Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|8963
Gene name
LocationContig_62:5148..6126
Strand+
Gene length (bp)978
Transcript length (bp)978
Coding sequence length (bp)978
Protein length (aa) 326

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00929 RNase_T Exonuclease 1.7E-14 138 287

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q4IEV5|REXO4_GIBZE RNA exonuclease 4 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=REX4 PE=3 SV=1 1 305 7.0E-138
sp|Q7S9B7|REXO4_NEUCR RNA exonuclease 4 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=rex-4 PE=3 SV=1 133 302 1.0E-77
sp|Q6BIK6|REXO4_DEBHA RNA exonuclease 4 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=REX4 PE=3 SV=2 4 295 2.0E-68
sp|Q4WHF8|REXO4_ASPFU RNA exonuclease 4 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=rex4 PE=3 SV=1 117 302 3.0E-64
sp|Q6FQA0|REXO4_CANGA RNA exonuclease 4 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=REX4 PE=3 SV=1 132 302 4.0E-62
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q4IEV5|REXO4_GIBZE RNA exonuclease 4 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=REX4 PE=3 SV=1 1 305 7.0E-138
sp|Q7S9B7|REXO4_NEUCR RNA exonuclease 4 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=rex-4 PE=3 SV=1 133 302 1.0E-77
sp|Q6BIK6|REXO4_DEBHA RNA exonuclease 4 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=REX4 PE=3 SV=2 4 295 2.0E-68
sp|Q4WHF8|REXO4_ASPFU RNA exonuclease 4 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=rex4 PE=3 SV=1 117 302 3.0E-64
sp|Q6FQA0|REXO4_CANGA RNA exonuclease 4 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=REX4 PE=3 SV=1 132 302 4.0E-62
sp|Q08237|REXO4_YEAST RNA exonuclease 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=REX4 PE=1 SV=1 4 302 3.0E-61
sp|Q6CMT3|REXO4_KLULA RNA exonuclease 4 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=REX4 PE=3 SV=1 133 307 4.0E-55
sp|O94375|REXO4_SCHPO RNA exonuclease 4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rex4 PE=3 SV=1 87 295 1.0E-54
sp|Q4PER6|REXO4_USTMA RNA exonuclease 4 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=REX4 PE=3 SV=1 128 295 6.0E-54
sp|Q5A3Q0|REXO4_CANAL RNA exonuclease 4 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=REX4 PE=3 SV=1 1 301 2.0E-53
sp|Q757I9|REXO4_ASHGO RNA exonuclease 4 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=REX4 PE=3 SV=1 133 303 3.0E-53
sp|P0CQ44|REXO4_CRYNJ RNA exonuclease 4 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=REX4 PE=3 SV=1 124 295 4.0E-53
sp|P0CQ45|REXO4_CRYNB RNA exonuclease 4 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=REX4 PE=3 SV=1 124 295 4.0E-53
sp|Q6PAQ4|REXO4_MOUSE RNA exonuclease 4 OS=Mus musculus GN=Rexo4 PE=2 SV=2 133 304 4.0E-44
sp|Q91560|REXO4_XENLA RNA exonuclease 4 OS=Xenopus laevis GN=rexo4 PE=2 SV=2 133 302 1.0E-43
sp|Q6DEW6|REXO4_XENTR RNA exonuclease 4 OS=Xenopus tropicalis GN=rexo4 PE=2 SV=1 133 303 4.0E-43
sp|Q6CE69|REXO4_YARLI RNA exonuclease 4 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=REX4 PE=3 SV=1 134 294 2.0E-42
sp|Q9GZR2|REXO4_HUMAN RNA exonuclease 4 OS=Homo sapiens GN=REXO4 PE=1 SV=2 133 287 3.0E-42
sp|Q8WTP8|AEN_HUMAN Apoptosis-enhancing nuclease OS=Homo sapiens GN=AEN PE=1 SV=2 126 288 4.0E-32
sp|Q2YDK1|I20L2_BOVIN Interferon-stimulated 20 kDa exonuclease-like 2 OS=Bos taurus GN=ISG20L2 PE=2 SV=1 112 288 6.0E-31
sp|Q5REE2|AEN_PONAB Apoptosis-enhancing nuclease OS=Pongo abelii GN=AEN PE=2 SV=1 126 288 7.0E-31
sp|Q96AZ6|ISG20_HUMAN Interferon-stimulated gene 20 kDa protein OS=Homo sapiens GN=ISG20 PE=1 SV=2 135 288 4.0E-30
sp|Q9H9L3|I20L2_HUMAN Interferon-stimulated 20 kDa exonuclease-like 2 OS=Homo sapiens GN=ISG20L2 PE=1 SV=1 135 288 1.0E-29
sp|Q66UW5|ISG20_PIG Interferon-stimulated gene 20 kDa protein OS=Sus scrofa GN=Isg20 PE=1 SV=2 135 288 3.0E-29
sp|Q3U1G5|I20L2_MOUSE Interferon-stimulated 20 kDa exonuclease-like 2 OS=Mus musculus GN=Isg20l2 PE=1 SV=2 134 288 9.0E-29
sp|Q6AXU3|I20L2_RAT Interferon-stimulated 20 kDa exonuclease-like 2 OS=Rattus norvegicus GN=Isg20l2 PE=2 SV=1 135 288 1.0E-28
sp|B2GUW6|AEN_RAT Apoptosis-enhancing nuclease OS=Rattus norvegicus GN=Aen PE=2 SV=1 135 288 1.0E-27
sp|Q9CZI9|AEN_MOUSE Apoptosis-enhancing nuclease OS=Mus musculus GN=Aen PE=2 SV=1 135 288 5.0E-27
sp|Q9JL16|ISG20_MOUSE Interferon-stimulated gene 20 kDa protein OS=Mus musculus GN=Isg20 PE=1 SV=1 129 303 2.0E-23
sp|Q9FFG1|SDN2_ARATH Small RNA degrading nuclease 2 OS=Arabidopsis thaliana GN=SDN2 PE=2 SV=1 131 286 3.0E-19
sp|A3KPE8|SDN1_ARATH Small RNA degrading nuclease 1 OS=Arabidopsis thaliana GN=SDN1 PE=2 SV=1 129 286 4.0E-19
sp|Q8L7M4|SDN5_ARATH Small RNA degrading nuclease 5 OS=Arabidopsis thaliana GN=SDN5 PE=2 SV=2 135 294 1.0E-18
sp|P53331|REXO1_YEAST RNA exonuclease 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RNH70 PE=1 SV=1 137 286 6.0E-18
sp|O94443|YFE9_SCHPO Uncharacterized exonuclease C637.09 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC637.09 PE=3 SV=2 135 294 6.0E-18
sp|Q54U94|REXO4_DICDI RNA exonuclease 4 OS=Dictyostelium discoideum GN=rexo4 PE=3 SV=1 132 306 4.0E-17
sp|Q6FIU7|REXO3_CANGA RNA exonuclease 3 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=REX3 PE=3 SV=1 137 284 7.0E-17
sp|Q6CFE7|REXO3_YARLI RNA exonuclease 3 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=REX3 PE=3 SV=1 129 293 1.0E-14
sp|Q8RXK2|SDN3_ARATH Small RNA degrading nuclease 3 OS=Arabidopsis thaliana GN=SDN3 PE=1 SV=1 128 286 2.0E-14
sp|Q96IC2|REXON_HUMAN Putative RNA exonuclease NEF-sp OS=Homo sapiens GN=44M2.3 PE=2 SV=1 137 292 3.0E-14
sp|Q4R9F7|REXON_MACFA Putative RNA exonuclease NEF-sp OS=Macaca fascicularis GN=QtsA-10054 PE=2 SV=1 137 292 5.0E-14
sp|Q2T9U5|REXON_BOVIN Putative RNA exonuclease NEF-sp OS=Bos taurus PE=2 SV=1 137 292 2.0E-13
sp|Q10124|PQE1_CAEEL Putative RNA exonuclease pqe-1 OS=Caenorhabditis elegans GN=pqe-1 PE=3 SV=2 135 287 1.0E-12
sp|Q750A5|REXO3_ASHGO RNA exonuclease 3 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=REX3 PE=3 SV=1 137 297 2.0E-12
sp|A5DAD0|PAN2_PICGU PAB-dependent poly(A)-specific ribonuclease subunit PAN2 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=PAN2 PE=3 SV=3 132 291 1.0E-11
sp|P48778|GOR_PANTR Exonuclease GOR OS=Pan troglodytes GN=REXO1L1 PE=2 SV=3 138 286 1.0E-11
sp|Q5AL29|REXO3_CANAL RNA exonuclease 3 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=REX3 PE=3 SV=1 134 280 2.0E-11
sp|Q7TT28|REXO1_MOUSE RNA exonuclease 1 homolog OS=Mus musculus GN=Rexo1 PE=1 SV=1 137 287 1.0E-10
sp|Q754X1|PAN2_ASHGO PAB-dependent poly(A)-specific ribonuclease subunit PAN2 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=PAN2 PE=3 SV=2 134 290 2.0E-10
sp|Q9SN09|SDN4_ARATH Putative small RNA degrading nuclease 4 OS=Arabidopsis thaliana GN=SDN4 PE=3 SV=1 134 279 2.0E-10
sp|Q8IX06|GOR_HUMAN Putative exonuclease GOR OS=Homo sapiens GN=REXO1L1P PE=5 SV=2 138 286 2.0E-10
sp|Q5APK0|PAN2_CANAL PAB-dependent poly(A)-specific ribonuclease subunit PAN2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=PAN2 PE=3 SV=1 134 291 3.0E-10
sp|P53010|PAN2_YEAST PAB-dependent poly(A)-specific ribonuclease subunit PAN2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PAN2 PE=1 SV=1 153 290 1.0E-09
sp|A3LRV8|PAN2_PICST PAB-dependent poly(A)-specific ribonuclease subunit PAN2 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=PAN2 PE=3 SV=2 133 290 1.0E-08
sp|Q6FS70|PAN2_CANGA PAB-dependent poly(A)-specific ribonuclease subunit PAN2 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=PAN2 PE=3 SV=1 134 290 2.0E-08
sp|A5E1W0|PAN2_LODEL PAB-dependent poly(A)-specific ribonuclease subunit PAN2 OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=PAN2 PE=3 SV=1 165 290 3.0E-08
sp|Q504Q3|PAN2_HUMAN PAB-dependent poly(A)-specific ribonuclease subunit PAN2 OS=Homo sapiens GN=PAN2 PE=1 SV=3 152 290 3.0E-08
sp|Q6IE70|PAN2_RAT PAB-dependent poly(A)-specific ribonuclease subunit PAN2 OS=Rattus norvegicus GN=Pan2 PE=2 SV=1 152 290 3.0E-08
sp|A4RF51|PAN2_MAGO7 PAB-dependent poly(A)-specific ribonuclease subunit PAN2 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=PAN2 PE=3 SV=3 154 291 4.0E-08
sp|Q8BGF7|PAN2_MOUSE PAB-dependent poly(A)-specific ribonuclease subunit PAN2 OS=Mus musculus GN=Pan2 PE=1 SV=1 152 290 4.0E-08
sp|Q5F450|PAN2_CHICK PAB-dependent poly(A)-specific ribonuclease subunit PAN2 OS=Gallus gallus GN=PAN2 PE=2 SV=1 152 290 4.0E-08
sp|Q6CJB5|REXO3_KLULA RNA exonuclease 3 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=REX3 PE=3 SV=1 137 289 5.0E-08
sp|Q6C462|PAN2_YARLI PAB-dependent poly(A)-specific ribonuclease subunit PAN2 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=PAN2 PE=3 SV=2 154 291 1.0E-07
sp|P0CQ08|PAN2_CRYNJ PAB-dependent poly(A)-specific ribonuclease subunit PAN2 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=PAN2 PE=3 SV=1 119 288 1.0E-07
sp|P0CQ09|PAN2_CRYNB PAB-dependent poly(A)-specific ribonuclease subunit PAN2 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=PAN2 PE=3 SV=1 119 288 1.0E-07
sp|Q8N1G1|REXO1_HUMAN RNA exonuclease 1 homolog OS=Homo sapiens GN=REXO1 PE=1 SV=3 127 287 1.0E-07
sp|Q6CMN5|PAN2_KLULA PAB-dependent poly(A)-specific ribonuclease subunit PAN2 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=PAN2 PE=3 SV=1 136 290 3.0E-07
sp|Q2GSV2|PAN2_CHAGB PAB-dependent poly(A)-specific ribonuclease subunit PAN2 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=PAN2 PE=3 SV=2 154 290 1.0E-06
sp|Q7S9B7|REXO4_NEUCR RNA exonuclease 4 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=rex-4 PE=3 SV=1 3 110 3.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 41 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|8963
MAELSSNWKRLQAKIKGEGTSAASSKRKTIGGPNASAKKRKFTSNKDATAAASRQPNNRPAGQQLTMGGVHSSTA
KEELGDGVSPSLALWAKDNNISAETLAEAYGLGLRVNSATLESQNDRVNHGLSAGIEMGKYMAIDCEMVGVGPGG
YESALARVSLVDFHGKQIYDSFVKQRERVTDWRTAVSGVSQKEMRFARDFQEVQEQVADILKDRVLVGHDVKHDL
AALKLSHPARDTRDTAKYAGFRRFGHGRKPALRVLAKQLLGVEIQGGPHSSIEDARVTMLLFRKHKPGFDVDHAN
RYAPKPCYSSQTPKKKQSGRKKGRN*
Coding >Hirsu2|8963
ATGGCAGAACTTTCTTCGAACTGGAAGAGACTGCAGGCAAAGATAAAGGGTGAGGGAACATCAGCAGCCTCATCA
AAACGAAAAACGATCGGAGGTCCAAACGCCTCAGCAAAGAAGCGAAAGTTCACGTCCAACAAGGACGCGACAGCA
GCGGCAAGCAGACAGCCAAACAATCGGCCGGCCGGCCAACAGCTGACCATGGGCGGTGTCCATAGCTCCACCGCC
AAAGAGGAGCTTGGAGATGGCGTTTCACCTTCGCTTGCTCTGTGGGCGAAAGACAATAACATCTCGGCCGAGACG
TTAGCAGAAGCTTACGGCCTAGGCCTGCGTGTTAACTCGGCGACTTTGGAGTCGCAAAATGACAGAGTCAACCAC
GGCTTGTCTGCTGGCATCGAAATGGGAAAGTATATGGCTATAGACTGCGAGATGGTTGGCGTCGGTCCAGGAGGG
TATGAGTCGGCGCTGGCGAGAGTCAGCCTGGTAGATTTTCACGGGAAGCAAATCTACGACTCGTTTGTGAAGCAA
AGAGAGAGGGTCACAGACTGGAGAACCGCCGTGAGTGGTGTCTCTCAGAAAGAAATGAGATTCGCGAGGGATTTT
CAGGAGGTGCAGGAGCAGGTCGCCGACATCCTCAAAGATCGAGTCTTGGTCGGACACGACGTCAAGCATGATCTG
GCCGCCTTGAAGCTTAGCCATCCGGCCCGAGACACTCGAGATACAGCCAAATACGCCGGCTTTAGAAGATTTGGA
CATGGTAGGAAACCGGCTCTCAGGGTGCTAGCCAAACAGCTCCTCGGAGTCGAGATTCAAGGCGGACCTCATTCC
AGCATCGAAGATGCTCGAGTCACAATGTTGCTCTTCCGCAAACACAAGCCCGGATTCGATGTCGATCATGCCAAT
CGCTACGCCCCCAAGCCTTGTTACTCAAGCCAAACCCCAAAGAAGAAGCAGAGTGGTAGAAAAAAGGGTCGAAAT
TGA
Transcript >Hirsu2|8963
ATGGCAGAACTTTCTTCGAACTGGAAGAGACTGCAGGCAAAGATAAAGGGTGAGGGAACATCAGCAGCCTCATCA
AAACGAAAAACGATCGGAGGTCCAAACGCCTCAGCAAAGAAGCGAAAGTTCACGTCCAACAAGGACGCGACAGCA
GCGGCAAGCAGACAGCCAAACAATCGGCCGGCCGGCCAACAGCTGACCATGGGCGGTGTCCATAGCTCCACCGCC
AAAGAGGAGCTTGGAGATGGCGTTTCACCTTCGCTTGCTCTGTGGGCGAAAGACAATAACATCTCGGCCGAGACG
TTAGCAGAAGCTTACGGCCTAGGCCTGCGTGTTAACTCGGCGACTTTGGAGTCGCAAAATGACAGAGTCAACCAC
GGCTTGTCTGCTGGCATCGAAATGGGAAAGTATATGGCTATAGACTGCGAGATGGTTGGCGTCGGTCCAGGAGGG
TATGAGTCGGCGCTGGCGAGAGTCAGCCTGGTAGATTTTCACGGGAAGCAAATCTACGACTCGTTTGTGAAGCAA
AGAGAGAGGGTCACAGACTGGAGAACCGCCGTGAGTGGTGTCTCTCAGAAAGAAATGAGATTCGCGAGGGATTTT
CAGGAGGTGCAGGAGCAGGTCGCCGACATCCTCAAAGATCGAGTCTTGGTCGGACACGACGTCAAGCATGATCTG
GCCGCCTTGAAGCTTAGCCATCCGGCCCGAGACACTCGAGATACAGCCAAATACGCCGGCTTTAGAAGATTTGGA
CATGGTAGGAAACCGGCTCTCAGGGTGCTAGCCAAACAGCTCCTCGGAGTCGAGATTCAAGGCGGACCTCATTCC
AGCATCGAAGATGCTCGAGTCACAATGTTGCTCTTCCGCAAACACAAGCCCGGATTCGATGTCGATCATGCCAAT
CGCTACGCCCCCAAGCCTTGTTACTCAAGCCAAACCCCAAAGAAGAAGCAGAGTGGTAGAAAAAAGGGTCGAAAT
TGA
Gene >Hirsu2|8963
ATGGCAGAACTTTCTTCGAACTGGAAGAGACTGCAGGCAAAGATAAAGGGTGAGGGAACATCAGCAGCCTCATCA
AAACGAAAAACGATCGGAGGTCCAAACGCCTCAGCAAAGAAGCGAAAGTTCACGTCCAACAAGGACGCGACAGCA
GCGGCAAGCAGACAGCCAAACAATCGGCCGGCCGGCCAACAGCTGACCATGGGCGGTGTCCATAGCTCCACCGCC
AAAGAGGAGCTTGGAGATGGCGTTTCACCTTCGCTTGCTCTGTGGGCGAAAGACAATAACATCTCGGCCGAGACG
TTAGCAGAAGCTTACGGCCTAGGCCTGCGTGTTAACTCGGCGACTTTGGAGTCGCAAAATGACAGAGTCAACCAC
GGCTTGTCTGCTGGCATCGAAATGGGAAAGTATATGGCTATAGACTGCGAGATGGTTGGCGTCGGTCCAGGAGGG
TATGAGTCGGCGCTGGCGAGAGTCAGCCTGGTAGATTTTCACGGGAAGCAAATCTACGACTCGTTTGTGAAGCAA
AGAGAGAGGGTCACAGACTGGAGAACCGCCGTGAGTGGTGTCTCTCAGAAAGAAATGAGATTCGCGAGGGATTTT
CAGGAGGTGCAGGAGCAGGTCGCCGACATCCTCAAAGATCGAGTCTTGGTCGGACACGACGTCAAGCATGATCTG
GCCGCCTTGAAGCTTAGCCATCCGGCCCGAGACACTCGAGATACAGCCAAATACGCCGGCTTTAGAAGATTTGGA
CATGGTAGGAAACCGGCTCTCAGGGTGCTAGCCAAACAGCTCCTCGGAGTCGAGATTCAAGGCGGACCTCATTCC
AGCATCGAAGATGCTCGAGTCACAATGTTGCTCTTCCGCAAACACAAGCCCGGATTCGATGTCGATCATGCCAAT
CGCTACGCCCCCAAGCCTTGTTACTCAAGCCAAACCCCAAAGAAGAAGCAGAGTGGTAGAAAAAAGGGTCGAAAT
TGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail