Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|8969
Gene name
LocationContig_62:21818..22541
Strand+
Gene length (bp)723
Transcript length (bp)555
Coding sequence length (bp)555
Protein length (aa) 185

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04800 ETC_C1_NDUFA4 ETC complex I subunit conserved region 4.4E-30 94 180

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P25711|NDUS4_NEUCR NADH-ubiquinone oxidoreductase 21 kDa subunit, mitochondrial OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=nuo-21 PE=1 SV=2 4 180 5.0E-70
sp|P0CB96|NDUS4_PONPY NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial OS=Pongo pygmaeus GN=NDUFS4 PE=2 SV=1 75 170 2.0E-15
sp|P0CB95|NDUS4_PONAB NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial OS=Pongo abelii GN=NDUFS4 PE=2 SV=1 75 170 2.0E-15
sp|Q9CXZ1|NDUS4_MOUSE NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial OS=Mus musculus GN=Ndufs4 PE=1 SV=3 78 170 3.0E-15
sp|O43181|NDUS4_HUMAN NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial OS=Homo sapiens GN=NDUFS4 PE=1 SV=1 75 170 5.0E-15
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P25711|NDUS4_NEUCR NADH-ubiquinone oxidoreductase 21 kDa subunit, mitochondrial OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=nuo-21 PE=1 SV=2 4 180 5.0E-70
sp|P0CB96|NDUS4_PONPY NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial OS=Pongo pygmaeus GN=NDUFS4 PE=2 SV=1 75 170 2.0E-15
sp|P0CB95|NDUS4_PONAB NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial OS=Pongo abelii GN=NDUFS4 PE=2 SV=1 75 170 2.0E-15
sp|Q9CXZ1|NDUS4_MOUSE NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial OS=Mus musculus GN=Ndufs4 PE=1 SV=3 78 170 3.0E-15
sp|O43181|NDUS4_HUMAN NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial OS=Homo sapiens GN=NDUFS4 PE=1 SV=1 75 170 5.0E-15
sp|Q0MQH0|NDUS4_GORGO NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial OS=Gorilla gorilla gorilla GN=NDUFS4 PE=2 SV=1 75 170 5.0E-15
sp|Q66XS7|NDUS4_GECJA NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial OS=Gecko japonicus GN=NDUFS4 PE=2 SV=1 31 170 1.0E-14
sp|Q02375|NDUS4_BOVIN NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial OS=Bos taurus GN=NDUFS4 PE=1 SV=1 75 170 1.0E-14
sp|Q5XIF3|NDUS4_RAT NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial OS=Rattus norvegicus GN=Ndufs4 PE=1 SV=1 76 169 3.0E-14
sp|Q0MQH1|NDUS4_PANTR NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial OS=Pan troglodytes GN=NDUFS4 PE=2 SV=1 75 170 6.0E-14
sp|Q9FJW4|NDUS4_ARATH NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial OS=Arabidopsis thaliana GN=FRO1 PE=2 SV=1 83 173 1.0E-12
sp|Q8T1V6|NDUS4_DICDI NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial OS=Dictyostelium discoideum GN=ndufs4 PE=3 SV=2 88 184 4.0E-09
[Show less]

GO

GO Term Description Terminal node
GO:0022900 electron transport chain Yes
GO:0016651 oxidoreductase activity, acting on NAD(P)H Yes
GO:0016491 oxidoreductase activity No
GO:0009987 cellular process No
GO:0008152 metabolic process No
GO:0008150 biological_process No
GO:0044237 cellular metabolic process No
GO:0003674 molecular_function No
GO:0006091 generation of precursor metabolites and energy No
GO:0003824 catalytic activity No
GO:0055114 oxidation-reduction process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 18 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|8969
MASLGSKSAARLWRNASNPRVPFTVGTQRFQSIVAKPSSAVPHAAASNQPDYEIQPDKATSTFTPVPKRIQNGSE
DILPAAVVSGAPLELQARTVRIYREAKPATQSGDFRGHHWRMDWDILPKGHRWENQLMGWQSSGDFMQGTHVNFK
SKEDAIFFAEKQGYEYFVQEPNSRKFTPKATYQG*
Coding >Hirsu2|8969
ATGGCTTCCCTCGGAAGCAAGAGCGCAGCCAGGCTGTGGCGGAATGCCTCTAACCCACGCGTGCCCTTCACCGTC
GGCACTCAACGCTTTCAAAGCATCGTCGCGAAACCCTCGAGCGCGGTCCCTCATGCTGCCGCTTCGAACCAGCCG
GACTATGAAATACAGCCGGACAAGGCGACTTCAACTTTCACCCCCGTGCCGAAGCGAATCCAGAACGGTAGCGAG
GACATTCTTCCTGCGGCCGTTGTCTCCGGCGCCCCCCTAGAACTTCAGGCCCGAACTGTTCGGATTTATAGGGAG
GCCAAGCCTGCTACCCAATCTGGGGACTTCAGAGGGCATCACTGGCGCATGGACTGGGACATTCTCCCCAAAGGA
CACCGTTGGGAGAACCAGCTGATGGGATGGCAGTCATCAGGAGACTTCATGCAAGGTACCCACGTCAACTTCAAG
TCCAAGGAGGATGCGATTTTTTTTGCGGAGAAACAGGGCTACGAATACTTTGTTCAGGAGCCGAACTCGCGCAAG
TTCACGCCTAAGGCCACCTATCAGGGCTAA
Transcript >Hirsu2|8969
ATGGCTTCCCTCGGAAGCAAGAGCGCAGCCAGGCTGTGGCGGAATGCCTCTAACCCACGCGTGCCCTTCACCGTC
GGCACTCAACGCTTTCAAAGCATCGTCGCGAAACCCTCGAGCGCGGTCCCTCATGCTGCCGCTTCGAACCAGCCG
GACTATGAAATACAGCCGGACAAGGCGACTTCAACTTTCACCCCCGTGCCGAAGCGAATCCAGAACGGTAGCGAG
GACATTCTTCCTGCGGCCGTTGTCTCCGGCGCCCCCCTAGAACTTCAGGCCCGAACTGTTCGGATTTATAGGGAG
GCCAAGCCTGCTACCCAATCTGGGGACTTCAGAGGGCATCACTGGCGCATGGACTGGGACATTCTCCCCAAAGGA
CACCGTTGGGAGAACCAGCTGATGGGATGGCAGTCATCAGGAGACTTCATGCAAGGTACCCACGTCAACTTCAAG
TCCAAGGAGGATGCGATTTTTTTTGCGGAGAAACAGGGCTACGAATACTTTGTTCAGGAGCCGAACTCGCGCAAG
TTCACGCCTAAGGCCACCTATCAGGGCTAA
Gene >Hirsu2|8969
ATGGCTTCCCTCGGAAGCAAGAGCGCAGCCAGGCTGTGGCGGAATGCCTCTAACCCACGCGTGCCCTTCACCGTC
GGCACTCAACGCTTTCAAAGCATCGTCGCGAAACCCTCGAGCGCGGTCCCTCATGCTGCCGCTTCGAACCAGCCG
GACTATGAAATACAGCCGGACAAGGCGACTTCGTACGTGCAGCTGCTTAAAATGAAGGCTTCGAAATAGCTGAAT
TCGTCTTAGAACTTTCACCCCCGTGCCGAAGCGAATCCAGAACGGTAGCGAGGACATTCTTCCTGCGGCCGTTGT
CTCCGGCGCCCCCCTAGAACTTCAGGCCCGAACTGTTCGGTCAGTTCCAGCTCGCTAGACTCGAAGATGCGCAAA
ACCTGACGTGGCTTCAGGATTTATAGGGAGGCCAAGCCTGCTACCCAATCTGGGGACTTCAGAGGGCATCACTGG
CGCATGGACTGGGACATTCTCCCCAAAGGACACCGTTGGGAGAACCAGCTGATGGGATGGCAGTCATCAGGAGAC
TTCATGCAAGGTACCCACGTCAACTTCAAGTCCAAGGAGGATGCGATTTTTTTTGCGGAGAAACAGGGCTACGAA
TACTTTGTTCAGGAGCCGAACTCGCGCAAGTTCACGCCTAAGGCGTACGCGAACAATTTCCTTTACTCTGCCACT
AAACTTAAGCATATTCGGACTAAATGATATAGCACCTATCAGGGCTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail