udk PE=3 SV=1 2 172 4.0E-37
sp|Q65S71|URK_MANSM Uridine kinase OS=Mannheimia succiniciproducens (strain MBEL55E) GN=udk PE=3 SV=1 2 161 1.0E-36
sp|A1S796|URK_SHEAM Uridine kinase OS=Shewanella amazonensis (strain ATCC BAA-1098 / SB2B) GN=udk PE=3 SV=1 2 169 2.0E-36
sp|B1KXA7|URK_CLOBM Uridine kinase OS=Clostridium botulinum (strain Loch Maree / Type A3) GN=udk PE=3 SV=1 2 172 3.0E-36
sp|B1IJ68|URK_CLOBK Uridine kinase OS=Clostridium botulinum (strain Okra / Type B1) GN=udk PE=3 SV=1 2 172 4.0E-36
sp|A7MVE7|URK_VIBCB Uridine kinase OS=Vibrio campbellii (strain ATCC BAA-1116 / BB120) GN=udk PE=3 SV=1 2 169 6.0E-36
sp|B0UT65|URK_HISS2 Uridine kinase OS=Histophilus somni (strain 2336) GN=udk PE=3 SV=1 2 161 1.0E-35
sp|Q0I2Y9|URK_HAES1 Uridine kinase OS=Haemophilus somnus (strain 129Pt) GN=udk PE=3 SV=1 2 161 1.0E-35
sp|Q12MJ0|URK_SHEDO Uridine kinase OS=Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013) GN=udk PE=3 SV=1 2 166 2.0E-35
sp|A8AWT2|URK_STRGC Uridine kinase OS=Streptococcus gordonii (strain Challis / ATCC 35105 / CH1 / DL1 / V288) GN=udk PE=3 SV=1 2 171 2.0E-35
sp|P44533|URK_HAEIN Uridine kinase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=udk PE=3 SV=1 2 161 2.0E-35
sp|A5UFT8|URK_HAEIG Uridine kinase OS=Haemophilus influenzae (strain PittGG) GN=udk PE=3 SV=1 2 161 2.0E-35
sp|Q4QP55|URK_HAEI8 Uridine kinase OS=Haemophilus influenzae (strain 86-028NP) GN=udk PE=3 SV=1 2 161 2.0E-35
sp|Q49Y49|URK_STAS1 Uridine kinase OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=udk PE=3 SV=1 2 166 2.0E-35
sp|A5UB17|URK_HAEIE Uridine kinase OS=Haemophilus influenzae (strain PittEE) GN=udk PE=3 SV=1 2 161 3.0E-35
sp|A7MHG8|URK_CROS8 Uridine kinase OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=udk PE=3 SV=1 2 161 4.0E-35
sp|B9DNJ4|URK_STACT Uridine kinase OS=Staphylococcus carnosus (strain TM300) GN=udk PE=3 SV=1 2 166 4.0E-35
sp|A7GT59|URK_BACCN Uridine kinase OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=udk PE=3 SV=1 2 172 7.0E-35
sp|Q0HVY0|URK_SHESR Uridine kinase OS=Shewanella sp. (strain MR-7) GN=udk PE=3 SV=1 2 166 8.0E-35
sp|Q0HJN4|URK_SHESM Uridine kinase OS=Shewanella sp. (strain MR-4) GN=udk PE=3 SV=1 2 166 8.0E-35
sp|A0KW26|URK_SHESA Uridine kinase OS=Shewanella sp. (strain ANA-3) GN=udk PE=3 SV=1 2 166 8.0E-35
sp|Q8EDX4|URK_SHEON Uridine kinase OS=Shewanella oneidensis (strain MR-1) GN=udk PE=3 SV=1 2 166 8.0E-35
sp|B5RBW3|URK_SALG2 Uridine kinase OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=udk PE=3 SV=1 2 161 1.0E-34
sp|P67408|URK_SALTY Uridine kinase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=udk PE=3 SV=1 2 161 1.0E-34
sp|P67409|URK_SALTI Uridine kinase OS=Salmonella typhi GN=udk PE=3 SV=1 2 161 1.0E-34
sp|B4TNH9|URK_SALSV Uridine kinase OS=Salmonella schwarzengrund (strain CVM19633) GN=udk PE=3 SV=1 2 161 1.0E-34
sp|C0Q1G0|URK_SALPC Uridine kinase OS=Salmonella paratyphi C (strain RKS4594) GN=udk PE=3 SV=1 2 161 1.0E-34
sp|A9N7M0|URK_SALPB Uridine kinase OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=udk PE=3 SV=1 2 161 1.0E-34
sp|B4T9T4|URK_SALHS Uridine kinase OS=Salmonella heidelberg (strain SL476) GN=udk PE=3 SV=1 2 161 1.0E-34
sp|B5R0B5|URK_SALEP Uridine kinase OS=Salmonella enteritidis PT4 (strain P125109) GN=udk PE=3 SV=1 2 161 1.0E-34
sp|B5FMU1|URK_SALDC Uridine kinase OS=Salmonella dublin (strain CT_02021853) GN=udk PE=3 SV=1 2 161 1.0E-34
sp|Q57MN1|URK_SALCH Uridine kinase OS=Salmonella choleraesuis (strain SC-B67) GN=udk PE=3 SV=1 2 161 1.0E-34
sp|B5EXV0|URK_SALA4 Uridine kinase OS=Salmonella agona (strain SL483) GN=udk PE=3 SV=1 2 161 1.0E-34
sp|A0KKF8|URK_AERHH Uridine kinase OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240) GN=udk PE=3 SV=1 2 161 1.0E-34
sp|A4SML3|URK_AERS4 Uridine kinase OS=Aeromonas salmonicida (strain A449) GN=udk PE=3 SV=1 2 161 1.0E-34
sp|A1RIY2|URK_SHESW Uridine kinase OS=Shewanella sp. (strain W3-18-1) GN=udk PE=3 SV=1 2 166 2.0E-34
sp|A4Y7K6|URK_SHEPC Uridine kinase OS=Shewanella putrefaciens (strain CN-32 / ATCC BAA-453) GN=udk PE=3 SV=1 2 166 2.0E-34
sp|A9VI01|URK_BACWK Uridine kinase OS=Bacillus weihenstephanensis (strain KBAB4) GN=udk PE=3 SV=1 2 172 3.0E-34
sp|Q26998|UPP_TOXGO Uracil phosphoribosyltransferase OS=Toxoplasma gondii GN=uprt PE=1 SV=1 196 380 4.0E-34
sp|B4SXV3|URK_SALNS Uridine kinase OS=Salmonella newport (strain SL254) GN=udk PE=3 SV=1 2 161 4.0E-34
sp|Q9KDD8|URK_BACHD Uridine kinase OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=udk PE=3 SV=1 2 174 4.0E-34
sp|A9L4F4|URK_SHEB9 Uridine kinase OS=Shewanella baltica (strain OS195) GN=udk PE=3 SV=1 2 169 5.0E-34
sp|A6WP54|URK_SHEB8 Uridine kinase OS=Shewanella baltica (strain OS185) GN=udk PE=3 SV=1 2 169 5.0E-34
sp|B8E960|URK_SHEB2 Uridine kinase OS=Shewanella baltica (strain OS223) GN=udk PE=3 SV=1 2 169 5.0E-34
sp|Q6HDE5|URK_BACHK Uridine kinase OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=udk PE=3 SV=1 2 172 5.0E-34
sp|Q634G4|URK_BACCZ Uridine kinase OS=Bacillus cereus (strain ZK / E33L) GN=udk PE=3 SV=1 2 172 5.0E-34
sp|B9IYE5|URK_BACCQ Uridine kinase OS=Bacillus cereus (strain Q1) GN=udk PE=3 SV=1 2 172 5.0E-34
sp|B7HQD8|URK_BACC7 Uridine kinase OS=Bacillus cereus (strain AH187) GN=udk PE=3 SV=1 2 172 5.0E-34
sp|C1ESS5|URK_BACC3 Uridine kinase OS=Bacillus cereus (strain 03BB102) GN=udk PE=3 SV=1 2 172 5.0E-34
sp|Q730F4|URK_BACC1 Uridine kinase OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=udk PE=3 SV=1 2 172 5.0E-34
sp|B7JP70|URK_BACC0 Uridine kinase OS=Bacillus cereus (strain AH820) GN=udk PE=3 SV=1 2 172 5.0E-34
sp|A0RIZ3|URK_BACAH Uridine kinase OS=Bacillus thuringiensis (strain Al Hakam) GN=udk PE=3 SV=1 2 172 5.0E-34
sp|A1JTX4|URK_YERE8 Uridine kinase OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=udk PE=3 SV=1 2 161 5.0E-34
sp|B1JPY6|URK_YERPY Uridine kinase OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=udk PE=3 SV=1 2 161 5.0E-34
sp|Q66C70|URK_YERPS Uridine kinase OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=udk PE=3 SV=1 2 161 5.0E-34
sp|A4TKM7|URK_YERPP Uridine kinase OS=Yersinia pestis (strain Pestoides F) GN=udk PE=3 SV=1 2 161 5.0E-34
sp|Q1CGU6|URK_YERPN Uridine kinase OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=udk PE=3 SV=1 2 161 5.0E-34
sp|A9R2M5|URK_YERPG Uridine kinase OS=Yersinia pestis bv. Antiqua (strain Angola) GN=udk PE=3 SV=1 2 161 5.0E-34
sp|Q8ZFZ9|URK_YERPE Uridine kinase OS=Yersinia pestis GN=udk PE=3 SV=1 2 161 5.0E-34
sp|B2JZK5|URK_YERPB Uridine kinase OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=udk PE=3 SV=1 2 161 5.0E-34
sp|Q1C9T6|URK_YERPA Uridine kinase OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=udk PE=3 SV=1 2 161 5.0E-34
sp|A7FJJ4|URK_YERP3 Uridine kinase OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=udk PE=3 SV=1 2 161 5.0E-34
sp|Q8EPT5|URK_OCEIH Uridine kinase OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=udk PE=3 SV=1 2 169 8.0E-34
sp|P0A8F7|URK_SHIFL Uridine kinase OS=Shigella flexneri GN=udk PE=3 SV=1 2 161 9.0E-34
sp|P0A8F4|URK_ECOLI Uridine kinase OS=Escherichia coli (strain K12) GN=udk PE=3 SV=1 2 161 9.0E-34
sp|P0A8F5|URK_ECOL6 Uridine kinase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=udk PE=3 SV=1 2 161 9.0E-34
sp|P0A8F6|URK_ECO57 Uridine kinase OS=Escherichia coli O157:H7 GN=udk PE=3 SV=1 2 161 9.0E-34
sp|A3D5E3|URK_SHEB5 Uridine kinase OS=Shewanella baltica (strain OS155 / ATCC BAA-1091) GN=udk PE=3 SV=1 2 166 1.0E-33
sp|Q81LK8|URK_BACAN Uridine kinase OS=Bacillus anthracis GN=udk PE=3 SV=1 2 172 1.0E-33
sp|C3L5Y6|URK_BACAC Uridine kinase OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=udk PE=3 SV=1 2 172 1.0E-33
sp|C3P969|URK_BACAA Uridine kinase OS=Bacillus anthracis (strain A0248) GN=udk PE=3 SV=1 2 172 1.0E-33
sp|C1CR90|URK_STRZT Uridine kinase OS=Streptococcus pneumoniae (strain Taiwan19F-14) GN=udk PE=3 SV=1 2 171 1.0E-33
sp|C1CKV4|URK_STRZP Uridine kinase OS=Streptococcus pneumoniae (strain P1031) GN=udk PE=3 SV=1 2 171 1.0E-33
sp|C1CEH1|URK_STRZJ Uridine kinase OS=Streptococcus pneumoniae (strain JJA) GN=udk PE=3 SV=1 2 171 1.0E-33
sp|P67414|URK_STRR6 Uridine kinase OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=udk PE=3 SV=1 2 171 1.0E-33
sp|B2IPS2|URK_STRPS Uridine kinase OS=Streptococcus pneumoniae (strain CGSP14) GN=udk PE=3 SV=1 2 171 1.0E-33
sp|P67413|URK_STRPN Uridine kinase OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=udk PE=3 SV=1 2 171 1.0E-33
sp|B8ZQ77|URK_STRPJ Uridine kinase OS=Streptococcus pneumoniae (strain ATCC 700669 / Spain 23F-1) GN=udk PE=3 SV=1 2 171 1.0E-33
sp|B1IC10|URK_STRPI Uridine kinase OS=Streptococcus pneumoniae (strain Hungary19A-6) GN=udk PE=3 SV=1 2 171 1.0E-33
sp|C1C7H7|URK_STRP7 Uridine kinase OS=Streptococcus pneumoniae (strain 70585) GN=udk PE=3 SV=1 2 171 1.0E-33
sp|Q04KA9|URK_STRP2 Uridine kinase OS=Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466) GN=udk PE=3 SV=1 2 171 1.0E-33
sp|B7LV30|URK_ESCF3 Uridine kinase OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=udk PE=3 SV=1 2 161 2.0E-33
sp|Q896E3|URK_CLOTE Uridine kinase OS=Clostridium tetani (strain Massachusetts / E88) GN=udk PE=3 SV=1 2 173 2.0E-33
sp|A6TBG6|URK_KLEP7 Uridine kinase OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=udk PE=3 SV=1 2 161 2.0E-33
sp|B5XPC8|URK_KLEP3 Uridine kinase OS=Klebsiella pneumoniae (strain 342) GN=udk PE=3 SV=1 2 161 2.0E-33
sp|Q817Z5|URK_BACCR Uridine kinase OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=udk PE=3 SV=1 2 172 3.0E-33
sp|B7HE15|URK_BACC4 Uridine kinase OS=Bacillus cereus (strain B4264) GN=udk PE=3 SV=1 2 172 3.0E-33
sp|B5BF73|URK_SALPK Uridine kinase OS=Salmonella paratyphi A (strain AKU_12601) GN=udk PE=3 SV=1 2 161 3.0E-33
sp|Q5PDX6|URK_SALPA Uridine kinase OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=udk PE=3 SV=1 2 161 3.0E-33
sp|Q081H5|URK_SHEFN Uridine kinase OS=Shewanella frigidimarina (strain NCIMB 400) GN=udk PE=3 SV=1 2 169 3.0E-33
sp|Q74KI9|URK_LACJO Uridine kinase OS=Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533) GN=udk PE=3 SV=1 2 169 3.0E-33
sp|A8H3V4|URK_SHEPA Uridine kinase OS=Shewanella pealeana (strain ATCC 700345 / ANG-SQ1) GN=udk PE=3 SV=1 2 169 3.0E-33
sp|B7IYN4|URK_BACC2 Uridine kinase OS=Bacillus cereus (strain G9842) GN=udk PE=3 SV=1 2 172 4.0E-33
sp|A4WCB6|URK_ENT38 Uridine kinase OS=Enterobacter sp. (strain 638) GN=udk PE=3 SV=1 2 161 5.0E-33
sp|B2VFR1|URK_ERWT9 Uridine kinase OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=udk PE=3 SV=1 2 161 5.0E-33
sp|C6DCI6|URK_PECCP Uridine kinase OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=udk PE=3 SV=1 2 161 6.0E-33
sp|Q9KT67|URK_VIBCH Uridine kinase OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=udk PE=3 SV=2 2 169 7.0E-33
sp|Q7MM12|URK_VIBVY Uridine kinase OS=Vibrio vulnificus (strain YJ016) GN=udk PE=3 SV=2 2 169 7.0E-33
sp|Q8D8F4|URK_VIBVU Uridine kinase OS=Vibrio vulnificus (strain CMCP6) GN=udk PE=3 SV=1 2 169 7.0E-33
sp|Q65GT3|URK_BACLD Uridine kinase OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=udk PE=3 SV=1 2 169 8.0E-33
sp|B7VLX0|URK_VIBTL Uridine kinase OS=Vibrio tasmaniensis (strain LGP32) GN=udk PE=3 SV=1 2 169 9.0E-33
sp|Q9RXZ5|URK_DEIRA Uridine kinase OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=udk PE=3 SV=1 2 165 9.0E-33
sp|Q6D7B4|URK_PECAS Uridine kinase OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=udk PE=3 SV=1 2 161 1.0E-32
sp|O13867|UPP1_SCHPO Uracil phosphoribosyltransferase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1B3.01c PE=3 SV=1 191 380 1.0E-32
sp|C0ZAS6|URK_BREBN Uridine kinase OS=Brevibacillus brevis (strain 47 / JCM 6285 / NBRC 100599) GN=udk PE=3 SV=1 2 172 1.0E-32
sp|Q87N09|URK_VIBPA Uridine kinase OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=udk PE=3 SV=1 2 169 3.0E-32
sp|A8FFL8|URK_BACP2 Uridine kinase OS=Bacillus pumilus (strain SAFR-032) GN=udk PE=3 SV=1 2 169 3.0E-32
sp|A8GC40|URK_SERP5 Uridine kinase OS=Serratia proteamaculans (strain 568) GN=udk PE=3 SV=1 2 161 4.0E-32
sp|A0Q140|URK_CLONN Uridine kinase OS=Clostridium novyi (strain NT) GN=udk PE=3 SV=1 2 171 5.0E-32
sp|B0TJ03|URK_SHEHH Uridine kinase OS=Shewanella halifaxensis (strain HAW-EB4) GN=udk PE=3 SV=1 2 169 6.0E-32
sp|B5FG51|URK_VIBFM Uridine kinase OS=Vibrio fischeri (strain MJ11) GN=udk PE=3 SV=1 2 169 6.0E-32
sp|Q5E3Z9|URK_VIBF1 Uridine kinase OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=udk PE=3 SV=1 2 169 6.0E-32
sp|C5D4Y5|URK_GEOSW Uridine kinase OS=Geobacillus sp. (strain WCH70) GN=udk PE=3 SV=1 2 173 7.0E-32
sp|B7GIU0|URK_ANOFW Uridine kinase OS=Anoxybacillus flavithermus (strain DSM 21510 / WK1) GN=udk PE=3 SV=1 2 173 1.0E-31
sp|B4ESY8|URK_PROMH Uridine kinase OS=Proteus mirabilis (strain HI4320) GN=udk PE=3 SV=1 2 161 1.0E-31
sp|Q7N6J4|URK_PHOLL Uridine kinase OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=udk PE=3 SV=1 2 161 1.0E-31
sp|B8CPI6|URK_SHEPW Uridine kinase OS=Shewanella piezotolerans (strain WP3 / JCM 13877) GN=udk PE=3 SV=1 2 169 2.0E-31
sp|B6EIY7|URK_ALISL Uridine kinase OS=Aliivibrio salmonicida (strain LFI1238) GN=udk PE=3 SV=1 2 169 2.0E-31
sp|A8YU29|URK_LACH4 Uridine kinase OS=Lactobacillus helveticus (strain DPC 4571) GN=udk PE=3 SV=1 2 169 2.0E-31
sp|P18562|UPP_YEAST Uracil phosphoribosyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FUR1 PE=1 SV=2 196 377 2.0E-31
sp|Q9CM85|URK_PASMU Uridine kinase OS=Pasteurella multocida (strain Pm70) GN=udk PE=3 SV=1 2 161 5.0E-31
sp|Q38VV6|URK_LACSS Uridine kinase OS=Lactobacillus sakei subsp. sakei (strain 23K) GN=udk PE=3 SV=1 2 169 6.0E-31
sp|Q17413|UCK_CAEEL Probable uridine-cytidine kinase OS=Caenorhabditis elegans GN=B0001.4 PE=3 SV=2 1 167 8.0E-31
sp|Q55GQ6|UPP_DICDI Uracil phosphoribosyltransferase OS=Dictyostelium discoideum GN=uprt PE=3 SV=1 194 394 1.0E-30
sp|Q4R4K2|UCK1_MACFA Uridine-cytidine kinase 1 OS=Macaca fascicularis GN=UCK1 PE=2 SV=1 2 166 2.0E-30
sp|Q8Y727|URK_LISMO Uridine kinase OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=udk PE=3 SV=1 11 169 2.0E-30
sp|B8DE13|URK_LISMH Uridine kinase OS=Listeria monocytogenes serotype 4a (strain HCC23) GN=udk PE=3 SV=1 11 169 2.0E-30
sp|Q71ZH3|URK_LISMF Uridine kinase OS=Listeria monocytogenes serotype 4b (strain F2365) GN=udk PE=3 SV=1 11 169 2.0E-30
sp|C1KVE4|URK_LISMC Uridine kinase OS=Listeria monocytogenes serotype 4b (strain CLIP80459) GN=udk PE=3 SV=1 11 169 2.0E-30
sp|B8G8N0|URK_CHLAD Uridine kinase OS=Chloroflexus aggregans (strain MD-66 / DSM 9485) GN=udk PE=3 SV=1 2 169 4.0E-30
sp|Q9PQF9|URK_UREPA Uridine kinase OS=Ureaplasma parvum serovar 3 (strain ATCC 700970) GN=udk PE=3 SV=1 2 167 7.0E-30
sp|B1AIX1|URK_UREP2 Uridine kinase OS=Ureaplasma parvum serovar 3 (strain ATCC 27815 / 27 / NCTC 11736) GN=udk PE=3 SV=1 2 167 7.0E-30
sp|Q6NYU7|UPP_DANRE Uracil phosphoribosyltransferase homolog OS=Danio rerio GN=uprt PE=2 SV=1 195 394 7.0E-30
sp|B9LED5|URK_CHLSY Uridine kinase OS=Chloroflexus aurantiacus (strain ATCC 29364 / DSM 637 / Y-400-fl) GN=udk PE=3 SV=1 2 169 9.0E-30
sp|A9WCC8|URK_CHLAA Uridine kinase OS=Chloroflexus aurantiacus (strain ATCC 29366 / DSM 635 / J-10-fl) GN=udk PE=3 SV=1 2 169 9.0E-30
sp|B5ZBE2|URK_UREU1 Uridine kinase OS=Ureaplasma urealyticum serovar 10 (strain ATCC 33699 / Western) GN=udk PE=3 SV=1 2 167 9.0E-30
sp|Q9HQC9|URK_HALSA Uridine kinase OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=udk PE=3 SV=2 1 173 9.0E-30
sp|Q5SKR5|URK_THET8 Uridine kinase OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=udk PE=1 SV=1 1 160 2.0E-29
sp|Q72L53|URK_THET2 Uridine kinase OS=Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) GN=udk PE=3 SV=1 1 160 2.0E-29
sp|A0AIU6|URK_LISW6 Uridine kinase OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=udk PE=3 SV=1 11 169 2.0E-29
sp|B5E4U6|URK_STRP4 Uridine kinase OS=Streptococcus pneumoniae serotype 19F (strain G54) GN=udk PE=3 SV=1 2 171 2.0E-29
sp|C1CXN1|URK_DEIDV Uridine kinase OS=Deinococcus deserti (strain VCD115 / DSM 17065 / LMG 22923) GN=udk PE=3 SV=1 2 161 3.0E-29
sp|A5H0J4|UPP_LACKL Uracil phosphoribosyltransferase OS=Lachancea kluyveri GN=FUR1 PE=3 SV=1 196 377 4.0E-29
sp|Q92BL6|URK_LISIN Uridine kinase OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=udk PE=3 SV=1 11 169 4.0E-29
sp|O32033|URK_BACSU Uridine kinase OS=Bacillus subtilis (strain 168) GN=udk PE=3 SV=1 2 169 4.0E-29
sp|A7Z727|URK_BACMF Uridine kinase OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=udk PE=3 SV=1 2 169 5.0E-29
sp|A1SUY9|URK_PSYIN Uridine kinase OS=Psychromonas ingrahamii (strain 37) GN=udk PE=3 SV=1 2 161 6.0E-29
sp|Q2NUC7|URK_SODGM Uridine kinase OS=Sodalis glossinidius (strain morsitans) GN=udk PE=3 SV=1 3 161 6.0E-29
sp|B1MXP1|URK_LEUCK Uridine kinase OS=Leuconostoc citreum (strain KM20) GN=udk PE=3 SV=1 2 163 2.0E-28
sp|B1AVZ0|UPP_MOUSE Uracil phosphoribosyltransferase homolog OS=Mus musculus GN=Uprt PE=1 SV=1 195 380 3.0E-28
sp|Q5ZIJ8|UPP_CHICK Uracil phosphoribosyltransferase homolog OS=Gallus gallus GN=UPRT PE=2 SV=1 191 380 4.0E-28
sp|A6TR08|URK_ALKMQ Uridine kinase OS=Alkaliphilus metalliredigens (strain QYMF) GN=udk PE=3 SV=1 2 173 4.0E-28
sp|B2G882|URK_LACRJ Uridine kinase OS=Lactobacillus reuteri (strain JCM 1112) GN=udk PE=3 SV=1 22 173 7.0E-28
sp|A5VKU8|URK_LACRD Uridine kinase OS=Lactobacillus reuteri (strain DSM 20016) GN=udk PE=3 SV=1 22 173 7.0E-28
sp|C4LEX3|URK_TOLAT Uridine kinase OS=Tolumonas auensis (strain DSM 9187 / TA4) GN=udk PE=3 SV=1 2 161 1.0E-27
sp|Q1WTY6|URK_LACS1 Uridine kinase OS=Lactobacillus salivarius (strain UCC118) GN=udk PE=3 SV=1 2 162 2.0E-27
sp|C0MCM8|URK_STRS7 Uridine kinase OS=Streptococcus equi subsp. zooepidemicus (strain H70) GN=udk PE=3 SV=1 2 161 6.0E-27
sp|B4U220|URK_STREM Uridine kinase OS=Streptococcus equi subsp. zooepidemicus (strain MGCS10565) GN=udk PE=3 SV=1 2 161 6.0E-27
sp|C0M9M0|URK_STRE4 Uridine kinase OS=Streptococcus equi subsp. equi (strain 4047) GN=udk PE=3 SV=1 2 161 6.0E-27
sp|Q96BW1|UPP_HUMAN Uracil phosphoribosyltransferase homolog OS=Homo sapiens GN=UPRT PE=1 SV=1 181 380 1.0E-26
sp|Q95KB0|UPP_MACFA Uracil phosphoribosyltransferase homolog OS=Macaca fascicularis GN=UPRT PE=2 SV=1 195 380 1.0E-26
sp|B5XM21|URK_STRPZ Uridine kinase OS=Streptococcus pyogenes serotype M49 (strain NZ131) GN=udk PE=3 SV=1 2 161 2.0E-26
sp|P0DH37|URK_STRPQ Uridine kinase OS=Streptococcus pyogenes serotype M3 (strain SSI-1) GN=udk PE=3 SV=1 2 161 2.0E-26
sp|A2RDZ9|URK_STRPG Uridine kinase OS=Streptococcus pyogenes serotype M5 (strain Manfredo) GN=udk PE=3 SV=1 2 161 2.0E-26
sp|Q5XBI8|URK_STRP6 Uridine kinase OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) GN=udk PE=1 SV=2 2 161 2.0E-26
sp|P0DH36|URK_STRP3 Uridine kinase OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) GN=udk PE=3 SV=1 2 161 2.0E-26
sp|P67415|URK_STRP1 Uridine kinase OS=Streptococcus pyogenes serotype M1 GN=udk PE=3 SV=1 2 161 2.0E-26
sp|Q8P0F8|URK_STRP8 Uridine kinase OS=Streptococcus pyogenes serotype M18 (strain MGAS8232) GN=udk PE=3 SV=1 2 161 2.0E-26
sp|Q9CF21|URK_LACLA Uridine kinase OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=udk PE=3 SV=1 2 165 2.0E-26
sp|A1QYG8|URK_BORT9 Uridine kinase OS=Borrelia turicatae (strain 91E135) GN=udk PE=3 SV=1 2 165 2.0E-26
sp|Q02XK6|URK_LACLS Uridine kinase OS=Lactococcus lactis subsp. cremoris (strain SK11) GN=udk PE=3 SV=1 2 165 3.0E-26
sp|A2RJB4|URK_LACLM Uridine kinase OS=Lactococcus lactis subsp. cremoris (strain MG1363) GN=udk PE=3 SV=1 2 165 3.0E-26
sp|Q662Z7|URK_BORBP Uridine kinase OS=Borrelia bavariensis (strain ATCC BAA-2496 / DSM 23469 / PBi) GN=udk PE=3 SV=1 2 166 5.0E-26
sp|B2S1K4|URK_BORHD Uridine kinase OS=Borrelia hermsii (strain HS1 / DAH) GN=udk PE=3 SV=1 2 165 5.0E-26
sp|Q32LA4|UPP_BOVIN Uracil phosphoribosyltransferase homolog OS=Bos taurus GN=UPRT PE=2 SV=1 195 380 6.0E-26
sp|B5RQJ8|URK_BORRA Uridine kinase OS=Borrelia recurrentis (strain A1) GN=udk PE=3 SV=1 2 166 8.0E-26
sp|B5RLM3|URK_BORDL Uridine kinase OS=Borrelia duttonii (strain Ly) GN=udk PE=3 SV=1 2 166 8.0E-26
sp|Q03K46|URK_STRTD Uridine kinase OS=Streptococcus thermophilus (strain ATCC BAA-491 / LMD-9) GN=udk PE=3 SV=1 2 161 8.0E-26
sp|Q5M3V0|URK_STRT2 Uridine kinase OS=Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311) GN=udk PE=3 SV=1 2 161 8.0E-26
sp|Q5LZ98|URK_STRT1 Uridine kinase OS=Streptococcus thermophilus (strain CNRZ 1066) GN=udk PE=3 SV=1 2 161 8.0E-26
sp|Q0SPE9|URK_BORAP Uridine kinase OS=Borrelia afzelii (strain PKo) GN=udk PE=3 SV=1 2 166 8.0E-26
sp|B9DSN2|URK_STRU0 Uridine kinase OS=Streptococcus uberis (strain ATCC BAA-854 / 0140J) GN=udk PE=3 SV=1 2 161 9.0E-26
sp|Q8DTG1|URK_STRMU Uridine kinase OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=udk PE=3 SV=1 2 161 1.0E-25
sp|P75217|URK_MYCPN Uridine kinase OS=Mycoplasma pneumoniae (strain ATCC 29342 / M129) GN=udk PE=3 SV=1 2 172 2.0E-25
sp|Q8E0A8|URK_STRA5 Uridine kinase OS=Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R) GN=udk PE=3 SV=1 2 161 3.0E-25
sp|Q3K1N1|URK_STRA1 Uridine kinase OS=Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700) GN=udk PE=3 SV=1 2 161 3.0E-25
sp|Q8E5Y5|URK_STRA3 Uridine kinase OS=Streptococcus agalactiae serotype III (strain NEM316) GN=udk PE=3 SV=1 2 161 4.0E-25
sp|A4IR72|URK_GEOTN Uridine kinase OS=Geobacillus thermodenitrificans (strain NG80-2) GN=udk PE=3 SV=1 2 174 3.0E-24
sp|Q88WR0|URK_LACPL Uridine kinase OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=udk PE=3 SV=1 2 161 3.0E-24
sp|Q5KWV3|URK_GEOKA Uridine kinase OS=Geobacillus kaustophilus (strain HTA426) GN=udk PE=3 SV=1 2 174 1.0E-23
sp|B7J0V4|URK_BORBZ Uridine kinase OS=Borrelia burgdorferi (strain ZS7) GN=udk PE=3 SV=1 2 166 4.0E-23
sp|Q59190|URK_BORBU Uridine kinase OS=Borrelia burgdorferi (strain ATCC 35210 / B31 / CIP 102532 / DSM 4680) GN=udk PE=1 SV=3 2 166 4.0E-23
sp|P47622|URK_MYCGE Uridine kinase OS=Mycoplasma genitalium (strain ATCC 33530 / G-37 / NCTC 10195) GN=udk PE=3 SV=1 2 174 1.0E-22
sp|Q7VL27|URK_HAEDU Uridine kinase OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=udk PE=3 SV=1 2 172 2.0E-22
sp|Q9Z7H0|URK_CHLPN Uridine kinase OS=Chlamydia pneumoniae GN=udk PE=3 SV=1 23 169 5.0E-22
sp|P19824|KPPR_CHLRE Phosphoribulokinase, chloroplastic OS=Chlamydomonas reinhardtii GN=PRKA PE=1 SV=1 25 172 3.0E-19
sp|Q9HE15|UPP2_SCHPO Uracil phosphoribosyltransferase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1399.04c PE=3 SV=1 189 380 9.0E-18
sp|Q7M8H6|UPP_WOLSU Uracil phosphoribosyltransferase OS=Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / LMG 7466 / NCTC 11488 / FDC 602W) GN=upp PE=3 SV=1 203 394 3.0E-17
sp|P09559|KPPR_SPIOL Phosphoribulokinase, chloroplastic OS=Spinacia oleracea PE=1 SV=1 26 148 3.0E-17
sp|P26302|KPPR_WHEAT Phosphoribulokinase, chloroplastic OS=Triticum aestivum PE=2 SV=1 26 148 2.0E-16
sp|P27774|KPPR_MESCR Phosphoribulokinase, chloroplastic OS=Mesembryanthemum crystallinum PE=2 SV=1 26 148 9.0E-16
sp|Q8RG35|UPP_FUSNN Uracil phosphoribosyltransferase OS=Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / CIP 101130 / JCM 8532 / LMG 13131) GN=upp PE=3 SV=2 203 380 2.0E-15
sp|P25697|KPPR_ARATH Phosphoribulokinase, chloroplastic OS=Arabidopsis thaliana GN=At1g32060 PE=2 SV=1 26 148 3.0E-15
sp|P37101|KPPR_SYNY3 Phosphoribulokinase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=prk PE=2 SV=1 26 173 6.0E-15
sp|B2A3H5|UPP_NATTJ Uracil phosphoribosyltransferase OS=Natranaerobius thermophilus (strain ATCC BAA-1301 / DSM 18059 / JW/NM-WN-LF) GN=upp PE=3 SV=1 201 394 5.0E-14
sp|B8E009|UPP_DICTD Uracil phosphoribosyltransferase OS=Dictyoglomus turgidum (strain Z-1310 / DSM 6724) GN=upp PE=3 SV=1 196 380 6.0E-14
sp|Q04DP1|UPP_OENOB Uracil phosphoribosyltransferase OS=Oenococcus oeni (strain ATCC BAA-331 / PSU-1) GN=upp PE=3 SV=1 211 375 7.0E-14
sp|C4KYT2|UPP_EXISA Uracil phosphoribosyltransferase OS=Exiguobacterium sp. (strain ATCC BAA-1283 / AT1b) GN=upp PE=3 SV=1 201 375 1.0E-13
sp|B8I567|UPP_CLOCE Uracil phosphoribosyltransferase OS=Clostridium cellulolyticum (strain ATCC 35319 / DSM 5812 / JCM 6584 / H10) GN=upp PE=3 SV=1 201 375 2.0E-13
sp|B5YDB8|UPP_DICT6 Uracil phosphoribosyltransferase OS=Dictyoglomus thermophilum (strain ATCC 35947 / DSM 3960 / H-6-12) GN=upp PE=3 SV=1 196 380 3.0E-13
sp|Q03EK5|UPP_PEDPA Uracil phosphoribosyltransferase OS=Pediococcus pentosaceus (strain ATCC 25745 / 183-1w) GN=upp PE=3 SV=1 201 375 7.0E-13
sp|A7ZFB7|UPP_CAMC1 Uracil phosphoribosyltransferase OS=Campylobacter concisus (strain 13826) GN=upp PE=3 SV=1 210 393 7.0E-13
sp|B1YEG7|UPP_EXIS2 Uracil phosphoribosyltransferase OS=Exiguobacterium sibiricum (strain DSM 17290 / JCM 13490 / 255-15) GN=upp PE=3 SV=1 201 380 7.0E-13
sp|Q898X9|UPP_CLOTE Uracil phosphoribosyltransferase OS=Clostridium tetani (strain Massachusetts / E88) GN=upp PE=3 SV=1 210 380 8.0E-13
sp|A6TK51|UPP_ALKMQ Uracil phosphoribosyltransferase OS=Alkaliphilus metalliredigens (strain QYMF) GN=upp PE=3 SV=1 201 380 1.0E-12
sp|C4Z9S1|UPP_EUBR3 Uracil phosphoribosyltransferase OS=Eubacterium rectale (strain ATCC 33656 / VPI 0990) GN=upp PE=3 SV=1 197 377 2.0E-12
sp|A7H0F9|UPP_CAMC5 Uracil phosphoribosyltransferase OS=Campylobacter curvus (strain 525.92) GN=upp PE=3 SV=1 211 393 3.0E-12
sp|Q5SIQ7|UPP_THET8 Uracil phosphoribosyltransferase OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=upp PE=3 SV=1 197 380 4.0E-12
sp|Q72J35|UPP_THET2 Uracil phosphoribosyltransferase OS=Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) GN=upp PE=1 SV=1 197 380 4.0E-12
sp|A8MJX1|UPP_ALKOO Uracil phosphoribosyltransferase OS=Alkaliphilus oremlandii (strain OhILAs) GN=upp PE=3 SV=1 201 380 4.0E-12
sp|Q927V5|UPP_LISIN Uracil phosphoribosyltransferase OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=upp PE=3 SV=1 203 395 5.0E-12
sp|A0ALM3|UPP_LISW6 Uracil phosphoribosyltransferase OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=upp PE=3 SV=1 203 395 8.0E-12
sp|Q8Y4B3|UPP_LISMO Uracil phosphoribosyltransferase OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=upp PE=3 SV=1 203 395 8.0E-12
sp|B8DBH1|UPP_LISMH Uracil phosphoribosyltransferase OS=Listeria monocytogenes serotype 4a (strain HCC23) GN=upp PE=3 SV=1 203 395 8.0E-12
sp|Q71WP0|UPP_LISMF Uracil phosphoribosyltransferase OS=Listeria monocytogenes serotype 4b (strain F2365) GN=upp PE=3 SV=1 203 395 8.0E-12
sp|C1KYV5|UPP_LISMC Uracil phosphoribosyltransferase OS=Listeria monocytogenes serotype 4b (strain CLIP80459) GN=upp PE=3 SV=1 203 395 8.0E-12
sp|A0Q306|UPP_CLONN Uracil phosphoribosyltransferase OS=Clostridium novyi (strain NT) GN=upp PE=3 SV=1 210 394 9.0E-12
sp|Q042K8|UPP_LACGA Uracil phosphoribosyltransferase OS=Lactobacillus gasseri (strain ATCC 33323 / DSM 20243 / JCM 1131 / NCIMB 11718 / AM63) GN=upp PE=3 SV=1 203 394 1.0E-11
sp|A0RR59|UPP_CAMFF Uracil phosphoribosyltransferase OS=Campylobacter fetus subsp. fetus (strain 82-40) GN=upp PE=3 SV=1 210 380 1.0E-11
sp|Q5WB67|UPP_BACSK Uracil phosphoribosyltransferase OS=Bacillus clausii (strain KSM-K16) GN=upp PE=3 SV=1 201 394 1.0E-11
sp|A5N3J1|UPP_CLOK5 Uracil phosphoribosyltransferase OS=Clostridium kluyveri (strain ATCC 8527 / DSM 555 / NCIMB 10680) GN=upp PE=3 SV=1 211 380 2.0E-11
sp|B9DX75|UPP_CLOK1 Uracil phosphoribosyltransferase OS=Clostridium kluyveri (strain NBRC 12016) GN=upp PE=3 SV=1 211 380 2.0E-11
sp|B3WDL1|UPP_LACCB Uracil phosphoribosyltransferase OS=Lactobacillus casei (strain BL23) GN=upp PE=3 SV=1 203 375 2.0E-11
sp|Q03A25|UPP_LACC3 Uracil phosphoribosyltransferase OS=Lactobacillus casei (strain ATCC 334) GN=upp PE=3 SV=1 203 375 2.0E-11
sp|P43049|UPP_MYCHO Uracil phosphoribosyltransferase OS=Mycoplasma hominis GN=upp PE=3 SV=1 203 394 2.0E-11
sp|B0S2A9|UPP_FINM2 Uracil phosphoribosyltransferase OS=Finegoldia magna (strain ATCC 29328) GN=upp PE=3 SV=1 201 380 2.0E-11
sp|Q9K6G5|UPP_BACHD Uracil phosphoribosyltransferase OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=upp PE=3 SV=1 201 394 3.0E-11
sp|Q03M79|UPP_STRTD Uracil phosphoribosyltransferase OS=Streptococcus thermophilus (strain ATCC BAA-491 / LMD-9) GN=upp PE=3 SV=1 203 394 3.0E-11
sp|Q5M5U5|UPP_STRT2 Uracil phosphoribosyltransferase OS=Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311) GN=upp PE=3 SV=1 203 394 3.0E-11
sp|Q5M1A9|UPP_STRT1 Uracil phosphoribosyltransferase OS=Streptococcus thermophilus (strain CNRZ 1066) GN=upp PE=3 SV=1 203 394 3.0E-11
sp|A3DIL9|UPP_CLOTH Uracil phosphoribosyltransferase OS=Clostridium thermocellum (strain ATCC 27405 / DSM 1237 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) GN=upp PE=3 SV=1 201 384 4.0E-11
sp|B2GAT5|UPP_LACF3 Uracil phosphoribosyltransferase OS=Lactobacillus fermentum (strain NBRC 3956 / LMG 18251) GN=upp PE=3 SV=1 201 375 4.0E-11
sp|P36399|UPP_STRSL Uracil phosphoribosyltransferase OS=Streptococcus salivarius GN=upp PE=3 SV=1 203 380 5.0E-11
sp|Q8DST6|UPP_STRMU Uracil phosphoribosyltransferase OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=upp PE=3 SV=1 203 394 5.0E-11
sp|A4VWM9|UPP_STRSY Uracil phosphoribosyltransferase OS=Streptococcus suis (strain 05ZYH33) GN=upp PE=3 SV=1 203 394 6.0E-11
sp|Q97RQ3|UPP_STRPN Uracil phosphoribosyltransferase OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=upp PE=3 SV=1 203 394 6.0E-11
sp|B1VF60|UPP_CORU7 Uracil phosphoribosyltransferase OS=Corynebacterium urealyticum (strain ATCC 43042 / DSM 7109) GN=upp PE=3 SV=1 210 368 7.0E-11
sp|Q8DQI3|UPP_STRR6 Uracil phosphoribosyltransferase OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=upp PE=3 SV=2 203 394 8.0E-11
sp|Q38WJ8|UPP_LACSS Uracil phosphoribosyltransferase OS=Lactobacillus sakei subsp. sakei (strain 23K) GN=upp PE=3 SV=1 203 375 8.0E-11
sp|Q93CX7|UPP_LACSK Uracil phosphoribosyltransferase OS=Lactobacillus sakei GN=upp PE=3 SV=1 203 375 8.0E-11
sp|Q04BB0|UPP_LACDB Uracil phosphoribosyltransferase OS=Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC BAA-365) GN=upp PE=3 SV=1 203 375 9.0E-11
sp|Q1GAX2|UPP_LACDA Uracil phosphoribosyltransferase OS=Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC 11842 / DSM 20081 / JCM 1002 / NBRC 13953 / NCIMB 11778) GN=upp PE=3 SV=1 203 375 9.0E-11
sp|B1KSR7|UPP_CLOBM Uracil phosphoribosyltransferase OS=Clostridium botulinum (strain Loch Maree / Type A3) GN=upp PE=3 SV=1 210 394 9.0E-11
sp|A7G9P8|UPP_CLOBL Uracil phosphoribosyltransferase OS=Clostridium botulinum (strain Langeland / NCTC 10281 / Type F) GN=upp PE=3 SV=1 210 394 9.0E-11
sp|B1IE69|UPP_CLOBK Uracil phosphoribosyltransferase OS=Clostridium botulinum (strain Okra / Type B1) GN=upp PE=3 SV=1 210 394 9.0E-11
sp|C1FQA3|UPP_CLOBJ Uracil phosphoribosyltransferase OS=Clostridium botulinum (strain Kyoto / Type A2) GN=upp PE=3 SV=1 210 394 9.0E-11
sp|A5HY41|UPP_CLOBH Uracil phosphoribosyltransferase OS=Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A) GN=upp PE=3 SV=1 210 394 9.0E-11
sp|C3KYI1|UPP_CLOB6 Uracil phosphoribosyltransferase OS=Clostridium botulinum (strain 657 / Type Ba4) GN=upp PE=3 SV=1 210 394 9.0E-11
sp|A7FQG8|UPP_CLOB1 Uracil phosphoribosyltransferase OS=Clostridium botulinum (strain ATCC 19397 / Type A) GN=upp PE=3 SV=1 210 394 9.0E-11
sp|P70881|UPP_BACCL Uracil phosphoribosyltransferase OS=Bacillus caldolyticus GN=upp PE=1 SV=2 201 380 9.0E-11
sp|B2G680|UPP_LACRJ Uracil phosphoribosyltransferase OS=Lactobacillus reuteri (strain JCM 1112) GN=upp PE=3 SV=1 201 375 1.0E-10
sp|A5VIQ0|UPP_LACRD Uracil phosphoribosyltransferase OS=Lactobacillus reuteri (strain DSM 20016) GN=upp PE=3 SV=1 201 375 1.0E-10
sp|Q6HAX0|UPP_BACHK Uracil phosphoribosyltransferase OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=upp PE=3 SV=1 201 380 1.0E-10
sp|Q630T4|UPP_BACCZ Uracil phosphoribosyltransferase OS=Bacillus cereus (strain ZK / E33L) GN=upp PE=3 SV=1 201 380 1.0E-10
sp|Q814V3|UPP_BACCR Uracil phosphoribosyltransferase OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=upp PE=3 SV=1 201 380 1.0E-10
sp|B9IRU7|UPP_BACCQ Uracil phosphoribosyltransferase OS=Bacillus cereus (strain Q1) GN=upp PE=3 SV=1 201 380 1.0E-10
sp|B7HY75|UPP_BACC7 Uracil phosphoribosyltransferase OS=Bacillus cereus (strain AH187) GN=upp PE=3 SV=1 201 380 1.0E-10
sp|B7HFL2|UPP_BACC4 Uracil phosphoribosyltransferase OS=Bacillus cereus (strain B4264) GN=upp PE=3 SV=1 201 380 1.0E-10
sp|C1F0N8|UPP_BACC3 Uracil phosphoribosyltransferase OS=Bacillus cereus (strain 03BB102) GN=upp PE=3 SV=1 201 380 1.0E-10
sp|B7IQW8|UPP_BACC2 Uracil phosphoribosyltransferase OS=Bacillus cereus (strain G9842) GN=upp PE=3 SV=1 201 380 1.0E-10
sp|Q72XD8|UPP_BACC1 Uracil phosphoribosyltransferase OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=upp PE=3 SV=1 201 380 1.0E-10
sp|B7JGP0|UPP_BACC0 Uracil phosphoribosyltransferase OS=Bacillus cereus (strain AH820) GN=upp PE=3 SV=1 201 380 1.0E-10
sp|Q81JY5|UPP_BACAN Uracil phosphoribosyltransferase OS=Bacillus anthracis GN=upp PE=3 SV=1 201 380 1.0E-10
sp|C3LFI9|UPP_BACAC Uracil phosphoribosyltransferase OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=upp PE=3 SV=1 201 380 1.0E-10
sp|C3P1G4|UPP_BACAA Uracil phosphoribosyltransferase OS=Bacillus anthracis (strain A0248) GN=upp PE=3 SV=1 201 380 1.0E-10
sp|C0MGT4|UPP_STRS7 Uracil phosphoribosyltransferase OS=Streptococcus equi subsp. zooepidemicus (strain H70) GN=upp PE=3 SV=1 203 375 1.0E-10
sp|B4U4M9|UPP_STREM Uracil phosphoribosyltransferase OS=Streptococcus equi subsp. zooepidemicus (strain MGCS10565) GN=upp PE=3 SV=1 203 375 1.0E-10
sp|C0M7M9|UPP_STRE4 Uracil phosphoribosyltransferase OS=Streptococcus equi subsp. equi (strain 4047) GN=upp PE=3 SV=1 203 375 1.0E-10
sp|A3CPK9|UPP_STRSV Uracil phosphoribosyltransferase OS=Streptococcus sanguinis (strain SK36) GN=upp PE=3 SV=1 203 375 1.0E-10
sp|A8AYQ0|UPP_STRGC Uracil phosphoribosyltransferase OS=Streptococcus gordonii (strain Challis / ATCC 35105 / CH1 / DL1 / V288) GN=upp PE=3 SV=1 203 375 1.0E-10
sp|A9VSB3|UPP_BACWK Uracil phosphoribosyltransferase OS=Bacillus weihenstephanensis (strain KBAB4) GN=upp PE=3 SV=1 201 380 1.0E-10
sp|A0RLA2|UPP_BACAH Uracil phosphoribosyltransferase OS=Bacillus thuringiensis (strain Al Hakam) GN=upp PE=3 SV=1 201 380 1.0E-10
sp|P0DH35|UPP_STRPQ Uracil phosphoribosyltransferase OS=Streptococcus pyogenes serotype M3 (strain SSI-1) GN=upp PE=3 SV=1 203 375 1.0E-10
sp|Q48V26|UPP_STRPM Uracil phosphoribosyltransferase OS=Streptococcus pyogenes serotype M28 (strain MGAS6180) GN=upp PE=3 SV=1 203 375 1.0E-10
sp|A2RG73|UPP_STRPG Uracil phosphoribosyltransferase OS=Streptococcus pyogenes serotype M5 (strain Manfredo) GN=upp PE=3 SV=1 203 375 1.0E-10
sp|Q1J888|UPP_STRPF Uracil phosphoribosyltransferase OS=Streptococcus pyogenes serotype M4 (strain MGAS10750) GN=upp PE=3 SV=1 203 375 1.0E-10
sp|Q1JID6|UPP_STRPD Uracil phosphoribosyltransferase OS=Streptococcus pyogenes serotype M2 (strain MGAS10270) GN=upp PE=3 SV=1 203 375 1.0E-10
sp|Q1JN85|UPP_STRPC Uracil phosphoribosyltransferase OS=Streptococcus pyogenes serotype M12 (strain MGAS9429) GN=upp PE=3 SV=1 203 375 1.0E-10
sp|P67402|UPP_STRP8 Uracil phosphoribosyltransferase OS=Streptococcus pyogenes serotype M18 (strain MGAS8232) GN=upp PE=3 SV=1 203 375 1.0E-10
sp|Q5XDM5|UPP_STRP6 Uracil phosphoribosyltransferase OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) GN=upp PE=3 SV=1 203 375 1.0E-10
sp|P0DH34|UPP_STRP3 Uracil phosphoribosyltransferase OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) GN=upp PE=3 SV=1 203 375 1.0E-10
sp|P67400|UPP_STRP1 Uracil phosphoribosyltransferase OS=Streptococcus pyogenes serotype M1 GN=upp PE=3 SV=1 203 375 1.0E-10
sp|B5XJZ7|UPP_STRPZ Uracil phosphoribosyltransferase OS=Streptococcus pyogenes serotype M49 (strain NZ131) GN=upp PE=3 SV=1 203 375 2.0E-10
sp|Q831G0|UPP_ENTFA Uracil phosphoribosyltransferase OS=Enterococcus faecalis (strain ATCC 700802 / V583) GN=upp PE=3 SV=1 201 394 2.0E-10
sp|Q5KUI3|UPP_GEOKA Uracil phosphoribosyltransferase OS=Geobacillus kaustophilus (strain HTA426) GN=upp PE=3 SV=1 201 380 2.0E-10
sp|Q180X8|UPP_PEPD6 Uracil phosphoribosyltransferase OS=Peptoclostridium difficile (strain 630) GN=upp PE=3 SV=1 203 394 3.0E-10
sp|O67914|UPP_AQUAE Uracil phosphoribosyltransferase OS=Aquifex aeolicus (strain VF5) GN=upp PE=1 SV=1 216 380 4.0E-10
sp|Q2S320|UPP_SALRD Uracil phosphoribosyltransferase OS=Salinibacter ruber (strain DSM 13855 / M31) GN=upp PE=3 SV=1 201 378 5.0E-10
sp|B3PM96|UPP_MYCA5 Uracil phosphoribosyltransferase OS=Mycoplasma arthritidis (strain 158L3-1) GN=upp PE=3 SV=1 196 394 5.0E-10
sp|Q2ST42|UPP_MYCCT Uracil phosphoribosyltransferase OS=Mycoplasma capricolum subsp. capricolum (strain California kid / ATCC 27343 / NCTC 10154) GN=upp PE=3 SV=1 210 394 5.0E-10
sp|Q6KHA6|UPP_MYCMO Uracil phosphoribosyltransferase OS=Mycoplasma mobile (strain ATCC 43663 / 163K / NCTC 11711) GN=upp PE=3 SV=1 203 375 6.0E-10
sp|B9DTU7|UPP_STRU0 Uracil phosphoribosyltransferase OS=Streptococcus uberis (strain ATCC BAA-854 / 0140J) GN=upp PE=3 SV=1 203 375 6.0E-10
sp|A7GV65|UPP_BACCN Uracil phosphoribosyltransferase OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=upp PE=3 SV=1 201 380 6.0E-10
sp|Q1WUD3|UPP_LACS1 Uracil phosphoribosyltransferase OS=Lactobacillus salivarius (strain UCC118) GN=upp PE=3 SV=1 201 375 6.0E-10
sp|Q54R62|UCKC_DICDI Uridine-cytidine kinase C OS=Dictyostelium discoideum GN=udkC PE=3 SV=1 20 174 7.0E-10
sp|B5ZAU8|UPP_UREU1 Uracil phosphoribosyltransferase OS=Ureaplasma urealyticum serovar 10 (strain ATCC 33699 / Western) GN=upp PE=3 SV=1 210 378 8.0E-10
sp|Q65DW6|UPP_BACLD Uracil phosphoribosyltransferase OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=upp PE=3 SV=1 201 394 1.0E-09
sp|P67399|UPP_STRA5 Uracil phosphoribosyltransferase OS=Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R) GN=upp PE=3 SV=1 203 375 1.0E-09
sp|P67398|UPP_STRA3 Uracil phosphoribosyltransferase OS=Streptococcus agalactiae serotype III (strain NEM316) GN=upp PE=3 SV=1 203 375 1.0E-09
sp|Q3JZU9|UPP_STRA1 Uracil phosphoribosyltransferase OS=Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700) GN=upp PE=3 SV=1 203 375 1.0E-09
sp|B9DMF2|UPP_STACT Uracil phosphoribosyltransferase OS=Staphylococcus carnosus (strain TM300) GN=upp PE=3 SV=1 201 380 1.0E-09
sp|A8FIC0|UPP_BACP2 Uracil phosphoribosyltransferase OS=Bacillus pumilus (strain SAFR-032) GN=upp PE=3 SV=1 201 394 1.0E-09
sp|Q98QP6|UPP_MYCPU Uracil phosphoribosyltransferase OS=Mycoplasma pulmonis (strain UAB CTIP) GN=upp PE=3 SV=1 229 345 1.0E-09
sp|Q9CEC9|UPP_LACLA Uracil phosphoribosyltransferase OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=upp PE=3 SV=1 203 375 1.0E-09
sp|Q4JAV0|UPP_SULAC Uracil phosphoribosyltransferase OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=upp PE=3 SV=1 228 387 1.0E-09
sp|P50926|UPP_LACLM Uracil phosphoribosyltransferase OS=Lactococcus lactis subsp. cremoris (strain MG1363) GN=upp PE=3 SV=1 203 375 2.0E-09
sp|Q8EM74|UPP_OCEIH Uracil phosphoribosyltransferase OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=upp PE=3 SV=1 201 394 2.0E-09
sp|Q03QY1|UPP_LACBA Uracil phosphoribosyltransferase OS=Lactobacillus brevis (strain ATCC 367 / JCM 1170) GN=upp PE=3 SV=1 201 375 2.0E-09
sp|Q9RU32|UPP_DEIRA Uracil phosphoribosyltransferase OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=upp PE=3 SV=1 196 380 2.0E-09
sp|Q9RE01|UPP_LACPL Uracil phosphoribosyltransferase OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=upp PE=3 SV=1 201 375 2.0E-09
sp|Q02WM7|UPP_LACLS Uracil phosphoribosyltransferase OS=Lactococcus lactis subsp. cremoris (strain SK11) GN=upp PE=3 SV=1 203 375 2.0E-09
sp|Q9RGY8|UPP_LACAC Uracil phosphoribosyltransferase OS=Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM) GN=upp PE=3 SV=2 197 394 2.0E-09
sp|Q8XIC4|UPP_CLOPE Uracil phosphoribosyltransferase OS=Clostridium perfringens (strain 13 / Type A) GN=upp PE=3 SV=1 212 380 2.0E-09
sp|Q0TNB4|UPP_CLOP1 Uracil phosphoribosyltransferase OS=Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) GN=upp PE=3 SV=1 212 380 2.0E-09
sp|Q8EUA1|UPP_MYCPE Uracil phosphoribosyltransferase OS=Mycoplasma penetrans (strain HF-2) GN=upp PE=3 SV=1 201 394 3.0E-09
sp|A9KIB0|UPP_CLOPH Uracil phosphoribosyltransferase OS=Clostridium phytofermentans (strain ATCC 700394 / DSM 18823 / ISDg) GN=upp PE=3 SV=1 201 394 3.0E-09
sp|Q0SQY5|UPP_CLOPS Uracil phosphoribosyltransferase OS=Clostridium perfringens (strain SM101 / Type A) GN=upp PE=3 SV=1 212 380 3.0E-09
sp|A8YUJ4|UPP_LACH4 Uracil phosphoribosyltransferase OS=Lactobacillus helveticus (strain DPC 4571) GN=upp PE=3 SV=1 197 394 3.0E-09
sp|B2TJY9|UPP_CLOBB Uracil phosphoribosyltransferase OS=Clostridium botulinum (strain Eklund 17B / Type B) GN=upp PE=3 SV=1 210 394 4.0E-09
sp|B2UZI9|UPP_CLOBA Uracil phosphoribosyltransferase OS=Clostridium botulinum (strain Alaska E43 / Type E3) GN=upp PE=3 SV=1 210 394 4.0E-09
sp|C5D9M4|UPP_GEOSW Uracil phosphoribosyltransferase OS=Geobacillus sp. (strain WCH70) GN=upp PE=3 SV=1 201 380 4.0E-09
sp|Q97F73|UPP_CLOAB Uracil phosphoribosyltransferase OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=upp PE=3 SV=1 204 380 4.0E-09
sp|B0K1G2|UPP_THEPX Uracil phosphoribosyltransferase OS=Thermoanaerobacter sp. (strain X514) GN=upp PE=3 SV=1 201 380 5.0E-09
sp|B0K7G1|UPP_THEP3 Uracil phosphoribosyltransferase OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) GN=upp PE=3 SV=1 201 380 5.0E-09
sp|C0Z818|UPP_BREBN Uracil phosphoribosyltransferase OS=Brevibacillus brevis (strain 47 / JCM 6285 / NBRC 100599) GN=upp PE=3 SV=1 201 380 5.0E-09
sp|B9E8F4|UPP_MACCJ Uracil phosphoribosyltransferase OS=Macrococcus caseolyticus (strain JCSC5402) GN=upp PE=3 SV=1 201 380 5.0E-09
sp|Q9PR28|UPP_UREPA Uracil phosphoribosyltransferase OS=Ureaplasma parvum serovar 3 (strain ATCC 700970) GN=upp PE=3 SV=1 210 378 6.0E-09
sp|B1AIA5|UPP_UREP2 Uracil phosphoribosyltransferase OS=Ureaplasma parvum serovar 3 (strain ATCC 27815 / 27 / NCTC 11736) GN=upp PE=3 SV=1 210 378 6.0E-09
sp|Q8FUZ2|UPP_BRUSU Uracil phosphoribosyltransferase OS=Brucella suis biovar 1 (strain 1330) GN=upp PE=3 SV=2 203 394 7.0E-09
sp|A9WW75|UPP_BRUSI Uracil phosphoribosyltransferase OS=Brucella suis (strain ATCC 23445 / NCTC 10510) GN=upp PE=3 SV=1 203 394 7.0E-09
sp|A9MCZ3|UPP_BRUC2 Uracil phosphoribosyltransferase OS=Brucella canis (strain ATCC 23365 / NCTC 10854) GN=upp PE=3 SV=1 203 394 7.0E-09
sp|A5VVW9|UPP_BRUO2 Uracil phosphoribosyltransferase OS=Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512) GN=upp PE=3 SV=1 203 394 7.0E-09
sp|Q6MS86|UPP_MYCMS Uracil phosphoribosyltransferase OS=Mycoplasma mycoides subsp. mycoides SC (strain PG1) GN=upp PE=3 SV=2 210 394 8.0E-09
sp|Q9PJJ6|UPP_CHLMU Uracil phosphoribosyltransferase OS=Chlamydia muridarum (strain MoPn / Nigg) GN=upp PE=3 SV=1 170 394 8.0E-09
sp|Q8RD94|UPP_CALS4 Uracil phosphoribosyltransferase OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=upp PE=3 SV=1 201 380 9.0E-09
sp|Q67TC9|UPP_SYMTH Uracil phosphoribosyltransferase OS=Symbiobacterium thermophilum (strain T / IAM 14863) GN=upp PE=3 SV=1 195 375 1.0E-08
sp|A7Z9Q8|UPP_BACMF Uracil phosphoribosyltransferase OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=upp PE=3 SV=1 201 345 1.0E-08
sp|B0TI63|UPP_HELMI Uracil phosphoribosyltransferase OS=Heliobacterium modesticaldum (strain ATCC 51547 / Ice1) GN=upp PE=3 SV=1 195 375 1.0E-08
sp|B7IDR9|UPP_THEAB Uracil phosphoribosyltransferase OS=Thermosipho africanus (strain TCF52B) GN=upp PE=3 SV=1 201 380 1.0E-08
sp|Q975Z7|UPP_SULTO Uracil phosphoribosyltransferase OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=upp PE=3 SV=1 200 387 1.0E-08
sp|B7GMG3|UPP_ANOFW Uracil phosphoribosyltransferase OS=Anoxybacillus flavithermus (strain DSM 21510 / WK1) GN=upp PE=3 SV=1 201 380 2.0E-08
sp|B1HM47|UPP_LYSSC Uracil phosphoribosyltransferase OS=Lysinibacillus sphaericus (strain C3-41) GN=upp PE=3 SV=1 201 345 2.0E-08
sp|P39149|UPP_BACSU Uracil phosphoribosyltransferase OS=Bacillus subtilis (strain 168) GN=upp PE=3 SV=1 201 345 3.0E-08
sp|A9NEQ2|UPP_ACHLI Uracil phosphoribosyltransferase OS=Acholeplasma laidlawii (strain PG-8A) GN=upp PE=3 SV=1 197 375 3.0E-08
sp|Q6F210|UPP_MESFL Uracil phosphoribosyltransferase OS=Mesoplasma florum (strain ATCC 33453 / NBRC 100688 / NCTC 11704 / L1) GN=upp PE=3 SV=1 216 394 4.0E-08
sp|B1L7Y5|UPP_THESQ Uracil phosphoribosyltransferase OS=Thermotoga sp. (strain RQ2) GN=upp PE=3 SV=1 197 380 4.0E-08
sp|A5IJ64|UPP_THEP1 Uracil phosphoribosyltransferase OS=Thermotoga petrophila (strain RKU-1 / ATCC BAA-488 / DSM 13995) GN=upp PE=3 SV=1 197 380 4.0E-08
sp|Q9WZI0|UPP_THEMA Uracil phosphoribosyltransferase OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=upp PE=1 SV=1 197 380 4.0E-08
sp|Q576P9|UPP_BRUAB Uracil phosphoribosyltransferase OS=Brucella abortus biovar 1 (strain 9-941) GN=upp PE=3 SV=1 203 380 4.0E-08
sp|B2SC51|UPP_BRUA1 Uracil phosphoribosyltransferase OS=Brucella abortus (strain S19) GN=upp PE=3 SV=1 203 380 4.0E-08
sp|A6WYH9|UPP_OCHA4 Uracil phosphoribosyltransferase OS=Ochrobactrum anthropi (strain ATCC 49188 / DSM 6882 / NCTC 12168) GN=upp PE=3 SV=1 203 394 4.0E-08
sp|Q8YDE5|UPP_BRUME Uracil phosphoribosyltransferase OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=upp PE=3 SV=1 203 380 4.0E-08
sp|C0RMK4|UPP_BRUMB Uracil phosphoribosyltransferase OS=Brucella melitensis biotype 2 (strain ATCC 23457) GN=upp PE=3 SV=1 203 380 4.0E-08
sp|Q24MM7|UPP_DESHY Uracil phosphoribosyltransferase OS=Desulfitobacterium hafniense (strain Y51) GN=upp PE=3 SV=1 201 380 4.0E-08
sp|B8FZ68|UPP_DESHD Uracil phosphoribosyltransferase OS=Desulfitobacterium hafniense (strain DCB-2 / DSM 10664) GN=upp PE=3 SV=1 201 380 4.0E-08
sp|Q12084|DAS2_YEAST Putative uridine kinase DAS2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DAS2 PE=1 SV=1 71 183 6.0E-08
sp|A6LMU0|UPP_THEM4 Uracil phosphoribosyltransferase OS=Thermosipho melanesiensis (strain DSM 12029 / CIP 104789 / BI429) GN=upp PE=3 SV=1 201 380 6.0E-08
sp|P67397|UPP_STAAW Uracil phosphoribosyltransferase OS=Staphylococcus aureus (strain MW2) GN=upp PE=3 SV=1 201 394 9.0E-08
sp|A8YY79|UPP_STAAT Uracil phosphoribosyltransferase OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=upp PE=3 SV=1 201 394 9.0E-08
sp|Q6G7J8|UPP_STAAS Uracil phosphoribosyltransferase OS=Staphylococcus aureus (strain MSSA476) GN=upp PE=3 SV=1 201 394 9.0E-08
sp|Q6GEW3|UPP_STAAR Uracil phosphoribosyltransferase OS=Staphylococcus aureus (strain MRSA252) GN=upp PE=3 SV=1 201 394 9.0E-08
sp|P67396|UPP_STAAN Uracil phosphoribosyltransferase OS=Staphylococcus aureus (strain N315) GN=upp PE=1 SV=1 201 394 9.0E-08
sp|P67395|UPP_STAAM Uracil phosphoribosyltransferase OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=upp PE=3 SV=1 201 394 9.0E-08
sp|A6QIV6|UPP_STAAE Uracil phosphoribosyltransferase OS=Staphylococcus aureus (strain Newman) GN=upp PE=3 SV=1 201 394 9.0E-08
sp|Q5HE88|UPP_STAAC Uracil phosphoribosyltransferase OS=Staphylococcus aureus (strain COL) GN=upp PE=3 SV=1 201 394 9.0E-08
sp|Q2YUJ2|UPP_STAAB Uracil phosphoribosyltransferase OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=upp PE=3 SV=1 201 394 9.0E-08
sp|A5IUQ7|UPP_STAA9 Uracil phosphoribosyltransferase OS=Staphylococcus aureus (strain JH9) GN=upp PE=3 SV=1 201 394 9.0E-08
sp|Q2FWE6|UPP_STAA8 Uracil phosphoribosyltransferase OS=Staphylococcus aureus (strain NCTC 8325) GN=upp PE=3 SV=1 201 394 9.0E-08
sp|Q2FF16|UPP_STAA3 Uracil phosphoribosyltransferase OS=Staphylococcus aureus (strain USA300) GN=upp PE=3 SV=1 201 394 9.0E-08
sp|A6U3J7|UPP_STAA2 Uracil phosphoribosyltransferase OS=Staphylococcus aureus (strain JH1) GN=upp PE=3 SV=1 201 394 9.0E-08
sp|A7X4V6|UPP_STAA1 Uracil phosphoribosyltransferase OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=upp PE=3 SV=1 201 394 9.0E-08
sp|Q49Z59|UPP_STAS1 Uracil phosphoribosyltransferase OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=upp PE=3 SV=1 201 380 1.0E-07
sp|A1R2Y2|UPP_ARTAT Uracil phosphoribosyltransferase OS=Arthrobacter aurescens (strain TC1) GN=upp PE=3 SV=1 195 394 2.0E-07
sp|Q8XXC7|UPP_RALSO Uracil phosphoribosyltransferase OS=Ralstonia solanacearum (strain GMI1000) GN=upp PE=3 SV=1 197 380 2.0E-07
sp|A6LQG6|UPP_CLOB8 Uracil phosphoribosyltransferase OS=Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052) GN=upp PE=3 SV=1 210 345 2.0E-07
sp|Q8CRN4|UPP_STAES Uracil phosphoribosyltransferase OS=Staphylococcus epidermidis (strain ATCC 12228) GN=upp PE=3 SV=1 201 394 3.0E-07
sp|Q5HMB1|UPP_STAEQ Uracil phosphoribosyltransferase OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=upp PE=3 SV=1 201 394 3.0E-07
sp|Q5MZF4|UPP_SYNP6 Uracil phosphoribosyltransferase OS=Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1) GN=upp PE=3 SV=1 265 375 4.0E-07
sp|Q31MH4|UPP_SYNE7 Uracil phosphoribosyltransferase OS=Synechococcus elongatus (strain PCC 7942) GN=upp PE=3 SV=1 265 375 4.0E-07
sp|C1ARF7|UPP_RHOOB Uracil phosphoribosyltransferase OS=Rhodococcus opacus (strain B4) GN=upp PE=3 SV=1 199 345 4.0E-07
sp|B2U8Z0|UPP_RALPJ Uracil phosphoribosyltransferase OS=Ralstonia pickettii (strain 12J) GN=upp PE=3 SV=1 203 380 4.0E-07
sp|A5UQV0|UPP_ROSS1 Uracil phosphoribosyltransferase OS=Roseiflexus sp. (strain RS-1) GN=upp PE=3 SV=1 197 380 4.0E-07
sp|P93394|UPP_TOBAC Uracil phosphoribosyltransferase OS=Nicotiana tabacum GN=UPP PE=2 SV=1 185 375 5.0E-07
sp|Q9M336|UPP_ARATH Uracil phosphoribosyltransferase, chloroplastic OS=Arabidopsis thaliana GN=UPP PE=1 SV=1 171 375 5.0E-07
sp|Q0SK44|UPP_RHOJR Uracil phosphoribosyltransferase OS=Rhodococcus jostii (strain RHA1) GN=upp PE=3 SV=1 203 380 5.0E-07
sp|B9MJ16|UPP_ACIET Uracil phosphoribosyltransferase OS=Acidovorax ebreus (strain TPSY) GN=upp PE=3 SV=1 201 338 6.0E-07
sp|A0JSM6|UPP_ARTS2 Uracil phosphoribosyltransferase OS=Arthrobacter sp. (strain FB24) GN=upp PE=3 SV=1 195 394 8.0E-07
sp|A1W748|UPP_ACISJ Uracil phosphoribosyltransferase OS=Acidovorax sp. (strain JS42) GN=upp PE=3 SV=1 201 338 9.0E-07
sp|A5CNC6|UPP_CLAM3 Uracil phosphoribosyltransferase OS=Clavibacter michiganensis subsp. michiganensis (strain NCPPB 382) GN=upp PE=3 SV=1 199 345 9.0E-07
sp|A5IYF5|UPP_MYCAP Uracil phosphoribosyltransferase OS=Mycoplasma agalactiae (strain PG2) GN=upp PE=3 SV=1 201 345 1.0E-06
sp|A7NRA6|UPP_ROSCS Uracil phosphoribosyltransferase OS=Roseiflexus castenholzii (strain DSM 13941 / HLO8) GN=upp PE=3 SV=1 203 375 2.0E-06
sp|P58998|UPP_CORGL Uracil phosphoribosyltransferase OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=upp PE=3 SV=1 210 345 2.0E-06
sp|A4QC29|UPP_CORGB Uracil phosphoribosyltransferase OS=Corynebacterium glutamicum (strain R) GN=upp PE=3 SV=1 210 345 2.0E-06
sp|B9KAQ6|UPP_THENN Uracil phosphoribosyltransferase OS=Thermotoga neapolitana (strain ATCC 49049 / DSM 4359 / NS-E) GN=upp PE=3 SV=1 197 380 2.0E-06
sp|Q1DG16|UPP_MYXXD Uracil phosphoribosyltransferase OS=Myxococcus xanthus (strain DK 1622) GN=upp PE=3 SV=1 201 341 2.0E-06
sp|A1S203|COAA_SHEAM Pantothenate kinase OS=Shewanella amazonensis (strain ATCC BAA-1098 / SB2B) GN=coaA PE=3 SV=1 26 154 3.0E-06
sp|A9BWD4|UPP_DELAS Uracil phosphoribosyltransferase OS=Delftia acidovorans (strain DSM 14801 / SPH-1) GN=upp PE=3 SV=1 196 341 3.0E-06
sp|A1B467|UPP_PARDP Uracil phosphoribosyltransferase OS=Paracoccus denitrificans (strain Pd 1222) GN=upp PE=3 SV=1 197 394 3.0E-06
sp|Q4L7Z3|UPP_STAHJ Uracil phosphoribosyltransferase OS=Staphylococcus haemolyticus (strain JCSC1435) GN=upp PE=3 SV=1 201 345 4.0E-06
sp|A4WMQ7|UPP_PYRAR Uracil phosphoribosyltransferase OS=Pyrobaculum arsenaticum (strain DSM 13514 / JCM 11321) GN=upp PE=3 SV=1 206 380 4.0E-06
sp|B5ZXI2|UPP_RHILW Uracil phosphoribosyltransferase OS=Rhizobium leguminosarum bv. trifolii (strain WSM2304) GN=upp PE=3 SV=1 201 380 4.0E-06
sp|A1SDD5|UPP_NOCSJ Uracil phosphoribosyltransferase OS=Nocardioides sp. (strain BAA-499 / JS614) GN=upp PE=3 SV=1 201 394 5.0E-06
sp|B9J6V7|UPP_AGRRK Uracil phosphoribosyltransferase OS=Agrobacterium radiobacter (strain K84 / ATCC BAA-868) GN=upp PE=3 SV=1 201 380 5.0E-06
sp|Q4JTK4|UPP_CORJK Uracil phosphoribosyltransferase OS=Corynebacterium jeikeium (strain K411) GN=upp PE=3 SV=1 210 345 5.0E-06
sp|Q1MMV8|UPP_RHIL3 Uracil phosphoribosyltransferase OS=Rhizobium leguminosarum bv. viciae (strain 3841) GN=upp PE=3 SV=1 201 380 5.0E-06
sp|Q2SZS9|UPP_BURTA Uracil phosphoribosyltransferase OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=upp PE=3 SV=1 197 380 7.0E-06
sp|B3DPH5|UPP_BIFLD Uracil phosphoribosyltransferase OS=Bifidobacterium longum (strain DJO10A) GN=upp PE=3 SV=1 210 394 7.0E-06
sp|Q9A627|UPP_CAUCR Uracil phosphoribosyltransferase OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=upp PE=3 SV=1 203 380 8.0E-06
sp|B8GYP3|UPP_CAUCN Uracil phosphoribosyltransferase OS=Caulobacter crescentus (strain NA1000 / CB15N) GN=upp PE=3 SV=1 203 380 8.0E-06
sp|B3PXN0|UPP_RHIE6 Uracil phosphoribosyltransferase OS=Rhizobium etli (strain CIAT 652) GN=upp PE=3 SV=1 201 380 9.0E-06
sp|A1W0S0|UPP_CAMJJ Uracil phosphoribosyltransferase OS=Campylobacter jejuni subsp. jejuni serotype O:23/36 (strain 81-176) GN=upp PE=3 SV=1 211 380 9.0E-06
sp|A8FMZ1|UPP_CAMJ8 Uracil phosphoribosyltransferase OS=Campylobacter jejuni subsp. jejuni serotype O:6 (strain 81116 / NCTC 11828) GN=upp PE=3 SV=1 211 380 9.0E-06
sp|C3MBH2|UPP_RHISN Uracil phosphoribosyltransferase OS=Rhizobium sp. (strain NGR234) GN=upp PE=3 SV=1 201 380 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0016301 kinase activity Yes
GO:0005524 ATP binding Yes
GO:0016772 transferase activity, transferring phosphorus-containing groups No
GO:0017076 purine nucleotide binding No
GO:0003674 molecular_function No
GO:0016740 transferase activity No
GO:0008144 drug binding No
GO:0036094 small molecule binding No
GO:1901265 nucleoside phosphate binding No
GO:0005488 binding No
GO:0097159 organic cyclic compound binding No
GO:0032559 adenyl ribonucleotide binding No
GO:0030554 adenyl nucleotide binding No
GO:0032553 ribonucleotide binding No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0032555 purine ribonucleotide binding No
GO:0003824 catalytic activity No
GO:0097367 carbohydrate derivative binding No
GO:0043168 anion binding No
GO:0043167 ion binding No
GO:0000166 nucleotide binding No
GO:1901363 heterocyclic compound binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 19 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|8971
MDSFYKTLTSEQSRLAFANEYDFDSPEAIDFDILVDRLRDLKAGKRAEIPVYSFAKHQRLEHTTSIYSPHVLILE
GIFALYDPRVLELLDMGIYCEADADTCLSRRIVRDVRERGRDIEGCIKQWFGYVKPNFEKFVEPQRKVADLIVPR
GIENQVALDMMVQFIEKKLFEKSTHHREALSRLEAASKEQPLSDRVLILKDTPQLNFMNTILQDIDTSAEDFIFY
FDRLAALIVEQALNNVHFMSMQIETPMGHKYRGLRPKGEVSAVIVLRGGSAFEPALRKTIPDCRTGRLLIQSDYS
TGEPELHYLRLPEDIHKHESVLLLDTQMASGGAALMAVQVLVDHGVALDRIVLATYSAGRLGLHRLMTVFPDITV
VVCKILADQEQRWVEKRYFRC*
Coding >Hirsu2|8971
ATGGACTCTTTCTACAAAACTTTGACATCTGAGCAGTCGAGGTTGGCCTTTGCCAATGAATACGACTTCGACTCT
CCAGAGGCAATTGACTTCGATATTCTGGTCGACCGCCTGCGGGATCTCAAGGCTGGCAAGCGAGCAGAAATCCCG
GTGTACTCGTTCGCGAAGCATCAACGTTTGGAACACACCACGTCCATCTACTCACCGCATGTGCTCATACTTGAA
GGTATATTTGCCTTGTATGATCCTCGTGTACTCGAGCTTCTGGATATGGGCATATACTGCGAAGCTGATGCAGAC
ACGTGCTTGTCGCGGCGCATCGTTCGAGACGTACGGGAGAGAGGCCGCGACATCGAGGGCTGCATCAAACAATGG
TTCGGATACGTGAAGCCCAATTTCGAGAAGTTTGTCGAGCCGCAGCGAAAAGTTGCGGATTTGATAGTGCCACGG
GGTATTGAGAACCAGGTGGCGCTCGATATGATGGTTCAATTTATTGAGAAGAAGCTTTTCGAGAAGTCGACTCAT
CATCGCGAAGCGCTCTCTCGTCTGGAAGCCGCGAGTAAAGAGCAGCCGCTTTCTGACCGGGTTTTGATCCTCAAG
GATACACCTCAGTTGAACTTCATGAATACAATTCTCCAAGATATAGATACTTCGGCGGAAGACTTCATATTTTAC
TTCGACCGTTTAGCAGCCCTCATCGTGGAGCAGGCCCTCAATAATGTGCACTTCATGAGCATGCAGATTGAGACG
CCCATGGGGCACAAGTATCGTGGCCTGAGGCCCAAGGGCGAGGTGAGTGCGGTGATTGTACTTCGGGGAGGCTCA
GCGTTCGAGCCGGCGCTCCGGAAGACGATTCCGGACTGCCGCACGGGGCGTCTCCTGATCCAGTCGGACTATTCA
ACTGGCGAGCCCGAACTTCACTACCTGAGACTGCCCGAAGATATTCACAAACATGAGAGCGTACTGCTACTGGAC
ACGCAAATGGCTAGTGGCGGCGCGGCTCTGATGGCCGTGCAAGTCTTGGTCGACCACGGGGTCGCCCTGGATCGT
ATTGTTTTGGCAACGTACTCGGCCGGCCGGCTTGGGCTGCACAGGCTGATGACGGTATTTCCCGACATCACTGTC
GTGGTCTGCAAAATTTTGGCGGACCAGGAGCAGCGATGGGTTGAAAAACGCTACTTCAGATGCTGA
Transcript >Hirsu2|8971
ATGGACTCTTTCTACAAAACTTTGACATCTGAGCAGTCGAGGTTGGCCTTTGCCAATGAATACGACTTCGACTCT
CCAGAGGCAATTGACTTCGATATTCTGGTCGACCGCCTGCGGGATCTCAAGGCTGGCAAGCGAGCAGAAATCCCG
GTGTACTCGTTCGCGAAGCATCAACGTTTGGAACACACCACGTCCATCTACTCACCGCATGTGCTCATACTTGAA
GGTATATTTGCCTTGTATGATCCTCGTGTACTCGAGCTTCTGGATATGGGCATATACTGCGAAGCTGATGCAGAC
ACGTGCTTGTCGCGGCGCATCGTTCGAGACGTACGGGAGAGAGGCCGCGACATCGAGGGCTGCATCAAACAATGG
TTCGGATACGTGAAGCCCAATTTCGAGAAGTTTGTCGAGCCGCAGCGAAAAGTTGCGGATTTGATAGTGCCACGG
GGTATTGAGAACCAGGTGGCGCTCGATATGATGGTTCAATTTATTGAGAAGAAGCTTTTCGAGAAGTCGACTCAT
CATCGCGAAGCGCTCTCTCGTCTGGAAGCCGCGAGTAAAGAGCAGCCGCTTTCTGACCGGGTTTTGATCCTCAAG
GATACACCTCAGTTGAACTTCATGAATACAATTCTCCAAGATATAGATACTTCGGCGGAAGACTTCATATTTTAC
TTCGACCGTTTAGCAGCCCTCATCGTGGAGCAGGCCCTCAATAATGTGCACTTCATGAGCATGCAGATTGAGACG
CCCATGGGGCACAAGTATCGTGGCCTGAGGCCCAAGGGCGAGGTGAGTGCGGTGATTGTACTTCGGGGAGGCTCA
GCGTTCGAGCCGGCGCTCCGGAAGACGATTCCGGACTGCCGCACGGGGCGTCTCCTGATCCAGTCGGACTATTCA
ACTGGCGAGCCCGAACTTCACTACCTGAGACTGCCCGAAGATATTCACAAACATGAGAGCGTACTGCTACTGGAC
ACGCAAATGGCTAGTGGCGGCGCGGCTCTGATGGCCGTGCAAGTCTTGGTCGACCACGGGGTCGCCCTGGATCGT
ATTGTTTTGGCAACGTACTCGGCCGGCCGGCTTGGGCTGCACAGGCTGATGACGGTATTTCCCGACATCACTGTC
GTGGTCTGCAAAATTTTGGCGGACCAGGAGCAGCGATGGGTTGAAAAACGCTACTTCAGATGCTGA
Gene >Hirsu2|8971
ATGGTAAGGGAGCCCCGTCTACGCGATGGCGGCTGCTGTGACAAAGCTGACAACCGGCCAGGACTCTTTCTACAA
AACTTTGACATCTGAGCAGTCGAGGTTGGCCTTTGCCAATGAATACGACTTCGACTCTCCAGAGGTAAAGCGCCC
TACCGTGCCATGTTCAGATACGAGACCACTCAACATGCATTTTTGTACAATTAAGGCAATTGACTTCGATATTCT
GGTCGACCGCCTGCGGGATCTCAAGGCTGGGTGACGGCCCCTGCCCCTCAGAAAAAATTCAACGCACGTACTGAT
TGATTCGTCGGATAGCAAGCGAGCAGAAATCCCGGTGTACTCGTTCGCGAAGCATCAACGTTTGGAACACACCAC
GTCCATCTACTCACCGCATGTGCTCATACTTGAAGGTATATTTGCCTTGTATGATCCTCGTGTACTCGAGCTTCT
GGATATGGGCGTGCGTCGAACCCACCTGTTCCCGTAGACATCATGGTTGGGGGTTGACATGGCCTCAGATATACT
GCGAAGCTGATGCAGACACGTGCTTGTCGCGGCGCAGTGAGTGAGCCTGCTTCCTTCCAATGGGTTTTTCTGTCG
CCTGTCGCGCGTCAACGTCAGAGAATCCTGATATATTCTTGGGTCAAGTCGTTCGAGACGTACGGGAGAGAGGCC
GCGACATCGAGGGCTGCATCAAACAATGGTTCGGATACGTGAAGCCCAATTTCGAGAAGGTGAATAGCACCGCCT
GTGGTCGTATTTTGGTGCTAACCCTCCGACAGTTTGTCGAGCCGCAGCGAAAAGTTGCGGATTTGATAGTGCCAC
GGGGTATTGAGAACCAGGTGGCGCTCGGTAAGCTGGGCTCCACCGACGCCGTGTTGTACTCCGCATGCTCTTTGT
GCTAAACGTGACCTCGAGATATGATGGTTCAATTTATTGAGAAGAAGCTTTTCGAGAAGTCGACTCATCATCGCG
AAGCGCTCTCTCGTCTGGAAGCCGCGAGTAAAGAGCAGCCGCTTTCTGACCGGGTTTTGATCCTCAAGGATACAC
CTCAGTTGAACTTCATGAATACAATTCTCCAAGATATAGATACTTCGGCGGAAGACTTCATATTTTACTTCGACC
GTTTAGCAGCCCTCATCGTGGAGCAGTGAGTTGACTGCCAAACCGCCTGTAAACGGGCAGGAGACGTTCTAACCG
GCTTTGCAGGGCCCTCAATAATGTGCACTTCATGAGCATGCAGATTGAGACGCCCATGGGGCACAAGTATCGTGG
CCTGAGGCCCAAGGGCGAGGTGAGTGCGGTGATTGTACTTCGGGGAGGCTCAGCGTTCGAGCCGGCGCTCCGGAA
GACGATTCCGGACTGCCGCACGGGGCGTCTCCTGATCCAGTCGGACTATTCAACTGGCGAGCCCGAACTTCACTA
CCTGAGACTGCCCGAAGATATTCACAAACATGAGAGCGTACTGCTACTGGACACGCAAATGGCTAGTGGCGGCGC
GGCTCTGATGGCCGTGCAAGTCTTGGTCGACCACGGGGTCGCCCTGGATCGTATTGTTTTGGCAACGTACTCGGC
CGGCCGGCTTGGGCTGCACAGGCTGATGACGGTATTTCCCGACATCACTGTCGTGGTCTGCAAAATTTTGGCGGA
CCAGGAGCAGCGATGGGTTGAAAAACGCTACTTCAGATGCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail